diff --git a/.gitattributes b/.gitattributes new file mode 100644 index 00000000..842f366d --- /dev/null +++ b/.gitattributes @@ -0,0 +1,27 @@ +# Auto detect text files and perform LF normalization +* text=auto + +# Custom for Visual Studio +*.cs diff=csharp +*.sln merge=union +*.csproj merge=union +*.vbproj merge=union +*.fsproj merge=union +*.dbproj merge=union + +# Standard to msysgit +*.doc diff=astextplain +*.DOC diff=astextplain +*.docx diff=astextplain +*.DOCX diff=astextplain +*.dot diff=astextplain +*.DOT diff=astextplain +*.pdf diff=astextplain +*.PDF diff=astextplain +*.rtf diff=astextplain +*.RTF diff=astextplain + +# make sure *nix stays *nix +*.sh eol=lf +*.conf eol=lf +dotnet-test-nunit eol=lf diff --git a/.github/workflows/ci.yml b/.github/workflows/ci.yml new file mode 100644 index 00000000..c1b364ea --- /dev/null +++ b/.github/workflows/ci.yml @@ -0,0 +1,41 @@ +name: ci + +on: + push: + branches: + - main + paths-ignore: + - 'doc/**' + - '*.md' + + pull_request: + branches: + - main + paths-ignore: + - 'doc/**' + - '*.md' + +jobs: + build-windows: + runs-on: windows-latest + steps: + - uses: actions/checkout@v2 + - name: Run './build.cmd ci' + run: ./build.cmd ci + + build-linux: + runs-on: ubuntu-latest + steps: + - uses: actions/checkout@v2 + - name: Run './build.cmd ci' + run: ./build.sh ci + + publish: + runs-on: ubuntu-latest + needs: [ build-windows, build-linux ] + steps: + - uses: actions/checkout@v2 + - name: Publish + run: ./build.sh publish + env: + NuGetApiKey: ${{ secrets.NUGET_API_KEY }} diff --git a/.github/workflows/publish.yml b/.github/workflows/publish.yml new file mode 100644 index 00000000..a6216779 --- /dev/null +++ b/.github/workflows/publish.yml @@ -0,0 +1,39 @@ +name: Publish + +on: + push: + tags: + - 'v*.*.*' + +jobs: + build: + + runs-on: ubuntu-latest + env: + DOTNET_NOLOGO: true + DOTNET_CLI_TELEMETRY_OPTOUT: 1 + + steps: + - name: Checkout source code + uses: actions/checkout@v2 + + - name: Setup dotnet 2.1 + uses: actions/setup-dotnet@v1 + with: + dotnet-version: 2.1.* + + - name: Setup dotnet 3.1 + uses: actions/setup-dotnet@v1 + with: + dotnet-version: 3.1.* + + - name: Setup dotnet 5.0 + uses: actions/setup-dotnet@v1 + with: + dotnet-version: 5.0.* + + - name: Test + run: ./build.cmd ci test pack + + - name: Push with dotnet + run: dotnet nuget push artifacts/*.*nupkg --api-key ${{ secrets.NUGET_API_KEY }} --source https://api.nuget.org/v3/index.json \ No newline at end of file diff --git a/.gitignore b/.gitignore index 839a39a2..dfaedfb1 100644 --- a/.gitignore +++ b/.gitignore @@ -87,3 +87,4 @@ PrecompiledWeb project.lock.json BenchmarkDotNet.Artifacts* +/artifacts diff --git a/.nuke/build.schema.json b/.nuke/build.schema.json new file mode 100644 index 00000000..3b1d87c3 --- /dev/null +++ b/.nuke/build.schema.json @@ -0,0 +1,155 @@ +{ + "$schema": "http://json-schema.org/draft-04/schema#", + "title": "Build Schema", + "$ref": "#/definitions/build", + "definitions": { + "build": { + "type": "object", + "properties": { + "BuildEms": { + "type": "boolean", + "description": "Build EMS" + }, + "Configuration": { + "type": "string", + "description": "Configuration to build - Default is 'Debug' (local) or 'Release' (server)", + "enum": [ + "Debug", + "Release" + ] + }, + "Continue": { + "type": "boolean", + "description": "Indicates to continue a previously failed build attempt" + }, + "Help": { + "type": "boolean", + "description": "Shows the help text for this build assembly" + }, + "Host": { + "type": "string", + "description": "Host for execution. Default is 'automatic'", + "enum": [ + "AppVeyor", + "AzurePipelines", + "Bamboo", + "Bitrise", + "GitHubActions", + "GitLab", + "Jenkins", + "Rider", + "SpaceAutomation", + "TeamCity", + "Terminal", + "TravisCI", + "VisualStudio", + "VSCode" + ] + }, + "NoLogo": { + "type": "boolean", + "description": "Disables displaying the NUKE logo" + }, + "NuGetApiKey": { + "type": "string", + "default": "Secrets must be entered via 'nuke :secret [profile]'" + }, + "NuGetSource": { + "type": "string" + }, + "Partition": { + "type": "string", + "description": "Partition to use on CI" + }, + "Plan": { + "type": "boolean", + "description": "Shows the execution plan (HTML)" + }, + "Profile": { + "type": "array", + "description": "Defines the profiles to load", + "items": { + "type": "string" + } + }, + "ProjectVersion": { + "type": "string", + "description": "Version" + }, + "Root": { + "type": "string", + "description": "Root directory during build execution" + }, + "Skip": { + "type": "array", + "description": "List of targets to be skipped. Empty list skips all dependencies", + "items": { + "type": "string", + "enum": [ + "Antlr", + "Ci", + "Clean", + "Compile", + "CompileExamples", + "CompileSolution", + "Pack", + "PackBinaries", + "Publish", + "Restore", + "Test" + ] + } + }, + "Solution": { + "type": "string", + "description": "Path to a solution file that is automatically loaded" + }, + "Target": { + "type": "array", + "description": "List of targets to be invoked. Default is '{default_target}'", + "items": { + "type": "string", + "enum": [ + "Antlr", + "Ci", + "Clean", + "Compile", + "CompileExamples", + "CompileSolution", + "Pack", + "PackBinaries", + "Publish", + "Restore", + "Test" + ] + } + }, + "TestFull": { + "type": "boolean" + }, + "TestIntegrationData": { + "type": "boolean" + }, + "TestIntegrationEms": { + "type": "boolean" + }, + "TestIntegrationMsMq": { + "type": "boolean" + }, + "TestIntegrationNms": { + "type": "boolean" + }, + "Verbosity": { + "type": "string", + "description": "Logging verbosity during build execution. Default is 'Normal'", + "enum": [ + "Minimal", + "Normal", + "Quiet", + "Verbose" + ] + } + } + } + } +} \ No newline at end of file diff --git a/.nuke/parameters.json b/.nuke/parameters.json new file mode 100644 index 00000000..cd89d7cd --- /dev/null +++ b/.nuke/parameters.json @@ -0,0 +1,4 @@ +{ + "$schema": "./build.schema.json", + "Solution": "Spring.Net.sln" +} \ No newline at end of file diff --git a/Build.cmd b/Build.cmd deleted file mode 100644 index e4f63ec3..00000000 --- a/Build.cmd +++ /dev/null @@ -1,23 +0,0 @@ -@echo off -cd build-support -call set-nant-config-per-processor-architecture.cmd -cd .. -@echo . -@echo .. -@echo ... -@echo Running full Build Script, capturing output to buildlog.txt file... -@echo Start Time: %time% -build-support\tools\nant\bin\nant -D:test.withcoverage=false %1 %2 %3 %4 %5 %6 %7 %8 %9 > buildlog.txt -@echo . -@echo .. -@echo ... -@echo Launching text file viewer to display buildlog.txt contents... -start "ignored but required placeholder window title argument" buildlog.txt -@echo . -@echo .. -@echo ... -@echo ************************ -@echo Build Complete! -@echo ************************ -@echo End Time: %time% -@echo    diff --git a/README.md b/README.md index 36cce9a9..dc5e3c6a 100644 --- a/README.md +++ b/README.md @@ -166,29 +166,7 @@ Documented sample applications can be found in "examples": VS.NET ------ -Visual Studio 2017 is required to open and build the solution. The free community version of Visual Studio should suffice. - -For the first time you need to execute `Build.cmd` which will generate `GenCommonAssemblyInfo.cs` file required for builds. - -NAnt ----- - -Build scripts are delivered with the download package. - -To build the source and run the unit tests type - -build test - -If you want to run the build to create strongly signed assemblies you can generate a key file by executing the following command (assuming that sn.exe is properly on your search path): - -sn -k Spring.Net.snk - -You need to place the Spring.NET.snk file into the root folder of the source tree. All builds are strongly named using this key file when executing the following nant command: - -nant -D:project.build.sign=true - -InnovaSys Document X! is used to generate the SDK documentation. - +Visual Studio 2019 is required to open and build the solution. The free community version of Visual Studio should suffice. ## 8. Support diff --git a/Spring.Net.sln b/Spring.Net.sln index a938b9ab..cabfcf59 100644 --- a/Spring.Net.sln +++ b/Spring.Net.sln @@ -1,17 +1,19 @@  Microsoft Visual Studio Solution File, Format Version 12.00 -# Visual Studio 15 -VisualStudioVersion = 15.0.25807.0 +# Visual Studio Version 17 +VisualStudioVersion = 17.0.31410.414 MinimumVisualStudioVersion = 10.0.40219.1 Project("{2150E333-8FDC-42A3-9474-1A3956D46DE8}") = "Solution Items", "Solution Items", "{F04753EF-7A1B-4837-AB63-8C0821E8155D}" ProjectSection(SolutionItems) = preProject BreakingChanges.txt = BreakingChanges.txt changelog.txt = changelog.txt common-project.include = common-project.include + src\Directory.Build.props = src\Directory.Build.props Local.testsettings = Local.testsettings + README.md = README.md Spring.build = Spring.build Spring.include = Spring.include - README.md = README.md + global.json = global.json EndProjectSection EndProject Project("{2150E333-8FDC-42A3-9474-1A3956D46DE8}") = ".nuget", ".nuget", "{79F495DF-83D6-435E-A20E-47800F6F8FE7}" @@ -87,458 +89,202 @@ Project("{9A19103F-16F7-4668-BE54-9A1E7A4F7556}") = "Spring.Template.Velocity.Ca EndProject Project("{9A19103F-16F7-4668-BE54-9A1E7A4F7556}") = "Spring.Template.Velocity.Castle.Tests", "test\Spring\Spring.Template.Velocity.Castle.Tests\Spring.Template.Velocity.Castle.Tests.csproj", "{8D6ED392-8A1F-41C0-A765-22CF384EDEA1}" EndProject -Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.NHibernate5", "src\Spring\Spring.Data.NHibernate5\Spring.Data.NHibernate5.csproj", "{26604974-B6B8-45BA-A72A-66574ADC498B}" +Project("{9A19103F-16F7-4668-BE54-9A1E7A4F7556}") = "Spring.Data.NHibernate5", "src\Spring\Spring.Data.NHibernate5\Spring.Data.NHibernate5.csproj", "{26604974-B6B8-45BA-A72A-66574ADC498B}" EndProject -Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.NHibernate5.Integration.Tests", "test\Spring\Spring.Data.NHibernate5.Integration.Tests\Spring.Data.NHibernate5.Integration.Tests.csproj", "{740CDA28-39BC-455A-86C3-5323D14F5B2E}" +Project("{9A19103F-16F7-4668-BE54-9A1E7A4F7556}") = "Spring.Data.NHibernate5.Integration.Tests", "test\Spring\Spring.Data.NHibernate5.Integration.Tests\Spring.Data.NHibernate5.Integration.Tests.csproj", "{740CDA28-39BC-455A-86C3-5323D14F5B2E}" EndProject Project("{9A19103F-16F7-4668-BE54-9A1E7A4F7556}") = "Spring.Data.NHibernate5.NestedTxSuspension.Integration.Tests", "test\Spring\Spring.Data.NHibernate5.NestedTxSuspension.Integration.Tests\Spring.Data.NHibernate5.NestedTxSuspension.Integration.Tests.csproj", "{DE276F7C-4564-49EC-AABC-B964EC3D1626}" EndProject -Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.NHibernate5.Tests", "test\Spring\Spring.Data.NHibernate5.Tests\Spring.Data.NHibernate5.Tests.csproj", "{BEEBC49B-4519-4C77-AE93-11E68F4CA7E3}" +Project("{9A19103F-16F7-4668-BE54-9A1E7A4F7556}") = "Spring.Data.NHibernate5.Tests", "test\Spring\Spring.Data.NHibernate5.Tests\Spring.Data.NHibernate5.Tests.csproj", "{BEEBC49B-4519-4C77-AE93-11E68F4CA7E3}" EndProject -Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Benchmark", "test\Spring\Spring.Benchmark\Spring.Benchmark.csproj", "{504F1D7B-C6AC-4128-9411-D680B3086662}" +Project("{9A19103F-16F7-4668-BE54-9A1E7A4F7556}") = "Spring.Benchmark", "test\Spring\Spring.Benchmark\Spring.Benchmark.csproj", "{504F1D7B-C6AC-4128-9411-D680B3086662}" EndProject Project("{2150E333-8FDC-42A3-9474-1A3956D46DE8}") = "Tools", "Tools", "{9537C677-ADE5-4503-AFD7-3E0C3B0960EB}" EndProject +Project("{9A19103F-16F7-4668-BE54-9A1E7A4F7556}") = "_build", "build-support\nuke-build\_build.csproj", "{0D135B50-2B59-44C1-941A-32B5EC798C88}" +EndProject +Project("{2150E333-8FDC-42A3-9474-1A3956D46DE8}") = ".github", ".github", "{C0BAC5A1-AC38-4D36-BE28-F5A74BD9FECD}" +EndProject +Project("{2150E333-8FDC-42A3-9474-1A3956D46DE8}") = "workflows", "workflows", "{76CA894B-7F4F-4F5B-8EFD-FF5253C6FCCE}" +ProjectSection(SolutionItems) = preProject + .github\workflows\ci.yml = .github\workflows\ci.yml + .github\workflows\publish.yml = .github\workflows\publish.yml +EndProjectSection +EndProject Global GlobalSection(SolutionConfigurationPlatforms) = preSolution - Debug|.NET = Debug|.NET Debug|Any CPU = Debug|Any CPU - Debug|Mixed Platforms = Debug|Mixed Platforms - Release|.NET = Release|.NET Release|Any CPU = Release|Any CPU - Release|Mixed Platforms = Release|Mixed Platforms EndGlobalSection GlobalSection(ProjectConfigurationPlatforms) = postSolution - {710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|.NET.ActiveCfg = Debug|Any CPU - {710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|.NET.Build.0 = Debug|Any CPU {710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Any CPU.Build.0 = Debug|Any CPU - {710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|.NET.ActiveCfg = Release|Any CPU - {710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|.NET.Build.0 = Release|Any CPU {710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Any CPU.ActiveCfg = Release|Any CPU {710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Any CPU.Build.0 = Release|Any CPU - {710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|.NET.ActiveCfg = Debug|Any CPU - {44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|.NET.Build.0 = Debug|Any CPU {44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Any CPU.Build.0 = Debug|Any CPU - {44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|.NET.ActiveCfg = Release|Any CPU - {44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|.NET.Build.0 = Release|Any CPU {44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Any CPU.ActiveCfg = Release|Any CPU {44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Any CPU.Build.0 = Release|Any CPU - {44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|.NET.ActiveCfg = Debug|Any CPU - {3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|.NET.Build.0 = Debug|Any CPU {3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Any CPU.Build.0 = Debug|Any CPU - {3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|.NET.ActiveCfg = Release|Any CPU - {3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|.NET.Build.0 = Release|Any CPU {3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Any CPU.ActiveCfg = Release|Any CPU {3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Any CPU.Build.0 = Release|Any CPU - {3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {2111596A-0327-4C9D-8919-294FBD988A23}.Debug|.NET.ActiveCfg = Debug|Any CPU - {2111596A-0327-4C9D-8919-294FBD988A23}.Debug|.NET.Build.0 = Debug|Any CPU {2111596A-0327-4C9D-8919-294FBD988A23}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {2111596A-0327-4C9D-8919-294FBD988A23}.Debug|Any CPU.Build.0 = Debug|Any CPU - {2111596A-0327-4C9D-8919-294FBD988A23}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {2111596A-0327-4C9D-8919-294FBD988A23}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {2111596A-0327-4C9D-8919-294FBD988A23}.Release|.NET.ActiveCfg = Release|Any CPU - {2111596A-0327-4C9D-8919-294FBD988A23}.Release|.NET.Build.0 = Release|Any CPU {2111596A-0327-4C9D-8919-294FBD988A23}.Release|Any CPU.ActiveCfg = Release|Any CPU {2111596A-0327-4C9D-8919-294FBD988A23}.Release|Any CPU.Build.0 = Release|Any CPU - {2111596A-0327-4C9D-8919-294FBD988A23}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {2111596A-0327-4C9D-8919-294FBD988A23}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}.Debug|.NET.ActiveCfg = Debug|Any CPU - {FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}.Debug|.NET.Build.0 = Debug|Any CPU {FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}.Debug|Any CPU.Build.0 = Debug|Any CPU - {FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}.Release|.NET.ActiveCfg = Release|Any CPU - {FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}.Release|.NET.Build.0 = Release|Any CPU {FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}.Release|Any CPU.ActiveCfg = Release|Any CPU {FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}.Release|Any CPU.Build.0 = Release|Any CPU - {FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {4374F018-9738-46BF-A399-4594CEE75B21}.Debug|.NET.ActiveCfg = Debug|Any CPU - {4374F018-9738-46BF-A399-4594CEE75B21}.Debug|.NET.Build.0 = Debug|Any CPU {4374F018-9738-46BF-A399-4594CEE75B21}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {4374F018-9738-46BF-A399-4594CEE75B21}.Debug|Any CPU.Build.0 = Debug|Any CPU - {4374F018-9738-46BF-A399-4594CEE75B21}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {4374F018-9738-46BF-A399-4594CEE75B21}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {4374F018-9738-46BF-A399-4594CEE75B21}.Release|.NET.ActiveCfg = Release|Any CPU - {4374F018-9738-46BF-A399-4594CEE75B21}.Release|.NET.Build.0 = Release|Any CPU {4374F018-9738-46BF-A399-4594CEE75B21}.Release|Any CPU.ActiveCfg = Release|Any CPU {4374F018-9738-46BF-A399-4594CEE75B21}.Release|Any CPU.Build.0 = Release|Any CPU - {4374F018-9738-46BF-A399-4594CEE75B21}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {4374F018-9738-46BF-A399-4594CEE75B21}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {BA4789EB-281A-48EA-8763-28B9F0596A18}.Debug|.NET.ActiveCfg = Debug|Any CPU - {BA4789EB-281A-48EA-8763-28B9F0596A18}.Debug|.NET.Build.0 = Debug|Any CPU {BA4789EB-281A-48EA-8763-28B9F0596A18}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {BA4789EB-281A-48EA-8763-28B9F0596A18}.Debug|Any CPU.Build.0 = Debug|Any CPU - {BA4789EB-281A-48EA-8763-28B9F0596A18}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {BA4789EB-281A-48EA-8763-28B9F0596A18}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {BA4789EB-281A-48EA-8763-28B9F0596A18}.Release|.NET.ActiveCfg = Release|Any CPU - {BA4789EB-281A-48EA-8763-28B9F0596A18}.Release|.NET.Build.0 = Release|Any CPU {BA4789EB-281A-48EA-8763-28B9F0596A18}.Release|Any CPU.ActiveCfg = Release|Any CPU {BA4789EB-281A-48EA-8763-28B9F0596A18}.Release|Any CPU.Build.0 = Release|Any CPU - {BA4789EB-281A-48EA-8763-28B9F0596A18}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {BA4789EB-281A-48EA-8763-28B9F0596A18}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Debug|.NET.ActiveCfg = Debug|Any CPU - {C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Debug|.NET.Build.0 = Debug|Any CPU {C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Debug|Any CPU.Build.0 = Debug|Any CPU - {C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Release|.NET.ActiveCfg = Release|Any CPU - {C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Release|.NET.Build.0 = Release|Any CPU {C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Release|Any CPU.ActiveCfg = Release|Any CPU {C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Release|Any CPU.Build.0 = Release|Any CPU - {C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|.NET.ActiveCfg = Debug|Any CPU - {AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|.NET.Build.0 = Debug|Any CPU {AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Any CPU.Build.0 = Debug|Any CPU - {AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|.NET.ActiveCfg = Release|Any CPU - {AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|.NET.Build.0 = Release|Any CPU {AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Any CPU.ActiveCfg = Release|Any CPU {AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Any CPU.Build.0 = Release|Any CPU - {AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|.NET.ActiveCfg = Debug|Any CPU - {ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|.NET.Build.0 = Debug|Any CPU {ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|Any CPU.Build.0 = Debug|Any CPU - {ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|.NET.ActiveCfg = Release|Any CPU - {ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|.NET.Build.0 = Release|Any CPU {ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|Any CPU.ActiveCfg = Release|Any CPU {ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|Any CPU.Build.0 = Release|Any CPU - {ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {91766D21-C568-459F-9BEA-759B011F23CF}.Debug|.NET.ActiveCfg = Debug|Any CPU - {91766D21-C568-459F-9BEA-759B011F23CF}.Debug|.NET.Build.0 = Debug|Any CPU {91766D21-C568-459F-9BEA-759B011F23CF}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {91766D21-C568-459F-9BEA-759B011F23CF}.Debug|Any CPU.Build.0 = Debug|Any CPU - {91766D21-C568-459F-9BEA-759B011F23CF}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {91766D21-C568-459F-9BEA-759B011F23CF}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {91766D21-C568-459F-9BEA-759B011F23CF}.Release|.NET.ActiveCfg = Release|Any CPU - {91766D21-C568-459F-9BEA-759B011F23CF}.Release|.NET.Build.0 = Release|Any CPU {91766D21-C568-459F-9BEA-759B011F23CF}.Release|Any CPU.ActiveCfg = Release|Any CPU {91766D21-C568-459F-9BEA-759B011F23CF}.Release|Any CPU.Build.0 = Release|Any CPU - {91766D21-C568-459F-9BEA-759B011F23CF}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {91766D21-C568-459F-9BEA-759B011F23CF}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Debug|.NET.ActiveCfg = Debug|Any CPU - {E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Debug|.NET.Build.0 = Debug|Any CPU {E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Debug|Any CPU.Build.0 = Debug|Any CPU - {E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Release|.NET.ActiveCfg = Release|Any CPU - {E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Release|.NET.Build.0 = Release|Any CPU {E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Release|Any CPU.ActiveCfg = Release|Any CPU {E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Release|Any CPU.Build.0 = Release|Any CPU - {E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Debug|.NET.ActiveCfg = Debug|Any CPU - {ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Debug|.NET.Build.0 = Debug|Any CPU {ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Debug|Any CPU.Build.0 = Debug|Any CPU - {ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Release|.NET.ActiveCfg = Release|Any CPU - {ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Release|.NET.Build.0 = Release|Any CPU {ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Release|Any CPU.ActiveCfg = Release|Any CPU {ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Release|Any CPU.Build.0 = Release|Any CPU - {ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Debug|.NET.ActiveCfg = Debug|Any CPU - {4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Debug|.NET.Build.0 = Debug|Any CPU {4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Debug|Any CPU.Build.0 = Debug|Any CPU - {4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Release|.NET.ActiveCfg = Release|Any CPU - {4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Release|.NET.Build.0 = Release|Any CPU {4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Release|Any CPU.ActiveCfg = Release|Any CPU {4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Release|Any CPU.Build.0 = Release|Any CPU - {4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {AEB1578C-9018-4D49-B440-789F38DD2F29}.Debug|.NET.ActiveCfg = Debug|Any CPU {AEB1578C-9018-4D49-B440-789F38DD2F29}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {AEB1578C-9018-4D49-B440-789F38DD2F29}.Debug|Any CPU.Build.0 = Debug|Any CPU - {AEB1578C-9018-4D49-B440-789F38DD2F29}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {AEB1578C-9018-4D49-B440-789F38DD2F29}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {AEB1578C-9018-4D49-B440-789F38DD2F29}.Release|.NET.ActiveCfg = Release|Any CPU {AEB1578C-9018-4D49-B440-789F38DD2F29}.Release|Any CPU.ActiveCfg = Release|Any CPU {AEB1578C-9018-4D49-B440-789F38DD2F29}.Release|Any CPU.Build.0 = Release|Any CPU - {AEB1578C-9018-4D49-B440-789F38DD2F29}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {AEB1578C-9018-4D49-B440-789F38DD2F29}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {FA7A6931-7DBE-4A32-A312-51FAD2E80332}.Debug|.NET.ActiveCfg = Debug|Any CPU {FA7A6931-7DBE-4A32-A312-51FAD2E80332}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {FA7A6931-7DBE-4A32-A312-51FAD2E80332}.Debug|Any CPU.Build.0 = Debug|Any CPU - {FA7A6931-7DBE-4A32-A312-51FAD2E80332}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {FA7A6931-7DBE-4A32-A312-51FAD2E80332}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {FA7A6931-7DBE-4A32-A312-51FAD2E80332}.Release|.NET.ActiveCfg = Release|Any CPU {FA7A6931-7DBE-4A32-A312-51FAD2E80332}.Release|Any CPU.ActiveCfg = Release|Any CPU {FA7A6931-7DBE-4A32-A312-51FAD2E80332}.Release|Any CPU.Build.0 = Release|Any CPU - {FA7A6931-7DBE-4A32-A312-51FAD2E80332}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {FA7A6931-7DBE-4A32-A312-51FAD2E80332}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Debug|.NET.ActiveCfg = Debug|Any CPU {0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Debug|Any CPU.Build.0 = Debug|Any CPU - {0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Release|.NET.ActiveCfg = Release|Any CPU {0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Release|Any CPU.ActiveCfg = Release|Any CPU {0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Release|Any CPU.Build.0 = Release|Any CPU - {0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {41BC3AEA-7EB3-48BF-B1EC-84119376AC98}.Debug|.NET.ActiveCfg = Debug|Any CPU {41BC3AEA-7EB3-48BF-B1EC-84119376AC98}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {41BC3AEA-7EB3-48BF-B1EC-84119376AC98}.Debug|Any CPU.Build.0 = Debug|Any CPU - {41BC3AEA-7EB3-48BF-B1EC-84119376AC98}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {41BC3AEA-7EB3-48BF-B1EC-84119376AC98}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {41BC3AEA-7EB3-48BF-B1EC-84119376AC98}.Release|.NET.ActiveCfg = Release|Any CPU {41BC3AEA-7EB3-48BF-B1EC-84119376AC98}.Release|Any CPU.ActiveCfg = Release|Any CPU {41BC3AEA-7EB3-48BF-B1EC-84119376AC98}.Release|Any CPU.Build.0 = Release|Any CPU - {41BC3AEA-7EB3-48BF-B1EC-84119376AC98}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {41BC3AEA-7EB3-48BF-B1EC-84119376AC98}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {BF3AB954-8375-407C-9E98-4C51D8072784}.Debug|.NET.ActiveCfg = Debug|Any CPU {BF3AB954-8375-407C-9E98-4C51D8072784}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {BF3AB954-8375-407C-9E98-4C51D8072784}.Debug|Any CPU.Build.0 = Debug|Any CPU - {BF3AB954-8375-407C-9E98-4C51D8072784}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {BF3AB954-8375-407C-9E98-4C51D8072784}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {BF3AB954-8375-407C-9E98-4C51D8072784}.Release|.NET.ActiveCfg = Release|Any CPU {BF3AB954-8375-407C-9E98-4C51D8072784}.Release|Any CPU.ActiveCfg = Release|Any CPU {BF3AB954-8375-407C-9E98-4C51D8072784}.Release|Any CPU.Build.0 = Release|Any CPU - {BF3AB954-8375-407C-9E98-4C51D8072784}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {BF3AB954-8375-407C-9E98-4C51D8072784}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {10405837-CB67-40D8-9326-84C9383983E2}.Debug|.NET.ActiveCfg = Debug|Any CPU {10405837-CB67-40D8-9326-84C9383983E2}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {10405837-CB67-40D8-9326-84C9383983E2}.Debug|Any CPU.Build.0 = Debug|Any CPU - {10405837-CB67-40D8-9326-84C9383983E2}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {10405837-CB67-40D8-9326-84C9383983E2}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {10405837-CB67-40D8-9326-84C9383983E2}.Release|.NET.ActiveCfg = Release|Any CPU {10405837-CB67-40D8-9326-84C9383983E2}.Release|Any CPU.ActiveCfg = Release|Any CPU {10405837-CB67-40D8-9326-84C9383983E2}.Release|Any CPU.Build.0 = Release|Any CPU - {10405837-CB67-40D8-9326-84C9383983E2}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {10405837-CB67-40D8-9326-84C9383983E2}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {2E10A8D3-B8FF-4699-90B8-E621659C58DD}.Debug|.NET.ActiveCfg = Debug|Any CPU {2E10A8D3-B8FF-4699-90B8-E621659C58DD}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {2E10A8D3-B8FF-4699-90B8-E621659C58DD}.Debug|Any CPU.Build.0 = Debug|Any CPU - {2E10A8D3-B8FF-4699-90B8-E621659C58DD}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {2E10A8D3-B8FF-4699-90B8-E621659C58DD}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {2E10A8D3-B8FF-4699-90B8-E621659C58DD}.Release|.NET.ActiveCfg = Release|Any CPU {2E10A8D3-B8FF-4699-90B8-E621659C58DD}.Release|Any CPU.ActiveCfg = Release|Any CPU {2E10A8D3-B8FF-4699-90B8-E621659C58DD}.Release|Any CPU.Build.0 = Release|Any CPU - {2E10A8D3-B8FF-4699-90B8-E621659C58DD}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {2E10A8D3-B8FF-4699-90B8-E621659C58DD}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {7321149A-47C6-4FBA-9D1A-26FD6815381B}.Debug|.NET.ActiveCfg = Debug|Any CPU {7321149A-47C6-4FBA-9D1A-26FD6815381B}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {7321149A-47C6-4FBA-9D1A-26FD6815381B}.Debug|Any CPU.Build.0 = Debug|Any CPU - {7321149A-47C6-4FBA-9D1A-26FD6815381B}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {7321149A-47C6-4FBA-9D1A-26FD6815381B}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {7321149A-47C6-4FBA-9D1A-26FD6815381B}.Release|.NET.ActiveCfg = Release|Any CPU {7321149A-47C6-4FBA-9D1A-26FD6815381B}.Release|Any CPU.ActiveCfg = Release|Any CPU {7321149A-47C6-4FBA-9D1A-26FD6815381B}.Release|Any CPU.Build.0 = Release|Any CPU - {7321149A-47C6-4FBA-9D1A-26FD6815381B}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {7321149A-47C6-4FBA-9D1A-26FD6815381B}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {900E3839-301E-48B1-BAEB-B6645620ACFF}.Debug|.NET.ActiveCfg = Debug|Any CPU {900E3839-301E-48B1-BAEB-B6645620ACFF}.Debug|Any CPU.ActiveCfg = Debug|Any CPU - {900E3839-301E-48B1-BAEB-B6645620ACFF}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {900E3839-301E-48B1-BAEB-B6645620ACFF}.Release|.NET.ActiveCfg = Release|Any CPU {900E3839-301E-48B1-BAEB-B6645620ACFF}.Release|Any CPU.ActiveCfg = Release|Any CPU - {900E3839-301E-48B1-BAEB-B6645620ACFF}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {E823D54C-CE82-4868-929F-5F95A999F123}.Debug|.NET.ActiveCfg = Debug|Any CPU {E823D54C-CE82-4868-929F-5F95A999F123}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {E823D54C-CE82-4868-929F-5F95A999F123}.Debug|Any CPU.Build.0 = Debug|Any CPU - {E823D54C-CE82-4868-929F-5F95A999F123}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {E823D54C-CE82-4868-929F-5F95A999F123}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {E823D54C-CE82-4868-929F-5F95A999F123}.Release|.NET.ActiveCfg = Release|Any CPU {E823D54C-CE82-4868-929F-5F95A999F123}.Release|Any CPU.ActiveCfg = Release|Any CPU {E823D54C-CE82-4868-929F-5F95A999F123}.Release|Any CPU.Build.0 = Release|Any CPU - {E823D54C-CE82-4868-929F-5F95A999F123}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {E823D54C-CE82-4868-929F-5F95A999F123}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {247787CF-ECE1-4675-8B42-7DF4329A4891}.Debug|.NET.ActiveCfg = Debug|Any CPU - {247787CF-ECE1-4675-8B42-7DF4329A4891}.Debug|Any CPU.ActiveCfg = Debug|Any CPU - {247787CF-ECE1-4675-8B42-7DF4329A4891}.Debug|Any CPU.Build.0 = Debug|Any CPU - {247787CF-ECE1-4675-8B42-7DF4329A4891}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {247787CF-ECE1-4675-8B42-7DF4329A4891}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {247787CF-ECE1-4675-8B42-7DF4329A4891}.Release|.NET.ActiveCfg = Release|Any CPU - {247787CF-ECE1-4675-8B42-7DF4329A4891}.Release|Any CPU.ActiveCfg = Release|Any CPU - {247787CF-ECE1-4675-8B42-7DF4329A4891}.Release|Any CPU.Build.0 = Release|Any CPU - {247787CF-ECE1-4675-8B42-7DF4329A4891}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {247787CF-ECE1-4675-8B42-7DF4329A4891}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {FA934E92-C8C2-428A-BE2A-26818F17A787}.Debug|.NET.ActiveCfg = Debug|Any CPU - {FA934E92-C8C2-428A-BE2A-26818F17A787}.Debug|Any CPU.ActiveCfg = Debug|Any CPU - {FA934E92-C8C2-428A-BE2A-26818F17A787}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {FA934E92-C8C2-428A-BE2A-26818F17A787}.Release|.NET.ActiveCfg = Release|Any CPU - {FA934E92-C8C2-428A-BE2A-26818F17A787}.Release|Any CPU.ActiveCfg = Release|Any CPU - {FA934E92-C8C2-428A-BE2A-26818F17A787}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {E5323AC8-137E-4EF7-BC62-3BD6FC0576CD}.Debug|.NET.ActiveCfg = Debug|Any CPU - {E5323AC8-137E-4EF7-BC62-3BD6FC0576CD}.Debug|Any CPU.ActiveCfg = Debug|Any CPU - {E5323AC8-137E-4EF7-BC62-3BD6FC0576CD}.Debug|Any CPU.Build.0 = Debug|Any CPU - {E5323AC8-137E-4EF7-BC62-3BD6FC0576CD}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {E5323AC8-137E-4EF7-BC62-3BD6FC0576CD}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {E5323AC8-137E-4EF7-BC62-3BD6FC0576CD}.Release|.NET.ActiveCfg = Release|Any CPU - {E5323AC8-137E-4EF7-BC62-3BD6FC0576CD}.Release|Any CPU.ActiveCfg = Release|Any CPU - {E5323AC8-137E-4EF7-BC62-3BD6FC0576CD}.Release|Any CPU.Build.0 = Release|Any CPU - {E5323AC8-137E-4EF7-BC62-3BD6FC0576CD}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {E5323AC8-137E-4EF7-BC62-3BD6FC0576CD}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {8CF0F34A-CC93-4D87-AE14-A2DEEF072F26}.Debug|.NET.ActiveCfg = Debug|Any CPU {8CF0F34A-CC93-4D87-AE14-A2DEEF072F26}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {8CF0F34A-CC93-4D87-AE14-A2DEEF072F26}.Debug|Any CPU.Build.0 = Debug|Any CPU - {8CF0F34A-CC93-4D87-AE14-A2DEEF072F26}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {8CF0F34A-CC93-4D87-AE14-A2DEEF072F26}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {8CF0F34A-CC93-4D87-AE14-A2DEEF072F26}.Release|.NET.ActiveCfg = Release|Any CPU {8CF0F34A-CC93-4D87-AE14-A2DEEF072F26}.Release|Any CPU.ActiveCfg = Release|Any CPU {8CF0F34A-CC93-4D87-AE14-A2DEEF072F26}.Release|Any CPU.Build.0 = Release|Any CPU - {8CF0F34A-CC93-4D87-AE14-A2DEEF072F26}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {8CF0F34A-CC93-4D87-AE14-A2DEEF072F26}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {CF375928-B6D5-485C-B04D-2BC41D9DBF1E}.Debug|.NET.ActiveCfg = Debug|Any CPU + {247787CF-ECE1-4675-8B42-7DF4329A4891}.Debug|Any CPU.ActiveCfg = Debug|Any CPU + {247787CF-ECE1-4675-8B42-7DF4329A4891}.Debug|Any CPU.Build.0 = Debug|Any CPU + {247787CF-ECE1-4675-8B42-7DF4329A4891}.Release|Any CPU.ActiveCfg = Release|Any CPU + {247787CF-ECE1-4675-8B42-7DF4329A4891}.Release|Any CPU.Build.0 = Release|Any CPU + {FA934E92-C8C2-428A-BE2A-26818F17A787}.Debug|Any CPU.ActiveCfg = Debug|Any CPU + {FA934E92-C8C2-428A-BE2A-26818F17A787}.Release|Any CPU.ActiveCfg = Release|Any CPU + {E5323AC8-137E-4EF7-BC62-3BD6FC0576CD}.Debug|Any CPU.ActiveCfg = Debug|Any CPU + {E5323AC8-137E-4EF7-BC62-3BD6FC0576CD}.Debug|Any CPU.Build.0 = Debug|Any CPU + {E5323AC8-137E-4EF7-BC62-3BD6FC0576CD}.Release|Any CPU.ActiveCfg = Release|Any CPU + {E5323AC8-137E-4EF7-BC62-3BD6FC0576CD}.Release|Any CPU.Build.0 = Release|Any CPU {CF375928-B6D5-485C-B04D-2BC41D9DBF1E}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {CF375928-B6D5-485C-B04D-2BC41D9DBF1E}.Debug|Any CPU.Build.0 = Debug|Any CPU - {CF375928-B6D5-485C-B04D-2BC41D9DBF1E}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {CF375928-B6D5-485C-B04D-2BC41D9DBF1E}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {CF375928-B6D5-485C-B04D-2BC41D9DBF1E}.Release|.NET.ActiveCfg = Release|Any CPU {CF375928-B6D5-485C-B04D-2BC41D9DBF1E}.Release|Any CPU.ActiveCfg = Release|Any CPU {CF375928-B6D5-485C-B04D-2BC41D9DBF1E}.Release|Any CPU.Build.0 = Release|Any CPU - {CF375928-B6D5-485C-B04D-2BC41D9DBF1E}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {CF375928-B6D5-485C-B04D-2BC41D9DBF1E}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {C57B05EA-FD1A-40EC-BB60-D2E45AB1A86A}.Debug|.NET.ActiveCfg = Debug|Any CPU {C57B05EA-FD1A-40EC-BB60-D2E45AB1A86A}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {C57B05EA-FD1A-40EC-BB60-D2E45AB1A86A}.Debug|Any CPU.Build.0 = Debug|Any CPU - {C57B05EA-FD1A-40EC-BB60-D2E45AB1A86A}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {C57B05EA-FD1A-40EC-BB60-D2E45AB1A86A}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {C57B05EA-FD1A-40EC-BB60-D2E45AB1A86A}.Release|.NET.ActiveCfg = Release|Any CPU {C57B05EA-FD1A-40EC-BB60-D2E45AB1A86A}.Release|Any CPU.ActiveCfg = Release|Any CPU {C57B05EA-FD1A-40EC-BB60-D2E45AB1A86A}.Release|Any CPU.Build.0 = Release|Any CPU - {C57B05EA-FD1A-40EC-BB60-D2E45AB1A86A}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {C57B05EA-FD1A-40EC-BB60-D2E45AB1A86A}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {39AAD7EA-2ED0-4E50-8D4D-C666EA9CBFE4}.Debug|.NET.ActiveCfg = Debug|Any CPU {39AAD7EA-2ED0-4E50-8D4D-C666EA9CBFE4}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {39AAD7EA-2ED0-4E50-8D4D-C666EA9CBFE4}.Debug|Any CPU.Build.0 = Debug|Any CPU - {39AAD7EA-2ED0-4E50-8D4D-C666EA9CBFE4}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {39AAD7EA-2ED0-4E50-8D4D-C666EA9CBFE4}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {39AAD7EA-2ED0-4E50-8D4D-C666EA9CBFE4}.Release|.NET.ActiveCfg = Release|Any CPU {39AAD7EA-2ED0-4E50-8D4D-C666EA9CBFE4}.Release|Any CPU.ActiveCfg = Release|Any CPU {39AAD7EA-2ED0-4E50-8D4D-C666EA9CBFE4}.Release|Any CPU.Build.0 = Release|Any CPU - {39AAD7EA-2ED0-4E50-8D4D-C666EA9CBFE4}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {39AAD7EA-2ED0-4E50-8D4D-C666EA9CBFE4}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {B9590252-6D58-4587-950C-475AB61FDBCF}.Debug|.NET.ActiveCfg = Debug|Any CPU {B9590252-6D58-4587-950C-475AB61FDBCF}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {B9590252-6D58-4587-950C-475AB61FDBCF}.Debug|Any CPU.Build.0 = Debug|Any CPU - {B9590252-6D58-4587-950C-475AB61FDBCF}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {B9590252-6D58-4587-950C-475AB61FDBCF}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {B9590252-6D58-4587-950C-475AB61FDBCF}.Release|.NET.ActiveCfg = Release|Any CPU {B9590252-6D58-4587-950C-475AB61FDBCF}.Release|Any CPU.ActiveCfg = Release|Any CPU {B9590252-6D58-4587-950C-475AB61FDBCF}.Release|Any CPU.Build.0 = Release|Any CPU - {B9590252-6D58-4587-950C-475AB61FDBCF}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {B9590252-6D58-4587-950C-475AB61FDBCF}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {250601C0-A4AC-41FE-B484-51A9B0D5473D}.Debug|.NET.ActiveCfg = Debug|Any CPU {250601C0-A4AC-41FE-B484-51A9B0D5473D}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {250601C0-A4AC-41FE-B484-51A9B0D5473D}.Debug|Any CPU.Build.0 = Debug|Any CPU - {250601C0-A4AC-41FE-B484-51A9B0D5473D}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {250601C0-A4AC-41FE-B484-51A9B0D5473D}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {250601C0-A4AC-41FE-B484-51A9B0D5473D}.Release|.NET.ActiveCfg = Release|Any CPU {250601C0-A4AC-41FE-B484-51A9B0D5473D}.Release|Any CPU.ActiveCfg = Release|Any CPU {250601C0-A4AC-41FE-B484-51A9B0D5473D}.Release|Any CPU.Build.0 = Release|Any CPU - {250601C0-A4AC-41FE-B484-51A9B0D5473D}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {250601C0-A4AC-41FE-B484-51A9B0D5473D}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {8D6ED392-8A1F-41C0-A765-22CF384EDEA1}.Debug|.NET.ActiveCfg = Debug|Any CPU {8D6ED392-8A1F-41C0-A765-22CF384EDEA1}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {8D6ED392-8A1F-41C0-A765-22CF384EDEA1}.Debug|Any CPU.Build.0 = Debug|Any CPU - {8D6ED392-8A1F-41C0-A765-22CF384EDEA1}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {8D6ED392-8A1F-41C0-A765-22CF384EDEA1}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {8D6ED392-8A1F-41C0-A765-22CF384EDEA1}.Release|.NET.ActiveCfg = Release|Any CPU {8D6ED392-8A1F-41C0-A765-22CF384EDEA1}.Release|Any CPU.ActiveCfg = Release|Any CPU {8D6ED392-8A1F-41C0-A765-22CF384EDEA1}.Release|Any CPU.Build.0 = Release|Any CPU - {8D6ED392-8A1F-41C0-A765-22CF384EDEA1}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {8D6ED392-8A1F-41C0-A765-22CF384EDEA1}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {DE276F7C-4564-49EC-AABC-B964EC3D1626}.Debug|.NET.ActiveCfg = Debug|Any CPU - {DE276F7C-4564-49EC-AABC-B964EC3D1626}.Debug|Any CPU.ActiveCfg = Debug|Any CPU - {DE276F7C-4564-49EC-AABC-B964EC3D1626}.Debug|Any CPU.Build.0 = Debug|Any CPU - {DE276F7C-4564-49EC-AABC-B964EC3D1626}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {DE276F7C-4564-49EC-AABC-B964EC3D1626}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {DE276F7C-4564-49EC-AABC-B964EC3D1626}.Release|.NET.ActiveCfg = Release|Any CPU - {DE276F7C-4564-49EC-AABC-B964EC3D1626}.Release|Any CPU.ActiveCfg = Release|Any CPU - {DE276F7C-4564-49EC-AABC-B964EC3D1626}.Release|Any CPU.Build.0 = Release|Any CPU - {DE276F7C-4564-49EC-AABC-B964EC3D1626}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {DE276F7C-4564-49EC-AABC-B964EC3D1626}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {26604974-B6B8-45BA-A72A-66574ADC498B}.Debug|.NET.ActiveCfg = Debug|Any CPU - {26604974-B6B8-45BA-A72A-66574ADC498B}.Debug|.NET.Build.0 = Debug|Any CPU {26604974-B6B8-45BA-A72A-66574ADC498B}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {26604974-B6B8-45BA-A72A-66574ADC498B}.Debug|Any CPU.Build.0 = Debug|Any CPU - {26604974-B6B8-45BA-A72A-66574ADC498B}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {26604974-B6B8-45BA-A72A-66574ADC498B}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {26604974-B6B8-45BA-A72A-66574ADC498B}.Release|.NET.ActiveCfg = Release|Any CPU - {26604974-B6B8-45BA-A72A-66574ADC498B}.Release|.NET.Build.0 = Release|Any CPU {26604974-B6B8-45BA-A72A-66574ADC498B}.Release|Any CPU.ActiveCfg = Release|Any CPU {26604974-B6B8-45BA-A72A-66574ADC498B}.Release|Any CPU.Build.0 = Release|Any CPU - {26604974-B6B8-45BA-A72A-66574ADC498B}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {26604974-B6B8-45BA-A72A-66574ADC498B}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {740CDA28-39BC-455A-86C3-5323D14F5B2E}.Debug|.NET.ActiveCfg = Debug|Any CPU - {740CDA28-39BC-455A-86C3-5323D14F5B2E}.Debug|.NET.Build.0 = Debug|Any CPU {740CDA28-39BC-455A-86C3-5323D14F5B2E}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {740CDA28-39BC-455A-86C3-5323D14F5B2E}.Debug|Any CPU.Build.0 = Debug|Any CPU - {740CDA28-39BC-455A-86C3-5323D14F5B2E}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {740CDA28-39BC-455A-86C3-5323D14F5B2E}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {740CDA28-39BC-455A-86C3-5323D14F5B2E}.Release|.NET.ActiveCfg = Release|Any CPU - {740CDA28-39BC-455A-86C3-5323D14F5B2E}.Release|.NET.Build.0 = Release|Any CPU {740CDA28-39BC-455A-86C3-5323D14F5B2E}.Release|Any CPU.ActiveCfg = Release|Any CPU {740CDA28-39BC-455A-86C3-5323D14F5B2E}.Release|Any CPU.Build.0 = Release|Any CPU - {740CDA28-39BC-455A-86C3-5323D14F5B2E}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {740CDA28-39BC-455A-86C3-5323D14F5B2E}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {BEEBC49B-4519-4C77-AE93-11E68F4CA7E3}.Debug|.NET.ActiveCfg = Debug|Any CPU - {BEEBC49B-4519-4C77-AE93-11E68F4CA7E3}.Debug|.NET.Build.0 = Debug|Any CPU + {DE276F7C-4564-49EC-AABC-B964EC3D1626}.Debug|Any CPU.ActiveCfg = Debug|Any CPU + {DE276F7C-4564-49EC-AABC-B964EC3D1626}.Debug|Any CPU.Build.0 = Debug|Any CPU + {DE276F7C-4564-49EC-AABC-B964EC3D1626}.Release|Any CPU.ActiveCfg = Release|Any CPU + {DE276F7C-4564-49EC-AABC-B964EC3D1626}.Release|Any CPU.Build.0 = Release|Any CPU {BEEBC49B-4519-4C77-AE93-11E68F4CA7E3}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {BEEBC49B-4519-4C77-AE93-11E68F4CA7E3}.Debug|Any CPU.Build.0 = Debug|Any CPU - {BEEBC49B-4519-4C77-AE93-11E68F4CA7E3}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {BEEBC49B-4519-4C77-AE93-11E68F4CA7E3}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {BEEBC49B-4519-4C77-AE93-11E68F4CA7E3}.Release|.NET.ActiveCfg = Release|Any CPU - {BEEBC49B-4519-4C77-AE93-11E68F4CA7E3}.Release|.NET.Build.0 = Release|Any CPU {BEEBC49B-4519-4C77-AE93-11E68F4CA7E3}.Release|Any CPU.ActiveCfg = Release|Any CPU {BEEBC49B-4519-4C77-AE93-11E68F4CA7E3}.Release|Any CPU.Build.0 = Release|Any CPU - {BEEBC49B-4519-4C77-AE93-11E68F4CA7E3}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {BEEBC49B-4519-4C77-AE93-11E68F4CA7E3}.Release|Mixed Platforms.Build.0 = Release|Any CPU - {504F1D7B-C6AC-4128-9411-D680B3086662}.Debug|.NET.ActiveCfg = Debug|Any CPU - {504F1D7B-C6AC-4128-9411-D680B3086662}.Debug|.NET.Build.0 = Debug|Any CPU {504F1D7B-C6AC-4128-9411-D680B3086662}.Debug|Any CPU.ActiveCfg = Debug|Any CPU {504F1D7B-C6AC-4128-9411-D680B3086662}.Debug|Any CPU.Build.0 = Debug|Any CPU - {504F1D7B-C6AC-4128-9411-D680B3086662}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU - {504F1D7B-C6AC-4128-9411-D680B3086662}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU - {504F1D7B-C6AC-4128-9411-D680B3086662}.Release|.NET.ActiveCfg = Release|Any CPU - {504F1D7B-C6AC-4128-9411-D680B3086662}.Release|.NET.Build.0 = Release|Any CPU {504F1D7B-C6AC-4128-9411-D680B3086662}.Release|Any CPU.ActiveCfg = Release|Any CPU {504F1D7B-C6AC-4128-9411-D680B3086662}.Release|Any CPU.Build.0 = Release|Any CPU - {504F1D7B-C6AC-4128-9411-D680B3086662}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU - {504F1D7B-C6AC-4128-9411-D680B3086662}.Release|Mixed Platforms.Build.0 = Release|Any CPU + {0D135B50-2B59-44C1-941A-32B5EC798C88}.Debug|Any CPU.ActiveCfg = Debug|Any CPU + {0D135B50-2B59-44C1-941A-32B5EC798C88}.Release|Any CPU.ActiveCfg = Release|Any CPU EndGlobalSection GlobalSection(SolutionProperties) = preSolution HideSolutionNode = FALSE EndGlobalSection + GlobalSection(NestedProjects) = preSolution + {504F1D7B-C6AC-4128-9411-D680B3086662} = {9537C677-ADE5-4503-AFD7-3E0C3B0960EB} + {C0BAC5A1-AC38-4D36-BE28-F5A74BD9FECD} = {F04753EF-7A1B-4837-AB63-8C0821E8155D} + {76CA894B-7F4F-4F5B-8EFD-FF5253C6FCCE} = {C0BAC5A1-AC38-4D36-BE28-F5A74BD9FECD} + EndGlobalSection GlobalSection(ExtensibilityGlobals) = postSolution - SolutionGuid = {803E6B42-7DEE-4DCC-83D0-51925047BCB0} NAntAddinLastFileName = Spring.build + SolutionGuid = {803E6B42-7DEE-4DCC-83D0-51925047BCB0} EndGlobalSection GlobalSection(TestCaseManagementSettings) = postSolution CategoryFile = Spring.Net.vsmdi EndGlobalSection - GlobalSection(NestedProjects) = preSolution - {504F1D7B-C6AC-4128-9411-D680B3086662} = {9537C677-ADE5-4503-AFD7-3E0C3B0960EB} - EndGlobalSection EndGlobal diff --git a/appveyor.yml b/appveyor.yml.old similarity index 100% rename from appveyor.yml rename to appveyor.yml.old diff --git a/build-support/nuke-build/.editorconfig b/build-support/nuke-build/.editorconfig new file mode 100644 index 00000000..31e43dcd --- /dev/null +++ b/build-support/nuke-build/.editorconfig @@ -0,0 +1,11 @@ +[*.cs] +dotnet_style_qualification_for_field = false:warning +dotnet_style_qualification_for_property = false:warning +dotnet_style_qualification_for_method = false:warning +dotnet_style_qualification_for_event = false:warning +dotnet_style_require_accessibility_modifiers = never:warning + +csharp_style_expression_bodied_methods = true:silent +csharp_style_expression_bodied_properties = true:warning +csharp_style_expression_bodied_indexers = true:warning +csharp_style_expression_bodied_accessors = true:warning diff --git a/build-support/nuke-build/Build.GitHubActions.cs b/build-support/nuke-build/Build.GitHubActions.cs new file mode 100644 index 00000000..698e3186 --- /dev/null +++ b/build-support/nuke-build/Build.GitHubActions.cs @@ -0,0 +1,8 @@ +using Nuke.Common; + +public partial class Build +{ + Target Ci => _ => _ + .DependsOn(Compile, Test, Pack) + .Executes(); +} \ No newline at end of file diff --git a/build-support/nuke-build/Build.Publish.cs b/build-support/nuke-build/Build.Publish.cs new file mode 100644 index 00000000..d5660064 --- /dev/null +++ b/build-support/nuke-build/Build.Publish.cs @@ -0,0 +1,43 @@ +using System.Collections.Generic; +using Nuke.Common; +using Nuke.Common.Git; +using Nuke.Common.IO; +using Nuke.Common.Tooling; +using Nuke.Common.Tools.DotNet; + +using static Nuke.Common.Tools.DotNet.DotNetTasks; + +public partial class Build +{ + [Parameter] string NuGetSource => "https://api.nuget.org/v3/index.json"; + [Parameter] [Secret] string NuGetApiKey; + + Target Publish => _ => _ + .OnlyWhenStatic(() => GitRepository.IsOnMainBranch() || GitRepository.Branch == "github-build") + .DependsOn(Pack) + .Requires(() => NuGetApiKey) + .Executes(() => + { + DotNetNuGetPush(_ => _ + .Apply(PushSettingsBase) + .Apply(PushSettings) + .CombineWith(PushPackageFiles, (_, v) => _ + .SetTargetPath(v)) + .Apply(PackagePushSettings), + PushDegreeOfParallelism, + PushCompleteOnFailure); + }); + + Configure PushSettingsBase => _ => _ + .SetSource(NuGetSource) + .SetApiKey(NuGetApiKey); + + Configure PushSettings => _ => _; + Configure PackagePushSettings => _ => _; + + IEnumerable PushPackageFiles => ArtifactsDirectory.GlobFiles("*.nupkg"); + + bool PushCompleteOnFailure => true; + int PushDegreeOfParallelism => 5; + +} \ No newline at end of file diff --git a/build-support/nuke-build/Build.Test.cs b/build-support/nuke-build/Build.Test.cs new file mode 100644 index 00000000..c3b76fc2 --- /dev/null +++ b/build-support/nuke-build/Build.Test.cs @@ -0,0 +1,59 @@ +using System.Linq; +using Nuke.Common; +using Nuke.Common.Tools.DotNet; + +using static Nuke.Common.Tools.DotNet.DotNetTasks; + +public partial class Build +{ + [Parameter] + readonly bool TestFull = false; + [Parameter] + readonly bool TestIntegrationData = false; + [Parameter] + readonly bool TestIntegrationEms = false; + [Parameter] + readonly bool TestIntegrationNms = false; + [Parameter] + readonly bool TestIntegrationMsMq = false; + + Target Test => _ => _ + .DependsOn(Restore) + .After(Compile) + .Executes(() => + { + var testTargets = GetActiveProjects() + .Where(x => x.Name.Contains(".Test")) + .Where(x => !x.Name.Contains(".Integration") || TestFull) + .Where(x => !x.Name.Contains("Spring.Web.Conversation.NHibernate5.Tests") || TestFull) + .Where(x => !x.Name.Contains("Spring.Data.Integration.Tests") || TestIntegrationData) + .Where(x => !x.Name.Contains("Spring.Messaging.Tests") || TestIntegrationMsMq || TestFull) + .Where(x => !x.Name.Contains("Spring.Nms.Integration.Tests") || TestIntegrationNms || TestFull) + .Where(x => !x.Name.Contains("Spring.Messaging.Ems.Integration.Tests") || TestIntegrationEms || TestFull) + .Where(x => !x.Name.Contains("Spring.Services.Tests")) + .Where(x => !x.Name.Contains("Spring.Template.Velocity.Castle.Tests") || EnvironmentInfo.IsWin) + .Where(x => !x.Name.Contains("Spring.Template.Velocity.Tests") || EnvironmentInfo.IsWin) + .Where(x => !x.Name.Contains("Spring.Testing.Microsoft.Test") || EnvironmentInfo.IsWin) + .Where(x => !x.Name.Contains("Spring.Web.Tests") || EnvironmentInfo.IsWin) + .Where(x => !x.Name.Contains("Spring.Web.Mvc5.Tests") || EnvironmentInfo.IsWin); + + foreach (var project in testTargets) + { + DotNetTest(s => + { + s = s + .SetProjectFile(project.Path) + .SetConfiguration(Configuration) + .EnableNoRestore(); + + if (!EnvironmentInfo.IsWin) + { + s = s.SetFramework("net5.0"); + } + + return s; + }); + } + }); + +} \ No newline at end of file diff --git a/build-support/nuke-build/Build.cs b/build-support/nuke-build/Build.cs new file mode 100644 index 00000000..20e5a378 --- /dev/null +++ b/build-support/nuke-build/Build.cs @@ -0,0 +1,204 @@ +using System; +using System.Collections.Generic; +using System.IO; +using System.Linq; +using Nuke.Common; +using Nuke.Common.CI; +using Nuke.Common.CI.AppVeyor; +using Nuke.Common.CI.GitHubActions; +using Nuke.Common.Git; +using Nuke.Common.IO; +using Nuke.Common.ProjectModel; +using Nuke.Common.Tools.DotNet; +using Nuke.Common.Tools.MSBuild; +using Nuke.Common.Utilities.Collections; + +using static Nuke.Common.IO.FileSystemTasks; +using static Nuke.Common.Tooling.ProcessTasks; +using static Nuke.Common.Tools.DotNet.DotNetTasks; +using static Nuke.Common.Tools.MSBuild.MSBuildTasks; + +[ShutdownDotNetAfterServerBuild] +partial class Build : NukeBuild +{ + /// Support plugins are available for: + /// - JetBrains ReSharper https://nuke.build/resharper + /// - JetBrains Rider https://nuke.build/rider + /// - Microsoft VisualStudio https://nuke.build/visualstudio + /// - Microsoft VSCode https://nuke.build/vscode + + public static int Main () => Execute(x => x.Compile); + + [Parameter("Configuration to build - Default is 'Debug' (local) or 'Release' (server)")] + readonly Configuration Configuration = IsLocalBuild ? Configuration.Debug : Configuration.Release; + + [Parameter("Build EMS")] + readonly bool BuildEms = false; + + [Parameter("Version")] + readonly string ProjectVersion = "3.0.0"; + + [Solution] readonly Solution Solution; + [GitRepository] readonly GitRepository GitRepository; + + [CI] readonly AppVeyor AppVeyor; + [CI] readonly GitHubActions GitHubActions; + + AbsolutePath SourceDirectory => RootDirectory / "src"; + AbsolutePath TestsDirectory => RootDirectory / "test"; + AbsolutePath BuildDirectory => RootDirectory / "build"; + AbsolutePath ExamplesDirectory => RootDirectory / "examples"; + AbsolutePath ArtifactsDirectory => RootDirectory / "artifacts"; + + Target Clean => _ => _ + .Before(Restore) + .Executes(() => + { + ExamplesDirectory.GlobDirectories("**/bin", "**/obj").ForEach(DeleteDirectory); + SourceDirectory.GlobDirectories("**/bin", "**/obj").ForEach(DeleteDirectory); + TestsDirectory.GlobDirectories("**/bin", "**/obj").ForEach(DeleteDirectory); + EnsureCleanDirectory(ArtifactsDirectory); + EnsureCleanDirectory(BuildDirectory); + }); + + Target Restore => _ => _ + .Executes(() => + { + DotNetRestore(s => s + .SetProjectFile(Solution)); + }); + + Target Compile => _ => _ + .DependsOn(CompileSolution, CompileExamples); + + Target CompileSolution => _ => _ + .DependsOn(Restore) + .Executes(() => + { + DotNetBuild(s => s + .SetProjectFile(Solution) + .SetConfiguration(Configuration) + .EnableNoRestore() + ); + }); + + Target CompileExamples => _ => _ + .OnlyWhenStatic(() => EnvironmentInfo.IsWin) + .DependsOn(CompileSolution, PackBinaries) + .Executes(() => + { + foreach (var solutionFile in ExamplesDirectory.GlobFiles("**/*.sln")) + { + if (solutionFile.ToString().Contains("Spring.EmsQuickStart") && !BuildEms + || solutionFile.ToString().Contains("Spring.Examples.Pool") + || solutionFile.ToString().Contains("SpringAir") + || solutionFile.ToString().Contains("Spring.Web.Extensions.Example") + || solutionFile.ToString().Contains("Spring.WebQuickStart")) + { + continue; + } + + MSBuild(s => s + .SetTargets("Restore", "Rebuild") + .SetConfiguration(Configuration) + .SetTargetPath(solutionFile) + .SetNodeReuse(false) + .SetVerbosity(MSBuildVerbosity.Minimal) + ); + } + }); + + Target Antlr => _ => _ + .Executes(() => + { + var projectDir = Solution.GetProject("Spring.Core"); + var expressionsDir = Path.Combine(projectDir.Directory, "Expressions"); + var antlrExecutable = Path.Combine(Solution.Directory, "build-support/tools/antlr-2.7.6/antlr-2.7.6.exe"); + var process = StartProcess( + toolPath: antlrExecutable, + arguments: $"-o {expressionsDir}/Parser {expressionsDir}/Expression.g" + ); + process.WaitForExit(); + }); + + Target Pack => _ => _ + .After(Test) + .DependsOn(Restore) + .Executes(() => + { + var packTargets = GetActiveProjects() + .Where(x => !x.Name.Contains(".Test")); + + var version = GitRepository.Tags.SingleOrDefault(x => x.StartsWith("v"))?[1..]; + var suffix = ""; + if (string.IsNullOrWhiteSpace(version)) + { + version = ProjectVersion; + suffix = "develop-" + DateTime.UtcNow.ToString("yyyyMMddHHmm"); + } + + foreach (var project in packTargets) + { + DotNetPack(s => s + .SetProject(project.Path) + .SetVersion(version) + .SetVersionSuffix(suffix) + .SetConfiguration(Configuration.Release) + .EnableNoRestore() + .SetOutputDirectory(ArtifactsDirectory) + ); + } + }); + + Target PackBinaries => _ => _ + .DependsOn(CompileSolution) + .Executes(() => + { + var binDirectory = RootDirectory / "bin"; + EnsureCleanDirectory(binDirectory); + + var moduleNames = new[] + { + "Common.Logging", + "Common.Logging.Core", + "Spring.Core", + "Spring.Aop", + "Spring.Data", + "Spring.Data.NHibernate*", + "Spring.Web", + "Spring.Web.Mvc5", + "Spring.Web.Extensions", + "Spring.Services", + "Spring.Testing.NUnit", + "Spring.Testing.Microsoft", + "Spring.Messaging.Ems", + "Spring.Messaging.Nms", + "Spring.Messaging", + "Spring.Scheduling.Quartz3", + "Spring.Template.Velocity", + "Spring.Web.Conversation.NHibernate5", + }; + + var patterns = moduleNames + .SelectMany(x => new [] + { + "**/" + Configuration + "/**/" + x + ".dll", + "**/" + Configuration + "/**/" + x + ".xml", + "**/" + Configuration + "/**/" + x + ".pdb" + }) + .ToArray(); + + foreach (var file in BuildDirectory.GlobFiles(patterns)) + { + CopyFileToDirectory(file, binDirectory / "net", FileExistsPolicy.OverwriteIfNewer); + } + }); + + IEnumerable GetActiveProjects() + { + var packTargets = Solution.GetProjects("*") + .Where(x => x.Name != "Spring.Messaging.Ems" || BuildEms) + .Where(x => !x.Name.Contains("_build")); + return packTargets; + } +} diff --git a/build-support/nuke-build/Configuration.cs b/build-support/nuke-build/Configuration.cs new file mode 100644 index 00000000..9c08b1ae --- /dev/null +++ b/build-support/nuke-build/Configuration.cs @@ -0,0 +1,16 @@ +using System; +using System.ComponentModel; +using System.Linq; +using Nuke.Common.Tooling; + +[TypeConverter(typeof(TypeConverter))] +public class Configuration : Enumeration +{ + public static Configuration Debug = new Configuration { Value = nameof(Debug) }; + public static Configuration Release = new Configuration { Value = nameof(Release) }; + + public static implicit operator string(Configuration configuration) + { + return configuration.Value; + } +} diff --git a/build-support/nuke-build/Directory.Build.props b/build-support/nuke-build/Directory.Build.props new file mode 100644 index 00000000..e147d635 --- /dev/null +++ b/build-support/nuke-build/Directory.Build.props @@ -0,0 +1,8 @@ + + + + + + + + diff --git a/build-support/nuke-build/Directory.Build.targets b/build-support/nuke-build/Directory.Build.targets new file mode 100644 index 00000000..25326095 --- /dev/null +++ b/build-support/nuke-build/Directory.Build.targets @@ -0,0 +1,8 @@ + + + + + + + + diff --git a/build-support/nuke-build/_build.csproj b/build-support/nuke-build/_build.csproj new file mode 100644 index 00000000..d12484e5 --- /dev/null +++ b/build-support/nuke-build/_build.csproj @@ -0,0 +1,17 @@ + + + + Exe + net5.0 + + CS0649;CS0169 + ..\.. + ..\.. + 1 + + + + + + + diff --git a/build-support/nuke-build/_build.csproj.DotSettings b/build-support/nuke-build/_build.csproj.DotSettings new file mode 100644 index 00000000..7bc28484 --- /dev/null +++ b/build-support/nuke-build/_build.csproj.DotSettings @@ -0,0 +1,27 @@ + + DO_NOT_SHOW + DO_NOT_SHOW + DO_NOT_SHOW + DO_NOT_SHOW + Implicit + Implicit + ExpressionBody + 0 + NEXT_LINE + True + False + 120 + IF_OWNER_IS_SINGLE_LINE + WRAP_IF_LONG + False + <Policy Inspect="True" Prefix="" Suffix="" Style="AaBb" /> + <Policy Inspect="True" Prefix="" Suffix="" Style="AaBb" /> + True + True + True + True + True + True + True + True + True diff --git a/build.cmd b/build.cmd new file mode 100644 index 00000000..6d78c42e --- /dev/null +++ b/build.cmd @@ -0,0 +1,7 @@ +:; set -eo pipefail +:; SCRIPT_DIR=$(cd "$( dirname "${BASH_SOURCE[0]}" )" && pwd) +:; ${SCRIPT_DIR}/build.sh "$@" +:; exit $? + +@ECHO OFF +powershell -ExecutionPolicy ByPass -NoProfile -File "%~dp0build.ps1" %* diff --git a/build.ps1 b/build.ps1 new file mode 100644 index 00000000..f623fa7f --- /dev/null +++ b/build.ps1 @@ -0,0 +1,69 @@ +[CmdletBinding()] +Param( + [Parameter(Position=0,Mandatory=$false,ValueFromRemainingArguments=$true)] + [string[]]$BuildArguments +) + +Write-Output "PowerShell $($PSVersionTable.PSEdition) version $($PSVersionTable.PSVersion)" + +Set-StrictMode -Version 2.0; $ErrorActionPreference = "Stop"; $ConfirmPreference = "None"; trap { Write-Error $_ -ErrorAction Continue; exit 1 } +$PSScriptRoot = Split-Path $MyInvocation.MyCommand.Path -Parent + +########################################################################### +# CONFIGURATION +########################################################################### + +$BuildProjectFile = "$PSScriptRoot\build-support\nuke-build\_build.csproj" +$TempDirectory = "$PSScriptRoot\\.nuke\temp" + +$DotNetGlobalFile = "$PSScriptRoot\\global.json" +$DotNetInstallUrl = "https://dot.net/v1/dotnet-install.ps1" +$DotNetChannel = "Current" + +$env:DOTNET_SKIP_FIRST_TIME_EXPERIENCE = 1 +$env:DOTNET_CLI_TELEMETRY_OPTOUT = 1 +$env:DOTNET_MULTILEVEL_LOOKUP = 0 + +########################################################################### +# EXECUTION +########################################################################### + +function ExecSafe([scriptblock] $cmd) { + & $cmd + if ($LASTEXITCODE) { exit $LASTEXITCODE } +} + +# If dotnet CLI is installed globally and it matches requested version, use for execution +if ($null -ne (Get-Command "dotnet" -ErrorAction SilentlyContinue) -and ` + $(dotnet --version) -and $LASTEXITCODE -eq 0) { + $env:DOTNET_EXE = (Get-Command "dotnet").Path +} +else { + # Download install script + $DotNetInstallFile = "$TempDirectory\dotnet-install.ps1" + New-Item -ItemType Directory -Path $TempDirectory -Force | Out-Null + [Net.ServicePointManager]::SecurityProtocol = [Net.SecurityProtocolType]::Tls12 + (New-Object System.Net.WebClient).DownloadFile($DotNetInstallUrl, $DotNetInstallFile) + + # If global.json exists, load expected version + if (Test-Path $DotNetGlobalFile) { + $DotNetGlobal = $(Get-Content $DotNetGlobalFile | Out-String | ConvertFrom-Json) + if ($DotNetGlobal.PSObject.Properties["sdk"] -and $DotNetGlobal.sdk.PSObject.Properties["version"]) { + $DotNetVersion = $DotNetGlobal.sdk.version + } + } + + # Install by channel or version + $DotNetDirectory = "$TempDirectory\dotnet-win" + if (!(Test-Path variable:DotNetVersion)) { + ExecSafe { & $DotNetInstallFile -InstallDir $DotNetDirectory -Channel $DotNetChannel -NoPath } + } else { + ExecSafe { & $DotNetInstallFile -InstallDir $DotNetDirectory -Version $DotNetVersion -NoPath } + } + $env:DOTNET_EXE = "$DotNetDirectory\dotnet.exe" +} + +Write-Output "Microsoft (R) .NET Core SDK version $(& $env:DOTNET_EXE --version)" + +ExecSafe { & $env:DOTNET_EXE build $BuildProjectFile /nodeReuse:false /p:UseSharedCompilation=false -nologo -clp:NoSummary --verbosity quiet } +ExecSafe { & $env:DOTNET_EXE run --project $BuildProjectFile --no-build -- $BuildArguments } diff --git a/build.sh b/build.sh new file mode 100755 index 00000000..3c2ddf5c --- /dev/null +++ b/build.sh @@ -0,0 +1,62 @@ +#!/usr/bin/env bash + +bash --version 2>&1 | head -n 1 + +set -eo pipefail +SCRIPT_DIR=$(cd "$( dirname "${BASH_SOURCE[0]}" )" && pwd) + +########################################################################### +# CONFIGURATION +########################################################################### + +BUILD_PROJECT_FILE="$SCRIPT_DIR/build-support/nuke-build/_build.csproj" +TEMP_DIRECTORY="$SCRIPT_DIR//.nuke/temp" + +DOTNET_GLOBAL_FILE="$SCRIPT_DIR//global.json" +DOTNET_INSTALL_URL="https://dot.net/v1/dotnet-install.sh" +DOTNET_CHANNEL="Current" + +export DOTNET_CLI_TELEMETRY_OPTOUT=1 +export DOTNET_SKIP_FIRST_TIME_EXPERIENCE=1 +export DOTNET_MULTILEVEL_LOOKUP=0 + +########################################################################### +# EXECUTION +########################################################################### + +function FirstJsonValue { + perl -nle 'print $1 if m{"'"$1"'": "([^"]+)",?}' <<< "${@:2}" +} + +# If dotnet CLI is installed globally and it matches requested version, use for execution +if [ -x "$(command -v dotnet)" ] && dotnet --version &>/dev/null; then + export DOTNET_EXE="$(command -v dotnet)" +else + # Download install script + DOTNET_INSTALL_FILE="$TEMP_DIRECTORY/dotnet-install.sh" + mkdir -p "$TEMP_DIRECTORY" + curl -Lsfo "$DOTNET_INSTALL_FILE" "$DOTNET_INSTALL_URL" + chmod +x "$DOTNET_INSTALL_FILE" + + # If global.json exists, load expected version + if [[ -f "$DOTNET_GLOBAL_FILE" ]]; then + DOTNET_VERSION=$(FirstJsonValue "version" "$(cat "$DOTNET_GLOBAL_FILE")") + if [[ "$DOTNET_VERSION" == "" ]]; then + unset DOTNET_VERSION + fi + fi + + # Install by channel or version + DOTNET_DIRECTORY="$TEMP_DIRECTORY/dotnet-unix" + if [[ -z ${DOTNET_VERSION+x} ]]; then + "$DOTNET_INSTALL_FILE" --install-dir "$DOTNET_DIRECTORY" --channel "$DOTNET_CHANNEL" --no-path + else + "$DOTNET_INSTALL_FILE" --install-dir "$DOTNET_DIRECTORY" --version "$DOTNET_VERSION" --no-path + fi + export DOTNET_EXE="$DOTNET_DIRECTORY/dotnet" +fi + +echo "Microsoft (R) .NET Core SDK version $("$DOTNET_EXE" --version)" + +"$DOTNET_EXE" build "$BUILD_PROJECT_FILE" /nodeReuse:false /p:UseSharedCompilation=false -nologo -clp:NoSummary --verbosity quiet +"$DOTNET_EXE" run --project "$BUILD_PROJECT_FILE" --no-build -- "$@" diff --git a/docker-compose-ci.yml b/docker-compose-ci.yml new file mode 100644 index 00000000..4615f83d --- /dev/null +++ b/docker-compose-ci.yml @@ -0,0 +1,12 @@ +version: '2' + +services: + + sqlserver: + image: mcr.microsoft.com/mssql/server:2019-latest + environment: + - MSSQL_PID=Express + - ACCEPT_EULA=Y + - SA_PASSWORD=MyPassword! + ports: + - 1433:1433 diff --git a/docker-compose.yml b/docker-compose.yml new file mode 100644 index 00000000..1bec6dfb --- /dev/null +++ b/docker-compose.yml @@ -0,0 +1,12 @@ +version: '2' + +services: + + sqlserver: + image: mcr.microsoft.com/mssql/server:2019-CU8-ubuntu-16.04 + environment: + - MSSQL_PID=Express + - ACCEPT_EULA=Y + - SA_PASSWORD=MyPassword! + ports: + - 1433:1433 diff --git a/global.json b/global.json new file mode 100644 index 00000000..c5b8f566 --- /dev/null +++ b/global.json @@ -0,0 +1,6 @@ +{ + "sdk": { + "version": "5.0", + "rollForward": "latestFeature" + } +} \ No newline at end of file diff --git a/src/Directory.Build.props b/src/Directory.Build.props index 7e533eec..ffdabaa8 100644 --- a/src/Directory.Build.props +++ b/src/Directory.Build.props @@ -11,17 +11,20 @@ false true - false false false - + Spring.NET + SpringSource + Copyright 2002-2021 Spring.NET Framework Team. + Apache License, Version 2.0 + 3.4.1 SpringSource SpringSource_Leaves32x32.png - http://springframework.net/images/SpringSource_Leaves32x32.png + https://springframework.net/images/SpringSource_Leaves32x32.png Apache-2.0 - http://www.springframework.net/ + https://www.springframework.net/ Library en-US diff --git a/src/Spring/Spring.Aop/Spring.Aop.csproj b/src/Spring/Spring.Aop/Spring.Aop.csproj index 0b45dff5..2909993a 100644 --- a/src/Spring/Spring.Aop/Spring.Aop.csproj +++ b/src/Spring/Spring.Aop/Spring.Aop.csproj @@ -10,10 +10,6 @@ - - GenCommonAssemblyInfo.cs - Code - spring-aop-1.1.xsd diff --git a/src/Spring/Spring.Core/Expressions/Expression.cs b/src/Spring/Spring.Core/Expressions/Expression.cs index da201685..c9e63b0e 100644 --- a/src/Spring/Spring.Core/Expressions/Expression.cs +++ b/src/Spring/Spring.Core/Expressions/Expression.cs @@ -1,7 +1,7 @@ #region License /* - * Copyright © 2002-2011 the original author or authors. + * Copyright © 2002-2011 the original author or authors. * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. @@ -40,8 +40,8 @@ namespace Spring.Expressions /// ///

/// Preparing this object once and reusing it many times for expression - /// evaluation can result in significant performance improvements, as - /// expression parsing and reflection lookups are only performed once. + /// evaluation can result in significant performance improvements, as + /// expression parsing and reflection lookups are only performed once. ///

///
/// Aleksandar Seovic @@ -99,9 +99,9 @@ namespace Spring.Expressions Typename2Creator = new Hashtable(); foreach (Type type in typeof(SpringASTFactory).Assembly.GetTypes()) { - if (BASENODE_TYPE.IsAssignableFrom(type)) + if (BASENODE_TYPE.IsAssignableFrom(type) && !type.IsAbstract) { - ConstructorInfo ctor = type.GetConstructor(new Type[0]); + ConstructorInfo ctor = type.GetConstructor(System.Type.EmptyTypes); if (ctor != null) { ASTNodeCreator creator = new ASTNodeCreator(ctor); @@ -258,7 +258,7 @@ namespace Spring.Expressions { } /// - /// Evaluates this expression for the specified root object and returns + /// Evaluates this expression for the specified root object and returns /// value of the last node. /// /// Context to evaluate expressions against. @@ -283,7 +283,7 @@ namespace Spring.Expressions } /// - /// Evaluates this expression for the specified root object and sets + /// Evaluates this expression for the specified root object and sets /// value of the last node. /// /// Context to evaluate expressions against. @@ -319,7 +319,7 @@ namespace Spring.Expressions } /// - /// Evaluates this expression for the specified root object and returns + /// Evaluates this expression for the specified root object and returns /// of the last node, if possible. /// /// Context to evaluate expression against. diff --git a/src/Spring/Spring.Core/Spring.Core.csproj b/src/Spring/Spring.Core/Spring.Core.csproj index c241d389..8d79718c 100644 --- a/src/Spring/Spring.Core/Spring.Core.csproj +++ b/src/Spring/Spring.Core/Spring.Core.csproj @@ -4,10 +4,6 @@ Core functionality for Spring.Net IoC container 219, 162, 618, 1591 - - rem $(ProjectDir)..\..\..\build-support\tools\antlr-2.7.6\antlr-2.7.6.exe -o $(ProjectDir)Expressions\Parser $(ProjectDir)Expressions\Expression.g - - @@ -30,10 +26,6 @@ - - GenCommonAssemblyInfo.cs - Code - diff --git a/src/Spring/Spring.Core/Util/DynamicCodeManager.cs b/src/Spring/Spring.Core/Util/DynamicCodeManager.cs index e5a5d652..0909b991 100644 --- a/src/Spring/Spring.Core/Util/DynamicCodeManager.cs +++ b/src/Spring/Spring.Core/Util/DynamicCodeManager.cs @@ -1,7 +1,7 @@ #region License /* - * Copyright © 2002-2011 the original author or authors. + * Copyright � 2002-2011 the original author or authors. * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. @@ -36,7 +36,7 @@ namespace Spring.Util /// /// ///

- /// The purpose of this class is to provide a simple abstraction for creating and managing dynamic assemblies. + /// The purpose of this class is to provide a simple abstraction for creating and managing dynamic assemblies. ///

/// /// Using this factory you can't define several modules within a single dynamic assembly - only a simple one2one relation between assembly/module is used. @@ -66,7 +66,7 @@ namespace Spring.Util public sealed class DynamicCodeManager { private static readonly Hashtable s_moduleCache = new CaseInsensitiveHashtable(); //CollectionsUtil.CreateCaseInsensitiveHashtable(); - + /// /// prevent instantiation /// @@ -74,13 +74,13 @@ namespace Spring.Util { throw new InvalidOperationException(); } - + /// /// Returns the for the dynamic module within the specified assembly. /// /// /// If the assembly does not exist yet, it will be created.
- /// This factory caches any dynamic assembly it creates - calling GetModule() twice with + /// This factory caches any dynamic assembly it creates - calling GetModule() twice with /// the same name will *not* create 2 distinct modules! ///
/// The assembly-name of the module to be returned @@ -111,7 +111,7 @@ namespace Spring.Util an.SetPublicKey(Assembly.GetExecutingAssembly().GetName().GetPublicKey()); var assembly = AppDomain.CurrentDomain.DefineDynamicAssembly(an, AssemblyBuilderAccess.Run, null, null, null, null,null, true ); #if DEBUG - module = assembly.DefineDynamicModule(an.Name, true); + var module = assembly.DefineDynamicModule(an.Name, true); #else var module = assembly.DefineDynamicModule(an.Name, false); #endif @@ -138,13 +138,13 @@ namespace Spring.Util public static void SaveAssembly( string assemblyName ) { AssertUtils.ArgumentHasText(assemblyName, "assemblyName"); - + ModuleBuilder module = null; lock(s_moduleCache.SyncRoot) { module = (ModuleBuilder) s_moduleCache[assemblyName]; } - + if(module == null) { throw new ArgumentException(string.Format("'{0}' is not a valid dynamic assembly name", assemblyName), "assemblyName"); diff --git a/src/Spring/Spring.Data.NHibernate5/Spring.Data.NHibernate5.csproj b/src/Spring/Spring.Data.NHibernate5/Spring.Data.NHibernate5.csproj index f4d8eaad..b38ffbe0 100644 --- a/src/Spring/Spring.Data.NHibernate5/Spring.Data.NHibernate5.csproj +++ b/src/Spring/Spring.Data.NHibernate5/Spring.Data.NHibernate5.csproj @@ -19,9 +19,6 @@
- - GenCommonAssemblyInfo.cs -
\ No newline at end of file diff --git a/src/Spring/Spring.Data/Spring.Data.csproj b/src/Spring/Spring.Data/Spring.Data.csproj index 62c314d9..af5c95a3 100644 --- a/src/Spring/Spring.Data/Spring.Data.csproj +++ b/src/Spring/Spring.Data/Spring.Data.csproj @@ -15,9 +15,6 @@ - - GenCommonAssemblyInfo.cs - spring-database-1.3.xsd diff --git a/src/Spring/Spring.Messaging.Ems/Spring.Messaging.Ems.csproj b/src/Spring/Spring.Messaging.Ems/Spring.Messaging.Ems.csproj index 7c2ba956..f1899bd8 100644 --- a/src/Spring/Spring.Messaging.Ems/Spring.Messaging.Ems.csproj +++ b/src/Spring/Spring.Messaging.Ems/Spring.Messaging.Ems.csproj @@ -21,9 +21,6 @@ - - GenCommonAssemblyInfo.cs - \ No newline at end of file diff --git a/src/Spring/Spring.Messaging.Nms/Spring.Messaging.Nms.csproj b/src/Spring/Spring.Messaging.Nms/Spring.Messaging.Nms.csproj index ca6c464f..31edc972 100644 --- a/src/Spring/Spring.Messaging.Nms/Spring.Messaging.Nms.csproj +++ b/src/Spring/Spring.Messaging.Nms/Spring.Messaging.Nms.csproj @@ -12,9 +12,6 @@ - - GenCommonAssemblyInfo.cs - diff --git a/src/Spring/Spring.Messaging/Spring.Messaging.csproj b/src/Spring/Spring.Messaging/Spring.Messaging.csproj index 85729a59..cd33698c 100644 --- a/src/Spring/Spring.Messaging/Spring.Messaging.csproj +++ b/src/Spring/Spring.Messaging/Spring.Messaging.csproj @@ -11,11 +11,6 @@ - - - GenCommonAssemblyInfo.cs - - diff --git a/src/Spring/Spring.Scheduling.Quartz3/Spring.Scheduling.Quartz3.csproj b/src/Spring/Spring.Scheduling.Quartz3/Spring.Scheduling.Quartz3.csproj index 3dd057d8..c0ac73f7 100644 --- a/src/Spring/Spring.Scheduling.Quartz3/Spring.Scheduling.Quartz3.csproj +++ b/src/Spring/Spring.Scheduling.Quartz3/Spring.Scheduling.Quartz3.csproj @@ -10,9 +10,4 @@ - - - GenCommonAssemblyInfo.cs - - \ No newline at end of file diff --git a/src/Spring/Spring.Services/Spring.Services.csproj b/src/Spring/Spring.Services/Spring.Services.csproj index ea2d6d39..fdfccb19 100644 --- a/src/Spring/Spring.Services/Spring.Services.csproj +++ b/src/Spring/Spring.Services/Spring.Services.csproj @@ -15,10 +15,6 @@ - - GenCommonAssemblyInfo.cs - Code - diff --git a/src/Spring/Spring.Template.Velocity.Castle/Spring.Template.Velocity.Castle.csproj b/src/Spring/Spring.Template.Velocity.Castle/Spring.Template.Velocity.Castle.csproj index a33d7838..18bd4378 100644 --- a/src/Spring/Spring.Template.Velocity.Castle/Spring.Template.Velocity.Castle.csproj +++ b/src/Spring/Spring.Template.Velocity.Castle/Spring.Template.Velocity.Castle.csproj @@ -9,9 +9,6 @@ - - GenCommonAssemblyInfo.cs - Template\Velocity\CommonsLoggingLogSystem.cs diff --git a/src/Spring/Spring.Template.Velocity/Spring.Template.Velocity.csproj b/src/Spring/Spring.Template.Velocity/Spring.Template.Velocity.csproj index 775a0fb4..e896d8fc 100644 --- a/src/Spring/Spring.Template.Velocity/Spring.Template.Velocity.csproj +++ b/src/Spring/Spring.Template.Velocity/Spring.Template.Velocity.csproj @@ -10,9 +10,6 @@ - - GenCommonAssemblyInfo.cs - \ No newline at end of file diff --git a/src/Spring/Spring.Testing.Microsoft/Spring.Testing.Microsoft.csproj b/src/Spring/Spring.Testing.Microsoft/Spring.Testing.Microsoft.csproj index 5ef008eb..c3532b8e 100644 --- a/src/Spring/Spring.Testing.Microsoft/Spring.Testing.Microsoft.csproj +++ b/src/Spring/Spring.Testing.Microsoft/Spring.Testing.Microsoft.csproj @@ -10,9 +10,4 @@ - - - GenCommonAssemblyInfo.cs - - \ No newline at end of file diff --git a/src/Spring/Spring.Testing.NUnit/Spring.Testing.NUnit.csproj b/src/Spring/Spring.Testing.NUnit/Spring.Testing.NUnit.csproj index b9f0e2a2..d47ad6c9 100644 --- a/src/Spring/Spring.Testing.NUnit/Spring.Testing.NUnit.csproj +++ b/src/Spring/Spring.Testing.NUnit/Spring.Testing.NUnit.csproj @@ -11,10 +11,4 @@ - - - GenCommonAssemblyInfo.cs - - - \ No newline at end of file diff --git a/src/Spring/Spring.Web.Conversation.NHibernate5/Spring.Web.Conversation.NHibernate5.csproj b/src/Spring/Spring.Web.Conversation.NHibernate5/Spring.Web.Conversation.NHibernate5.csproj index 8c3e5265..e670abed 100644 --- a/src/Spring/Spring.Web.Conversation.NHibernate5/Spring.Web.Conversation.NHibernate5.csproj +++ b/src/Spring/Spring.Web.Conversation.NHibernate5/Spring.Web.Conversation.NHibernate5.csproj @@ -11,10 +11,4 @@ - - - GenCommonAssemblyInfo.cs - - - \ No newline at end of file diff --git a/src/Spring/Spring.Web.Extensions/Spring.Web.Extensions.csproj b/src/Spring/Spring.Web.Extensions/Spring.Web.Extensions.csproj index f997497b..e827b640 100644 --- a/src/Spring/Spring.Web.Extensions/Spring.Web.Extensions.csproj +++ b/src/Spring/Spring.Web.Extensions/Spring.Web.Extensions.csproj @@ -12,9 +12,4 @@ - - - GenCommonAssemblyInfo.cs - - \ No newline at end of file diff --git a/src/Spring/Spring.Web.Mvc5/Spring.Web.Mvc5.csproj b/src/Spring/Spring.Web.Mvc5/Spring.Web.Mvc5.csproj index a71a0003..287d9124 100644 --- a/src/Spring/Spring.Web.Mvc5/Spring.Web.Mvc5.csproj +++ b/src/Spring/Spring.Web.Mvc5/Spring.Web.Mvc5.csproj @@ -18,9 +18,4 @@ - - - GenCommonAssemblyInfo.cs - - \ No newline at end of file diff --git a/src/Spring/Spring.Web/Spring.Web.csproj b/src/Spring/Spring.Web/Spring.Web.csproj index fd82aeb6..7c0d5736 100644 --- a/src/Spring/Spring.Web/Spring.Web.csproj +++ b/src/Spring/Spring.Web/Spring.Web.csproj @@ -14,10 +14,4 @@ - - - GenCommonAssemblyInfo.cs - Code - - \ No newline at end of file diff --git a/test/Directory.Build.props b/test/Directory.Build.props index c0581b50..885c9646 100644 --- a/test/Directory.Build.props +++ b/test/Directory.Build.props @@ -17,11 +17,11 @@ 3.4.1 2.0.8 - 3.12.0 + 3.13.1 3.17.0 6.2.1 6.0.0 - 16.8.0 + 16.9.4 True False @@ -30,6 +30,8 @@ latest net461 + + false diff --git a/test/Spring/Spring.Aop.Tests/Aop/Framework/Adapter/AdvisorAdapterRegistrationTests.cs b/test/Spring/Spring.Aop.Tests/Aop/Framework/Adapter/AdvisorAdapterRegistrationTests.cs index 8806a520..1f24ad0f 100644 --- a/test/Spring/Spring.Aop.Tests/Aop/Framework/Adapter/AdvisorAdapterRegistrationTests.cs +++ b/test/Spring/Spring.Aop.Tests/Aop/Framework/Adapter/AdvisorAdapterRegistrationTests.cs @@ -1,13 +1,13 @@ #region License /* * Copyright 2002-2010 the original author or authors. - * + * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. * You may obtain a copy of the License at - * + * * http://www.apache.org/licenses/LICENSE-2.0 - * + * * Unless required by applicable law or agreed to in writing, software * distributed under the License is distributed on an "AS IS" BASIS, * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. @@ -34,22 +34,22 @@ namespace Spring.Aop.Framework.Adapter /// /// Dmitriy Kopylenko /// Simon White (.NET) - [TestFixture] + [Platform("Win")] public class AdvisorAdapterRegistrationTests { [Test] - public void AdvisorAdapterRegistrationManagerNotPresentInContext() + public void AdvisorAdapterRegistrationManagerNotPresentInContext() { string configLocation = ReadOnlyXmlTestResource.GetFilePath("withoutBPPContext.xml", typeof(AdvisorAdapterRegistrationTests)); IApplicationContext ctx = new XmlApplicationContext(configLocation); ITestObject to = (ITestObject) ctx.GetObject("testObject"); // just invoke any method to see if advice fired - try + try { to.ReturnsThis(); Assert.Fail("Should throw UnknownAdviceTypeException"); } - catch (UnknownAdviceTypeException) + catch (UnknownAdviceTypeException) { // expected Assert.AreEqual(0, GetAdviceImpl(to).InvocationCounter); @@ -57,24 +57,24 @@ namespace Spring.Aop.Framework.Adapter } [Test] - public void AdvisorAdapterRegistrationManagerPresentInContext() + public void AdvisorAdapterRegistrationManagerPresentInContext() { string configLocation = ReadOnlyXmlTestResource.GetFilePath("withBPPContext.xml", typeof(AdvisorAdapterRegistrationTests)); IApplicationContext ctx = new XmlApplicationContext(configLocation); ITestObject to = (ITestObject) ctx.GetObject("testObject"); // just invoke any method to see if advice fired - try + try { to.ReturnsThis(); Assert.AreEqual(1, GetAdviceImpl(to).InvocationCounter); } - catch (UnknownAdviceTypeException) + catch (UnknownAdviceTypeException) { Assert.Fail("Should not throw UnknownAdviceTypeException"); } } - private SimpleBeforeAdviceImpl GetAdviceImpl(ITestObject to) + private SimpleBeforeAdviceImpl GetAdviceImpl(ITestObject to) { IAdvised advised = (IAdvised) to; IAdvisor advisor = advised.Advisors[0]; diff --git a/test/Spring/Spring.Aop.Tests/Aop/Framework/AutoProxy/AbstractAutoProxyCreatorTests.cs b/test/Spring/Spring.Aop.Tests/Aop/Framework/AutoProxy/AbstractAutoProxyCreatorTests.cs index 318a1928..6addd5bb 100644 --- a/test/Spring/Spring.Aop.Tests/Aop/Framework/AutoProxy/AbstractAutoProxyCreatorTests.cs +++ b/test/Spring/Spring.Aop.Tests/Aop/Framework/AutoProxy/AbstractAutoProxyCreatorTests.cs @@ -51,7 +51,7 @@ namespace Spring.Aop.Framework.AutoProxy public class ObjectWithoutInterface { public virtual void Foo() - { } + { } } public class TransparentProxyFactory : IFactoryObject @@ -162,12 +162,13 @@ namespace Spring.Aop.Framework.AutoProxy } [Test] + [Platform("Win")] public void ProxyTransparentProxy() { DefaultListableObjectFactory of = new DefaultListableObjectFactory(); ConstructorArgumentValues ctorArgs = new ConstructorArgumentValues(); - ctorArgs.AddNamedArgumentValue("objectType", typeof(ITestObject)); + ctorArgs.AddNamedArgumentValue("objectType", typeof(ITestObject)); of.RegisterObjectDefinition("bar", new RootObjectDefinition(typeof(TransparentProxyFactory), ctorArgs, null)); TestAutoProxyCreator apc = new TestAutoProxyCreator(of); diff --git a/test/Spring/Spring.Aop.Tests/Aop/Framework/DynamicProxy/AbstractAopProxyTests.cs b/test/Spring/Spring.Aop.Tests/Aop/Framework/DynamicProxy/AbstractAopProxyTests.cs index d2f48a95..4b407d90 100644 --- a/test/Spring/Spring.Aop.Tests/Aop/Framework/DynamicProxy/AbstractAopProxyTests.cs +++ b/test/Spring/Spring.Aop.Tests/Aop/Framework/DynamicProxy/AbstractAopProxyTests.cs @@ -1,5 +1,5 @@ /* - * Copyright © 2002-2011 the original author or authors. + * Copyright © 2002-2011 the original author or authors. * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. @@ -532,6 +532,7 @@ namespace Spring.Aop.Framework.DynamicProxy } [Test] + [Platform("Win")] public void ProxyMethodWithRefOutParametersWithDirectCall() { PublicRefOutTestObject target = new PublicRefOutTestObject(); @@ -547,6 +548,7 @@ namespace Spring.Aop.Framework.DynamicProxy } [Test] + [Platform("Win")] public void ProxyMethodWithRefOutParametersWithDynamicReflection() { PublicRefOutTestObject target = new PublicRefOutTestObject(); @@ -566,6 +568,7 @@ namespace Spring.Aop.Framework.DynamicProxy } [Test] + [Platform("Win")] public virtual void ProxyMethodWithRefOutParametersWithStandardReflection() { InternalRefOutTestObject target = new InternalRefOutTestObject(); @@ -660,6 +663,7 @@ namespace Spring.Aop.Framework.DynamicProxy } [Test] + [Platform("Win")] public void ProxyGenericMethodWithRefOutParametersWithDirectCall() { PublicRefOutGenericTestObject target = new PublicRefOutGenericTestObject(); @@ -675,6 +679,7 @@ namespace Spring.Aop.Framework.DynamicProxy } [Test] + [Platform("Win")] public void ProxyGenericMethodWithRefOutParametersWithDynamicReflection() { PublicRefOutGenericTestObject target = new PublicRefOutGenericTestObject(); @@ -694,6 +699,7 @@ namespace Spring.Aop.Framework.DynamicProxy } [Test] + [Platform("Win")] public virtual void ProxyGenericMethodWithRefOutParametersWithStandardReflection() { InternalRefOutGenericTestObject target = new InternalRefOutGenericTestObject(); @@ -844,6 +850,7 @@ namespace Spring.Aop.Framework.DynamicProxy } [Test(Description = "http://opensource.atlassian.com/projects/spring/browse/SPRNET-340")] + [Platform("Win")] public void MultiThreadedProxyCreation() { MultiThreadedProxyCreation(5); diff --git a/test/Spring/Spring.Aop.Tests/Aop/Support/RegularExpressionMethodPointcutAdvisorTests.cs b/test/Spring/Spring.Aop.Tests/Aop/Support/RegularExpressionMethodPointcutAdvisorTests.cs index 02dfc5f2..87359549 100644 --- a/test/Spring/Spring.Aop.Tests/Aop/Support/RegularExpressionMethodPointcutAdvisorTests.cs +++ b/test/Spring/Spring.Aop.Tests/Aop/Support/RegularExpressionMethodPointcutAdvisorTests.cs @@ -1,13 +1,13 @@ #region License /* * Copyright 2002-2010 the original author or authors. - * + * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. * You may obtain a copy of the License at - * + * * http://www.apache.org/licenses/LICENSE-2.0 - * + * * Unless required by applicable law or agreed to in writing, software * distributed under the License is distributed on an "AS IS" BASIS, * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. @@ -55,7 +55,7 @@ namespace Spring.Aop.Support // Interceptor behind regexp advisor NopInterceptor nop = (NopInterceptor) iof.GetObject("NopInterceptor"); Assert.AreEqual(0, nop.Count); - + int newAge = 12; // Not advised advised.Exceptional(null); @@ -74,20 +74,20 @@ namespace Spring.Aop.Support { IObjectFactory iof = new XmlObjectFactory(new ReadOnlyXmlTestResource("RegularExpressionSetterTests.xml", GetType())); IPerson advised = (IPerson) iof.GetObject("SettersAndReturnsThisAdvised"); - + // Interceptor behind regexp advisor NopInterceptor nop = (NopInterceptor) iof.GetObject("NopInterceptor"); Assert.AreEqual(0, nop.Count); - + int newAge = 12; // Not advised advised.Exceptional(null); Assert.AreEqual(0, nop.Count); - + // This is proxied advised.ReturnsThis(); Assert.AreEqual(1, nop.Count); - + // Only setter is advised advised.SetAge(newAge); Assert.AreEqual(2, nop.Count); @@ -97,6 +97,7 @@ namespace Spring.Aop.Support } [Test] + [Platform("Win")] public void Serialization() { IObjectFactory iof = new XmlObjectFactory(new ReadOnlyXmlTestResource("RegularExpressionSetterTests.xml", GetType())); @@ -104,12 +105,12 @@ namespace Spring.Aop.Support // Interceptor behind regexp advisor NopInterceptor nop = (NopInterceptor) iof.GetObject("NopInterceptor"); Assert.AreEqual(0, nop.Count); - + int newAge = 12; // Not advised Assert.AreEqual(0, p.GetAge()); Assert.AreEqual(0, nop.Count); - + // This is proxied p.SetAge(newAge); Assert.AreEqual(1, nop.Count); @@ -117,7 +118,7 @@ namespace Spring.Aop.Support Assert.AreEqual(newAge, p.GetAge()); // Only setter fired Assert.AreEqual(2, nop.Count); - + // Serialize and continue... #if !NETCOREAPP // deep chains for Type serialization problems, not worth the effort at the moment diff --git a/test/Spring/Spring.Aop.Tests/Spring.Aop.Tests.csproj b/test/Spring/Spring.Aop.Tests/Spring.Aop.Tests.csproj index 6660ab98..0ff35260 100644 --- a/test/Spring/Spring.Aop.Tests/Spring.Aop.Tests.csproj +++ b/test/Spring/Spring.Aop.Tests/Spring.Aop.Tests.csproj @@ -25,7 +25,14 @@ - + + Data\%(RecursiveDir)%(Filename)%(Extension) + PreserveNewest + + + %(RecursiveDir)%(Filename)%(Extension) + PreserveNewest + diff --git a/test/Spring/Spring.Core.Tests/Core/IO/FileSystemResourceTests.cs b/test/Spring/Spring.Core.Tests/Core/IO/FileSystemResourceTests.cs index 5098cf84..447984f4 100644 --- a/test/Spring/Spring.Core.Tests/Core/IO/FileSystemResourceTests.cs +++ b/test/Spring/Spring.Core.Tests/Core/IO/FileSystemResourceTests.cs @@ -1,7 +1,7 @@ #region License /* - * Copyright © 2002-2011 the original author or authors. + * Copyright © 2002-2011 the original author or authors. * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. @@ -32,19 +32,19 @@ namespace Spring.Core.IO /// Unit tests for the FileSystemResourceTest class. /// /// Rick Evans - [TestFixture] + [Platform("Win")] public class FileSystemResourceTests : FileSystemResourceCommonTests { protected override FileSystemResource CreateResourceInstance( string resourceName ) { return new FileSystemResource(resourceName); } - + [Test] public void LeadingProtocolIsNotTreatedRelative() { FileSystemResource res = new FileSystemResource(@"file://\\server\share\samples\artfair\"); - FileSystemResource res2 = (FileSystemResource) res.CreateRelative(@"file://./index.html"); + FileSystemResource res2 = (FileSystemResource) res.CreateRelative(@"file://./index.html"); Assert.AreEqual(new Uri(Path.Combine(Environment.CurrentDirectory, "index.html")).AbsolutePath, res2.Uri.AbsolutePath); } @@ -94,7 +94,7 @@ namespace Spring.Core.IO } } } - + [Test] public void Resolution_WithProtocolAndSpecialHomeCharacter() { @@ -116,7 +116,7 @@ namespace Spring.Core.IO "The file name with file://~/.. must have resolved to a file " + "in the parent directory of the currently executing domain."); } - + [Test] public void CreateRelativeWithParent() { @@ -198,7 +198,7 @@ namespace Spring.Core.IO } } } - + [Test] public void RelativeLocalFileSystemResourceWhenNotRelative() { @@ -259,8 +259,8 @@ namespace Spring.Core.IO IResource rel5 = res.CreateRelative(@"..\..\index.html"); Assert.IsTrue(rel5 is FileSystemResource); Assert.AreEqual(@"file [c:\index.html]", rel5.Description); - } - + } + [Test] public void RelativeUncResourceWhenNotRelative() { @@ -321,6 +321,6 @@ namespace Spring.Core.IO IResource rel5 = res.CreateRelative(@"..\..\index.html"); Assert.IsTrue(rel5 is FileSystemResource); Assert.AreEqual(@"file [\\server\share\index.html]", rel5.Description); - } + } } } \ No newline at end of file diff --git a/test/Spring/Spring.Core.Tests/Core/IO/ResourceConverterTests.cs b/test/Spring/Spring.Core.Tests/Core/IO/ResourceConverterTests.cs index f35394c7..99e12923 100644 --- a/test/Spring/Spring.Core.Tests/Core/IO/ResourceConverterTests.cs +++ b/test/Spring/Spring.Core.Tests/Core/IO/ResourceConverterTests.cs @@ -43,7 +43,7 @@ namespace Spring.Core.IO public void FixtureSetUp() { // enable (null appender) logging, just to ensure that the logging code is correct - LogManager.Adapter = new NoOpLoggerFactoryAdapter(); + LogManager.Adapter = new NoOpLoggerFactoryAdapter(); } [Test] @@ -80,6 +80,7 @@ namespace Spring.Core.IO } [Test] + [Platform("Win")] public void ConvertFromWithEnvironmentVariableExpansion() { string filename = Guid.NewGuid().ToString(); diff --git a/test/Spring/Spring.Core.Tests/Core/IO/UrlResourceTest.cs b/test/Spring/Spring.Core.Tests/Core/IO/UrlResourceTest.cs index 3325a5a9..9169e83e 100644 --- a/test/Spring/Spring.Core.Tests/Core/IO/UrlResourceTest.cs +++ b/test/Spring/Spring.Core.Tests/Core/IO/UrlResourceTest.cs @@ -52,6 +52,7 @@ namespace Spring.Core.IO } [Test] + [Platform("Win")] public void GetValidFileInfo() { UrlResource urlResource = new UrlResource(FILE_PROTOCOL_PREFIX + "C:/temp"); diff --git a/test/Spring/Spring.Core.Tests/Core/TypeConversion/RegistryKeyConverterTests.cs b/test/Spring/Spring.Core.Tests/Core/TypeConversion/RegistryKeyConverterTests.cs index d07a927a..2fc9f367 100644 --- a/test/Spring/Spring.Core.Tests/Core/TypeConversion/RegistryKeyConverterTests.cs +++ b/test/Spring/Spring.Core.Tests/Core/TypeConversion/RegistryKeyConverterTests.cs @@ -1,14 +1,14 @@ #region License /* - * Copyright © 2002-2011 the original author or authors. - * + * Copyright © 2002-2011 the original author or authors. + * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. * You may obtain a copy of the License at - * + * * http://www.apache.org/licenses/LICENSE-2.0 - * + * * Unless required by applicable law or agreed to in writing, software * distributed under the License is distributed on an "AS IS" BASIS, * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. @@ -32,7 +32,7 @@ namespace Spring.Core.TypeConversion /// Unit tests for the RegistryKeyConverter class. /// /// Aleksandar Seovic - [TestFixture] + [Platform("Win")] public sealed class RegistryKeyConverterTests { [Test] diff --git a/test/Spring/Spring.Core.Tests/Data/Spring/Objects/Factory/Xml/resource.xml b/test/Spring/Spring.Core.Tests/Data/Spring/Objects/Factory/Xml/resource.xml index 2750ff7e..bc9df67d 100644 --- a/test/Spring/Spring.Core.Tests/Data/Spring/Objects/Factory/Xml/resource.xml +++ b/test/Spring/Spring.Core.Tests/Data/Spring/Objects/Factory/Xml/resource.xml @@ -3,18 +3,18 @@ - file:///temp/spring-test.properties + file://./temp/spring-test.properties - file:///temp/spring-test.properties + file://./temp/spring-test.properties - file:///temp/spring-test.properties + file://./temp/spring-test.properties - file:///temp/spring-test.properties + file://./temp/spring-test.properties diff --git a/test/Spring/Spring.Core.Tests/Globalization/Formatters/CurrencyFormatterTests.cs b/test/Spring/Spring.Core.Tests/Globalization/Formatters/CurrencyFormatterTests.cs index 4fe2d1cc..40addaef 100644 --- a/test/Spring/Spring.Core.Tests/Globalization/Formatters/CurrencyFormatterTests.cs +++ b/test/Spring/Spring.Core.Tests/Globalization/Formatters/CurrencyFormatterTests.cs @@ -28,7 +28,6 @@ namespace Spring.Globalization.Formatters /// Unit tests for CurrencyFormatter class. /// /// Aleksandar Seovic - [TestFixture] public class CurrencyFormatterTests { [Test] @@ -54,6 +53,7 @@ namespace Spring.Globalization.Formatters } #if !MONO [Test] + [Platform("Win")] public void FormatUsingDefaults() { CurrencyFormatter fmt = new CurrencyFormatter("en-US"); @@ -108,6 +108,7 @@ namespace Spring.Globalization.Formatters } [Test] + [Platform("Win")] public void ParseUsingDefaults() { CurrencyFormatter fmt = new CurrencyFormatter("en-US"); @@ -160,6 +161,7 @@ namespace Spring.Globalization.Formatters } [Test] + [Platform("Win")] public void FormatUsingCustomSettings() { CurrencyFormatter fmt = new CurrencyFormatter("en-US"); @@ -189,8 +191,6 @@ namespace Spring.Globalization.Formatters Assert.AreEqual("-1.234,56 din", fmt.Format(-1234.56)); } - - fmt = new CurrencyFormatter(CultureInfoUtils.SerbianCyrillicCultureName); fmt.GroupSizes = new int[] { 1, 2 }; fmt.GroupSeparator = "'"; @@ -213,6 +213,7 @@ namespace Spring.Globalization.Formatters } [Test] + [Platform("Win")] public void ParseUsingCustomSettings() { CurrencyFormatter fmt = new CurrencyFormatter("en-US"); diff --git a/test/Spring/Spring.Core.Tests/Globalization/Formatters/DateTimeFormatterTests.cs b/test/Spring/Spring.Core.Tests/Globalization/Formatters/DateTimeFormatterTests.cs index 6851b2b3..71490c72 100644 --- a/test/Spring/Spring.Core.Tests/Globalization/Formatters/DateTimeFormatterTests.cs +++ b/test/Spring/Spring.Core.Tests/Globalization/Formatters/DateTimeFormatterTests.cs @@ -28,7 +28,6 @@ namespace Spring.Globalization.Formatters /// Unit tests for DateTimeFormatter class. /// /// Aleksandar Seovic - [TestFixture] public class DateTimeFormatterTests { [Test] @@ -54,6 +53,7 @@ namespace Spring.Globalization.Formatters } #if !MONO [Test] + [Platform("Win")] public void FormatUsingDefaults() { DateTimeFormatter fmt = new DateTimeFormatter("d", "en-US"); @@ -103,6 +103,7 @@ namespace Spring.Globalization.Formatters } [Test] + [Platform("Win")] public void ParseUsingDefaults() { DateTimeFormatter fmt = new DateTimeFormatter("d", "en-US"); diff --git a/test/Spring/Spring.Core.Tests/Globalization/Formatters/FloatFormatterTests.cs b/test/Spring/Spring.Core.Tests/Globalization/Formatters/FloatFormatterTests.cs index df391f2f..bd43c484 100644 --- a/test/Spring/Spring.Core.Tests/Globalization/Formatters/FloatFormatterTests.cs +++ b/test/Spring/Spring.Core.Tests/Globalization/Formatters/FloatFormatterTests.cs @@ -54,6 +54,7 @@ namespace Spring.Globalization.Formatters } [Test] + [Platform("Win")] public void FormatUsingDefaults() { FloatFormatter fmt = new FloatFormatter(FloatFormatter.DefaultFormat, "en-US"); diff --git a/test/Spring/Spring.Core.Tests/Globalization/Formatters/NumberFormatterTests.cs b/test/Spring/Spring.Core.Tests/Globalization/Formatters/NumberFormatterTests.cs index bd6d30df..679bc3f1 100644 --- a/test/Spring/Spring.Core.Tests/Globalization/Formatters/NumberFormatterTests.cs +++ b/test/Spring/Spring.Core.Tests/Globalization/Formatters/NumberFormatterTests.cs @@ -28,7 +28,6 @@ namespace Spring.Globalization.Formatters /// Unit tests for NumberFormatter class. /// /// Aleksandar Seovic - [TestFixture] public class NumberFormatterTests { [Test] @@ -54,6 +53,7 @@ namespace Spring.Globalization.Formatters } [Test] + [Platform("Win")] public void FormatUsingDefaults() { NumberFormatter fmt = new NumberFormatter("en-US"); @@ -70,6 +70,7 @@ namespace Spring.Globalization.Formatters } [Test] + [Platform("Win")] public void ParseUsingDefaults() { NumberFormatter fmt = new NumberFormatter("en-US"); @@ -86,6 +87,7 @@ namespace Spring.Globalization.Formatters } [Test] + [Platform("Win")] public void FormatUsingCustomSettings() { NumberFormatter fmt = new NumberFormatter("en-US"); diff --git a/test/Spring/Spring.Core.Tests/Globalization/Formatters/PercentFormatterTests.cs b/test/Spring/Spring.Core.Tests/Globalization/Formatters/PercentFormatterTests.cs index e42e4afd..2d661abb 100644 --- a/test/Spring/Spring.Core.Tests/Globalization/Formatters/PercentFormatterTests.cs +++ b/test/Spring/Spring.Core.Tests/Globalization/Formatters/PercentFormatterTests.cs @@ -28,7 +28,6 @@ namespace Spring.Globalization.Formatters /// Unit tests for PercentFormatter class. /// /// Aleksandar Seovic - [TestFixture] public class PercentFormatterTests { [Test] @@ -54,6 +53,7 @@ namespace Spring.Globalization.Formatters } [Test] + [Platform("Win")] public void FormatUsingDefaults() { PercentFormatter fmt = new PercentFormatter("en-US"); diff --git a/test/Spring/Spring.Core.Tests/Objects/Factory/Config/EnvironmentVariableSourceTests.cs b/test/Spring/Spring.Core.Tests/Objects/Factory/Config/EnvironmentVariableSourceTests.cs index 3e4f4dd0..cb7c4f29 100644 --- a/test/Spring/Spring.Core.Tests/Objects/Factory/Config/EnvironmentVariableSourceTests.cs +++ b/test/Spring/Spring.Core.Tests/Objects/Factory/Config/EnvironmentVariableSourceTests.cs @@ -1,7 +1,7 @@ #region License /* - * Copyright © 2002-2011 the original author or authors. + * Copyright © 2002-2011 the original author or authors. * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. @@ -41,8 +41,8 @@ namespace Spring.Objects.Factory.Config EnvironmentVariableSource vs = new EnvironmentVariableSource(); // existing vars - Assert.AreEqual(Environment.GetEnvironmentVariable("path"), vs.ResolveVariable("PATH")); - Assert.AreEqual(Environment.GetEnvironmentVariable("PATH"), vs.ResolveVariable("path")); + Assert.AreEqual(Environment.GetEnvironmentVariable("path"), vs.ResolveVariable("path")); + Assert.AreEqual(Environment.GetEnvironmentVariable("PATH"), vs.ResolveVariable("PATH")); Assert.AreEqual(Environment.GetEnvironmentVariable("ComputerName"), vs.ResolveVariable("computerName")); // non-existant variable diff --git a/test/Spring/Spring.Core.Tests/Objects/Factory/Config/PropertyPlaceholderConfigurerTests.cs b/test/Spring/Spring.Core.Tests/Objects/Factory/Config/PropertyPlaceholderConfigurerTests.cs index a04d09a8..14ebed5e 100644 --- a/test/Spring/Spring.Core.Tests/Objects/Factory/Config/PropertyPlaceholderConfigurerTests.cs +++ b/test/Spring/Spring.Core.Tests/Objects/Factory/Config/PropertyPlaceholderConfigurerTests.cs @@ -47,7 +47,7 @@ namespace Spring.Objects.Factory.Config private static string testConnectionString = @"Provider=Microsoft.Jet.OLEDB.4.0; Data Source=c:\Northwind.mdb;User ID=Admin;Password=;"; private static string testConnectionStringTwo = @"Provider=Microsoft.Jet.OLEDB.4.0; Data Source=c:\Northwind.mdb;User ID=Admin;Password=Ernie;"; #endif - + [SetUp] public void SetUp() { @@ -140,7 +140,7 @@ namespace Spring.Objects.Factory.Config IConfigurableListableObjectFactory mock = A.Fake(); A.CallTo(() => mock.GetObjectDefinitionNames(false)).Returns(new string [] {defName}); A.CallTo(() => mock.GetObjectDefinition(defName, false)).Returns(def); - + PropertyPlaceholderConfigurer cfg = new PropertyPlaceholderConfigurer(); NameValueCollection defaultProperties = new NameValueCollection(); const string expectedName = "Rick Evans"; @@ -159,7 +159,7 @@ namespace Spring.Objects.Factory.Config const string defName = "foo"; const string placeholder = "${name}"; MutablePropertyValues pvs = new MutablePropertyValues(); - + const string theProperty = "name"; pvs.Add(theProperty, placeholder); @@ -188,6 +188,7 @@ namespace Spring.Objects.Factory.Config /// variable is replaced. /// [Test] + [Platform("Win")] public void WithEnvironmentVariableFallback() { StaticApplicationContext ac = new StaticApplicationContext(); @@ -233,6 +234,7 @@ namespace Spring.Objects.Factory.Config /// variable setting to override the explicitly defined name value collection. /// [Test] + [Platform("Win")] public void WithOverridingEnvironmentProperty() { StaticApplicationContext ac = new StaticApplicationContext(); @@ -312,14 +314,14 @@ namespace Spring.Objects.Factory.Config public void SunnyDay() { StaticApplicationContext ac = new StaticApplicationContext(); - + MutablePropertyValues pvs = new MutablePropertyValues(); pvs.Add("age", "${age}"); RootObjectDefinition def = new RootObjectDefinition("${fqn}", new ConstructorArgumentValues(), pvs); ac.RegisterObjectDefinition("tb3", def); - + pvs = new MutablePropertyValues(); @@ -387,7 +389,7 @@ namespace Spring.Objects.Factory.Config Assert.AreEqual(98, inner2.Age); Assert.AreEqual("namemyvar${", inner2.Name); } - + /// /// Makes sure that an appropriate exception is raised when trying /// to resolve this placeholder... ${foo} with this value... foo=ba${foo}r @@ -404,7 +406,7 @@ namespace Spring.Objects.Factory.Config NameValueCollection properties = new NameValueCollection(); const string expectedName = "ba${foo}r"; properties.Add("foo", expectedName); - + IConfigurableListableObjectFactory mock = A.Fake(); A.CallTo(() => mock.GetObjectDefinitionNames(false)).Returns(new string[] {"foo"}); A.CallTo(() => mock.GetObjectDefinition(null, false)).WithAnyArguments().Returns(def); @@ -437,7 +439,7 @@ namespace Spring.Objects.Factory.Config IConfigurableListableObjectFactory mock = A.Fake(); A.CallTo(() => mock.GetObjectDefinitionNames(false)).Returns(new string[] {"foo"}); A.CallTo(() => mock.GetObjectDefinition(null, false)).WithAnyArguments().Returns(def); - + PropertyPlaceholderConfigurer cfg = new PropertyPlaceholderConfigurer(); cfg.Properties = properties; cfg.PostProcessObjectFactory(mock); @@ -602,7 +604,7 @@ namespace Spring.Objects.Factory.Config { IApplicationContext ctx = new XmlApplicationContext( "file://Spring/Objects/Factory/Config/PPCWithTypesTests.xml"); - + object obj = ctx["testObject"]; Assert.IsTrue(obj is TestObject); diff --git a/test/Spring/Spring.Core.Tests/Objects/Factory/Config/RegistryVariableSourceTests.cs b/test/Spring/Spring.Core.Tests/Objects/Factory/Config/RegistryVariableSourceTests.cs index 0008c2cc..08e9a33e 100644 --- a/test/Spring/Spring.Core.Tests/Objects/Factory/Config/RegistryVariableSourceTests.cs +++ b/test/Spring/Spring.Core.Tests/Objects/Factory/Config/RegistryVariableSourceTests.cs @@ -1,7 +1,7 @@ #region License /* - * Copyright © 2002-2011 the original author or authors. + * Copyright © 2002-2011 the original author or authors. * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. @@ -32,7 +32,7 @@ namespace Spring.Objects.Factory.Config /// Unit tests for the RegistryVariableSource class. /// /// Aleksandar Seovic - [TestFixture] + [Platform("Win")] public sealed class RegistryVariableSourceTests { private RegistryKey key; diff --git a/test/Spring/Spring.Core.Tests/Objects/Factory/Config/TypeAliasConfigurerTests.cs b/test/Spring/Spring.Core.Tests/Objects/Factory/Config/TypeAliasConfigurerTests.cs index 408107c3..aad71a22 100644 --- a/test/Spring/Spring.Core.Tests/Objects/Factory/Config/TypeAliasConfigurerTests.cs +++ b/test/Spring/Spring.Core.Tests/Objects/Factory/Config/TypeAliasConfigurerTests.cs @@ -1,7 +1,7 @@ #region License /* - * Copyright © 2002-2011 the original author or authors. + * Copyright © 2002-2011 the original author or authors. * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. @@ -105,7 +105,7 @@ namespace Spring.Objects.Factory.Config [Test] public void WithinApplicationContext() { - IApplicationContext ctx = new XmlApplicationContext("file://Spring/Objects/Factory/Config/typeAliases.xml"); + IApplicationContext ctx = new XmlApplicationContext("file://Spring/Objects/Factory/Config/TypeAliases.xml"); object obj1 = ctx.GetObject("testObject1"); Assert.IsNotNull(obj1); diff --git a/test/Spring/Spring.Core.Tests/Objects/Factory/Xml/XmlObjectFactoryTests.cs b/test/Spring/Spring.Core.Tests/Objects/Factory/Xml/XmlObjectFactoryTests.cs index 340ac1c9..1cdaf6a5 100644 --- a/test/Spring/Spring.Core.Tests/Objects/Factory/Xml/XmlObjectFactoryTests.cs +++ b/test/Spring/Spring.Core.Tests/Objects/Factory/Xml/XmlObjectFactoryTests.cs @@ -703,7 +703,7 @@ namespace Spring.Objects.Factory.Xml [Test] public void DependenciesMaterializeThis() { - IResource resource = new ReadOnlyXmlTestResource("dependenciesMaterializeThis.xml", GetType()); + IResource resource = new ReadOnlyXmlTestResource("dependenciesmaterializethis.xml", GetType()); XmlObjectFactory bf = new XmlObjectFactory(resource); DummyBo bos = (DummyBo) bf.GetObject("boSingleton"); DummyBo bop = (DummyBo) bf.GetObject("boPrototype"); @@ -796,7 +796,7 @@ namespace Spring.Objects.Factory.Xml [Test] public void FactoryReferenceCircle() { - IResource resource = new ReadOnlyXmlTestResource("factoryCircle.xml", GetType()); + IResource resource = new ReadOnlyXmlTestResource("factorycircle.xml", GetType()); XmlObjectFactory xof = new XmlObjectFactory(resource); TestObject tb = (TestObject) xof.GetObject("singletonFactory"); DummyFactory db = (DummyFactory) xof.GetObject("&singletonFactory"); @@ -1062,14 +1062,14 @@ namespace Spring.Objects.Factory.Xml [Test] public void UnsatisfiedObjectDependencyCheck() { - XmlObjectFactory xof = new XmlObjectFactory(new ReadOnlyXmlTestResource("unsatisfiedObjectDependencyCheck.xml", GetType())); + XmlObjectFactory xof = new XmlObjectFactory(new ReadOnlyXmlTestResource("unsatisfiedobjectdependencycheck.xml", GetType())); Assert.Throws(() => xof.GetObject("a", typeof(DependenciesObject))); } [Test] public void UnsatisfiedSimpleDependencyCheck() { - XmlObjectFactory xof = new XmlObjectFactory(new ReadOnlyXmlTestResource("unsatisfiedSimpleDependencyCheck.xml", GetType())); + XmlObjectFactory xof = new XmlObjectFactory(new ReadOnlyXmlTestResource("unsatisfiedsimpledependencycheck.xml", GetType())); Assert.Throws(() => xof.GetObject("a", typeof(DependenciesObject))); } @@ -1078,7 +1078,7 @@ namespace Spring.Objects.Factory.Xml { XmlObjectFactory xof = new XmlObjectFactory( - new ReadOnlyXmlTestResource("satisfiedObjectDependencyCheck.xml", GetType())); + new ReadOnlyXmlTestResource("satisfiedobjectdependencycheck.xml", GetType())); DependenciesObject a = (DependenciesObject) xof.GetObject("a"); Assert.IsNotNull(a.Spouse); } @@ -1089,7 +1089,7 @@ namespace Spring.Objects.Factory.Xml XmlObjectFactory xof = new XmlObjectFactory( new ReadOnlyXmlTestResource( - "satisfiedSimpleDependencyCheck.xml", GetType())); + "satisfiedsimpledependencycheck.xml", GetType())); DependenciesObject a = (DependenciesObject) xof.GetObject("a"); Assert.AreEqual(a.Age, 33); } @@ -1097,7 +1097,7 @@ namespace Spring.Objects.Factory.Xml [Test] public void UnsatisfiedAllDependencyCheck() { - XmlObjectFactory xof= new XmlObjectFactory(new ReadOnlyXmlTestResource("unsatisfiedAllDependencyCheckMissingObjects.xml", GetType())); + XmlObjectFactory xof= new XmlObjectFactory(new ReadOnlyXmlTestResource("unsatisfiedalldependencycheckmissingobjects.xml", GetType())); Assert.Throws(() => xof.GetObject("a", typeof(DependenciesObject))); } @@ -1106,7 +1106,7 @@ namespace Spring.Objects.Factory.Xml { XmlObjectFactory xof = new XmlObjectFactory( - new ReadOnlyXmlTestResource("satisfiedAllDependencyCheck.xml", GetType())); + new ReadOnlyXmlTestResource("satisfiedalldependencycheck.xml", GetType())); DependenciesObject a = (DependenciesObject) xof.GetObject("a"); Assert.AreEqual(a.Age, 33); Assert.IsNotNull(a.Name); @@ -1346,7 +1346,7 @@ namespace Spring.Objects.Factory.Xml try { new XmlObjectFactory( - new ReadOnlyXmlTestResource("classNotFound.xml", GetType())); + new ReadOnlyXmlTestResource("classnotfound.xml", GetType())); } catch (ObjectDefinitionStoreException ex) { @@ -1356,6 +1356,7 @@ namespace Spring.Objects.Factory.Xml #if !NETCOREAPP [Test] + [Platform("Win")] public void AnObjectCanBeIstantiatedWithANotFullySpecifiedAssemblyName() { IResource resource = new ReadOnlyXmlTestResource("notfullyspecified.xml", GetType()); @@ -1368,8 +1369,7 @@ namespace Spring.Objects.Factory.Xml [Test] public void ResourceAndInputStream() { - //string filename = @"C:\temp\spring-test.properties"; - string filename = @"/temp/spring-test.properties"; + string filename = "./temp/spring-test.properties"; FileInfo file = new FileInfo(filename); bool tempDirWasCreated = false; try diff --git a/test/Spring/Spring.Core.Tests/Proxy/AbstractProxyTypeBuilderTests.cs b/test/Spring/Spring.Core.Tests/Proxy/AbstractProxyTypeBuilderTests.cs index f567d831..a6c8e485 100644 --- a/test/Spring/Spring.Core.Tests/Proxy/AbstractProxyTypeBuilderTests.cs +++ b/test/Spring/Spring.Core.Tests/Proxy/AbstractProxyTypeBuilderTests.cs @@ -1,5 +1,5 @@ /* - * Copyright © 2002-2011 the original author or authors. + * Copyright © 2002-2011 the original author or authors. * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. @@ -125,7 +125,7 @@ namespace Spring.Proxy { ConstructorInfo ci = typeof(FakeServiceKnownTypeAttribute).GetConstructor(new Type[] { typeof(Type) }); CustomAttributeBuilder cab = new CustomAttributeBuilder(ci, new object[] { typeof(TestObject) }); - + IProxyTypeBuilder builder = GetProxyBuilder(); builder.TargetType = typeof(ClassWithFakeServiceKnownTypeAttribute); builder.TypeAttributes.Add(cab); @@ -273,6 +273,7 @@ namespace Spring.Proxy #if !MONO && !NETCOREAPP // http://connect.microsoft.com/VisualStudio/feedback/ViewFeedback.aspx?FeedbackID=94803 [Test] + [Platform("Win")] public void ProxySecurityAttribute() { IProxyTypeBuilder builder = GetProxyBuilder(); diff --git a/test/Spring/Spring.Core.Tests/Spring.Core.Tests.csproj b/test/Spring/Spring.Core.Tests/Spring.Core.Tests.csproj index d932c79f..f7b086f4 100644 --- a/test/Spring/Spring.Core.Tests/Spring.Core.Tests.csproj +++ b/test/Spring/Spring.Core.Tests/Spring.Core.Tests.csproj @@ -3,6 +3,7 @@ net5.0;$(TargetFullFrameworkVersion) $(NoWarn);SYSLIB0001;SYSLIB0003;SYSLIB0011 false + true @@ -21,7 +22,7 @@ - + @@ -45,12 +46,16 @@ - + + + + Data\%(RecursiveDir)%(Filename)%(Extension) PreserveNewest - - + + + %(RecursiveDir)%(Filename)%(Extension) PreserveNewest - + @@ -71,9 +76,4 @@ - - - - - \ No newline at end of file diff --git a/test/Spring/Spring.Core.Tests/TestAssemblySetup.cs b/test/Spring/Spring.Core.Tests/TestAssemblySetup.cs index a2d77fb7..bd28e563 100644 --- a/test/Spring/Spring.Core.Tests/TestAssemblySetup.cs +++ b/test/Spring/Spring.Core.Tests/TestAssemblySetup.cs @@ -14,16 +14,19 @@ namespace Spring [OneTimeSetUp] public void SetUp() { - // while R# is broken (https://youtrack.jetbrains.com/issue/RSRP-451142) - string codeBase = Assembly.GetExecutingAssembly().Location; - UriBuilder uri = new UriBuilder(codeBase); - string path = Uri.UnescapeDataString(uri.Path); - var pathToUse = Path.GetDirectoryName(path); - Directory.SetCurrentDirectory(pathToUse); - - CultureInfo enUs = new CultureInfo("en-US"); - Thread.CurrentThread.CurrentCulture = enUs; - Thread.CurrentThread.CurrentUICulture = enUs; + try + { + // while R# is broken (https://youtrack.jetbrains.com/issue/RSRP-451142) + string codeBase = Assembly.GetExecutingAssembly().Location; + UriBuilder uri = new UriBuilder(codeBase); + string path = Uri.UnescapeDataString(uri.Path); + var pathToUse = Path.GetDirectoryName(path); + Directory.SetCurrentDirectory(pathToUse); + } + catch + { + // ignored + } } } } \ No newline at end of file diff --git a/test/Spring/Spring.Core.Tests/Threading/CommonThreadStorageTests.cs b/test/Spring/Spring.Core.Tests/Threading/CommonThreadStorageTests.cs index 02c884a5..0c322b8e 100644 --- a/test/Spring/Spring.Core.Tests/Threading/CommonThreadStorageTests.cs +++ b/test/Spring/Spring.Core.Tests/Threading/CommonThreadStorageTests.cs @@ -1,7 +1,7 @@ #region License /* - * Copyright © 2002-2011 the original author or authors. + * Copyright © 2002-2011 the original author or authors. * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. @@ -36,41 +36,39 @@ namespace Spring.Threading protected abstract IThreadStorage CreateStorage(); protected virtual void ThreadSetup() - {} + { + } protected virtual void ThreadCleanup() - {} + { + } - [OneTimeSetUp] - public void FixtureSetUp() + [SetUp] + public void SetUp() { ThreadSetup(); } - [OneTimeTearDown] - public void FixtureTearDown() + [TearDown] + public void TearDown() { + // cleanup storage + var storage = CreateStorage(); + storage.FreeNamedDataSlot("key"); + storage.FreeNamedDataSlot("KEY"); + storage.FreeNamedDataSlot("KeY"); + ThreadCleanup(); } - [TearDown] - public void TearDown() - { - // cleanup storage - IThreadStorage storage = CreateStorage(); - storage.FreeNamedDataSlot("key"); - storage.FreeNamedDataSlot("KEY"); - storage.FreeNamedDataSlot("KeY"); - } - [Test] public void IsCaseSensitive() { - IThreadStorage storage = CreateStorage(); + var storage = CreateStorage(); - object value1 = new object(); - object value2 = new object(); - object value3 = new object(); + var value1 = new object(); + var value2 = new object(); + var value3 = new object(); storage.SetData("key", value1); storage.SetData("KEY", value2); @@ -84,10 +82,10 @@ namespace Spring.Threading [Test] public void AllowReplaceData() { - IThreadStorage storage = CreateStorage(); + var storage = CreateStorage(); - object value1 = new object(); - object value2 = new object(); + var value1 = new object(); + var value2 = new object(); storage.SetData("key", value1); Assert.AreSame(value1, storage.GetData("key")); @@ -100,7 +98,7 @@ namespace Spring.Threading [Test] public void UnknownKeyReturnsNull() { - IThreadStorage storage = CreateStorage(); + var storage = CreateStorage(); Assert.AreSame(null, storage.GetData("key")); } @@ -108,9 +106,9 @@ namespace Spring.Threading [Test] public void FreeNamedDataSlotRemovesData() { - IThreadStorage storage = CreateStorage(); + var storage = CreateStorage(); - object value1 = new object(); + var value1 = new object(); storage.SetData("key", value1); Assert.AreSame(value1, storage.GetData("key")); storage.FreeNamedDataSlot("key"); @@ -120,15 +118,15 @@ namespace Spring.Threading [Test] public void UsesDistinguishedStorageOnDifferentThreads() { - IThreadStorage storage = CreateStorage(); + var storage = CreateStorage(); - object value1 = new object(); + var value1 = new object(); storage.SetData("key", value1); - ThreadTestHelper helper = new ThreadTestHelper(this,storage); + var helper = new ThreadTestHelper(this, storage); helper.Execute(); - Assert.AreNotSame( value1, helper.value ); + Assert.AreNotSame(value1, helper.value); Assert.IsNull(helper.value); } @@ -149,7 +147,7 @@ namespace Spring.Threading public void Execute() { - Thread t = new Thread(new ThreadStart(this.Run)); + var t = new Thread(new ThreadStart(Run)); t.Start(); t.Join(); } @@ -157,7 +155,7 @@ namespace Spring.Threading private void Run() { outer.ThreadSetup(); - value = this.storage.GetData("key"); + value = storage.GetData("key"); } } diff --git a/test/Spring/Spring.Data.NHibernate5.Tests/Data/NHibernate/Config/AopConfiguration.cs b/test/Spring/Spring.Data.NHibernate5.Tests/Data/NHibernate/Config/AopConfiguration.cs index 259f9763..cfcd552f 100644 --- a/test/Spring/Spring.Data.NHibernate5.Tests/Data/NHibernate/Config/AopConfiguration.cs +++ b/test/Spring/Spring.Data.NHibernate5.Tests/Data/NHibernate/Config/AopConfiguration.cs @@ -1,7 +1,7 @@ #region License /* - * Copyright © 2002-2011 the original author or authors. + * Copyright © 2002-2011 the original author or authors. * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. @@ -50,6 +50,7 @@ namespace Spring.Data.NHibernate.Config } [Test] + [Ignore("TODO Connects to database")] public void ProxyDataAccessAndServiceLayer() { Assert.IsFalse(AopUtils.IsAopProxy( ctx["DbProvider"] )); diff --git a/test/Spring/Spring.Messaging.Ems.Integration.Tests/Spring.Messaging.Ems.Integration.Tests.csproj b/test/Spring/Spring.Messaging.Ems.Integration.Tests/Spring.Messaging.Ems.Integration.Tests.csproj index 6740fe1f..57926186 100644 --- a/test/Spring/Spring.Messaging.Ems.Integration.Tests/Spring.Messaging.Ems.Integration.Tests.csproj +++ b/test/Spring/Spring.Messaging.Ems.Integration.Tests/Spring.Messaging.Ems.Integration.Tests.csproj @@ -26,9 +26,6 @@ - - GenCommonAssemblyInfo.cs - diff --git a/test/Spring/Spring.Messaging.Nms.Tests/Spring.Messaging.Nms.Tests.csproj b/test/Spring/Spring.Messaging.Nms.Tests/Spring.Messaging.Nms.Tests.csproj index f46568f0..f6fd03e6 100644 --- a/test/Spring/Spring.Messaging.Nms.Tests/Spring.Messaging.Nms.Tests.csproj +++ b/test/Spring/Spring.Messaging.Nms.Tests/Spring.Messaging.Nms.Tests.csproj @@ -19,13 +19,11 @@ - + + testhost.dll.config PreserveNewest - + - - - \ No newline at end of file diff --git a/test/Spring/Spring.Scheduling.Quartz3.Tests/Scheduling/Quartz/QuartzSupportTests.cs b/test/Spring/Spring.Scheduling.Quartz3.Tests/Scheduling/Quartz/QuartzSupportTests.cs index 9f6c4228..980c7ac0 100644 --- a/test/Spring/Spring.Scheduling.Quartz3.Tests/Scheduling/Quartz/QuartzSupportTests.cs +++ b/test/Spring/Spring.Scheduling.Quartz3.Tests/Scheduling/Quartz/QuartzSupportTests.cs @@ -569,7 +569,7 @@ namespace Spring.Scheduling.Quartz factoryObject.AfterPropertiesSet(); await factoryObject.Start(); - Thread.Sleep(500); + await Task.Delay(TimeSpan.FromSeconds(1)); Assert.IsTrue(DummyJob.count > 0); Assert.AreEqual(DummyJob.count, taskExecutor.count); @@ -601,7 +601,7 @@ namespace Spring.Scheduling.Quartz factoryObject.AfterPropertiesSet(); await factoryObject.Start(); - DummyRunnable.runEvent.WaitOne(500); + DummyRunnable.runEvent.WaitOne(1000); Assert.IsTrue(DummyRunnable.count > 0); factoryObject.Dispose(); @@ -742,7 +742,7 @@ namespace Spring.Scheduling.Quartz factoryObject.AfterPropertiesSet(); await factoryObject.Start(); - Thread.Sleep(500); + await Task.Delay(TimeSpan.FromSeconds(1)); Assert.AreEqual(10, DummyRunnable.param); Assert.IsTrue(DummyRunnable.count > 0); @@ -777,7 +777,7 @@ namespace Spring.Scheduling.Quartz factoryObject.AfterPropertiesSet(); await factoryObject.Start(); - Thread.Sleep(500); + await Task.Delay(TimeSpan.FromSeconds(1)); Assert.AreEqual(10, DummyJobObject.param); Assert.IsTrue(DummyJobObject.count > 0); @@ -800,7 +800,7 @@ namespace Spring.Scheduling.Quartz factoryObject.AfterPropertiesSet(); await factoryObject.Start(); - Thread.Sleep(500); + await Task.Delay(TimeSpan.FromSeconds(1)); Assert.AreEqual(10, DummyJob.param); Assert.IsTrue(DummyJob.count > 0); diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/Conversation/HttpWebclientExtensions.cs b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/Conversation/HttpWebclientExtensions.cs new file mode 100644 index 00000000..3434c14d --- /dev/null +++ b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/Conversation/HttpWebclientExtensions.cs @@ -0,0 +1,35 @@ +#region License +// /* +// * Copyright 2018 the original author or authors. +// * +// * Licensed under the Apache License, Version 2.0 (the "License"); +// * you may not use this file except in compliance with the License. +// * You may obtain a copy of the License at +// * +// * http://www.apache.org/licenses/LICENSE-2.0 +// * +// * Unless required by applicable law or agreed to in writing, software +// * distributed under the License is distributed on an "AS IS" BASIS, +// * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// * See the License for the specific language governing permissions and +// * limitations under the License. +// */ +#endregion + +using NUnitAspEx; +using NUnitAspEx.Client; + +namespace Spring.Web.Conversation +{ + public static class HttpWebclientExtensions + { + + public static HttpWebClient CreateClientWithDefaultPort(this IAspFixtureHost host) + { + HttpWebClient clnt = host.CreateWebClient(); + // fix port which otherwise defaults to -1 breaking everything + clnt.BaseAddress = clnt.BaseAddress.Replace("aspfixturehost/", "aspfixturehost:80/"); + return clnt; + } + } +} \ No newline at end of file diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/Conversation/WebConversationStateTest.cs b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/Conversation/WebConversationStateTest.cs index ae40cd80..cb8c2c87 100644 Binary files a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/Conversation/WebConversationStateTest.cs and b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/Conversation/WebConversationStateTest.cs differ diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/Data/Spring/Conversation/WebConversationStateTest/Web.Config b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/Data/Spring/Conversation/WebConversationStateTest/Web.Config index 0dd6ded3..dbca6374 100644 --- a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/Data/Spring/Conversation/WebConversationStateTest/Web.Config +++ b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/Data/Spring/Conversation/WebConversationStateTest/Web.Config @@ -92,7 +92,7 @@ - + diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/Spring.Web.Conversation.NHibernate5.Tests.csproj b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/Spring.Web.Conversation.NHibernate5.Tests.csproj index 8146181d..a0672083 100644 --- a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/Spring.Web.Conversation.NHibernate5.Tests.csproj +++ b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/Spring.Web.Conversation.NHibernate5.Tests.csproj @@ -1,7 +1,8 @@  net461 - Debug;Release + true + x86 @@ -15,16 +16,13 @@ + ..\..\..\lib\Net\2.0\NUnitAspEx.dll False - - ..\Spring.Web.Conversation.NHibernate5.Tests\lib\net\2.0\System.Data.SQLite.dll - False - @@ -61,4 +59,5 @@ + \ No newline at end of file diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/TestAssemblySetup.cs b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/TestAssemblySetup.cs new file mode 100644 index 00000000..3850fd2b --- /dev/null +++ b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/TestAssemblySetup.cs @@ -0,0 +1,22 @@ +using System; +using System.IO; +using NUnit.Framework; + +namespace Spring +{ + [SetUpFixture] + public class TestAssemblySetup + { + [OneTimeSetUp] + public void SetUp() + { + // work around getting interop assembly to correct directory + var requiredFile = Path.Combine(Environment.CurrentDirectory, "SQLite.Interop.dll"); + var fileToUse = Path.Combine(Environment.CurrentDirectory, "x86", "SQLite.Interop.dll"); + if (!File.Exists(requiredFile) && File.Exists(fileToUse)) + { + File.Copy(fileToUse, requiredFile); + } + } + } +} \ No newline at end of file diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/app.config b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/app.config index cc10890d..f57ca185 100644 --- a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/app.config +++ b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/app.config @@ -8,12 +8,4 @@ - - - - - - - - diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/Mono/2.0/System.Data.SQLite.dll b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/Mono/2.0/System.Data.SQLite.dll deleted file mode 100644 index 698d501d..00000000 Binary files a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/Mono/2.0/System.Data.SQLite.dll and /dev/null differ diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/2.0/System.Data.SQLite.dll b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/2.0/System.Data.SQLite.dll deleted file mode 100644 index 2414373e..00000000 Binary files a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/2.0/System.Data.SQLite.dll and /dev/null differ diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/2.0/System.Data.SQLite.xml b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/2.0/System.Data.SQLite.xml deleted file mode 100644 index 6df7eb75..00000000 --- a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/2.0/System.Data.SQLite.xml +++ /dev/null @@ -1,13100 +0,0 @@ - - - - System.Data.SQLite - - - - - Defines a source code identifier custom attribute for an assembly - manifest. - - - - - Constructs an instance of this attribute class using the specified - source code identifier value. - - - The source code identifier value to use. - - - - - Gets the source code identifier value. - - - - - Defines a source code time-stamp custom attribute for an assembly - manifest. - - - - - Constructs an instance of this attribute class using the specified - source code time-stamp value. - - - The source code time-stamp value to use. - - - - - Gets the source code time-stamp value. - - - - - This is the method signature for the SQLite core library logging callback - function for use with sqlite3_log() and the SQLITE_CONFIG_LOG. - - WARNING: This delegate is used more-or-less directly by native code, do - not modify its type signature. - - - The extra data associated with this message, if any. - - - The error code associated with this message. - - - The message string to be logged. - - - - - This class implements SQLiteBase completely, and is the guts of the code that interop's SQLite with .NET - - - - - This internal class provides the foundation of SQLite support. It defines all the abstract members needed to implement - a SQLite data provider, and inherits from SQLiteConvert which allows for simple translations of string to and from SQLite. - - - - - This base class provides datatype conversion services for the SQLite provider. - - - - - The format string for DateTime values when using the InvariantCulture or CurrentCulture formats. - - - - - The value for the Unix epoch (e.g. January 1, 1970 at midnight, in UTC). - - - - - The value of the OLE Automation epoch represented as a Julian day. - - - - - An array of ISO-8601 DateTime formats that we support parsing. - - - - - The internal default format for UTC DateTime values when converting - to a string. - - - - - The internal default format for local DateTime values when converting - to a string. - - - - - An UTF-8 Encoding instance, so we can convert strings to and from UTF-8 - - - - - The default DateTime format for this instance. - - - - - The default DateTimeKind for this instance. - - - - - The default DateTime format string for this instance. - - - - - Initializes the conversion class - - The default date/time format to use for this instance - The DateTimeKind to use. - The DateTime format string to use. - - - - Converts a string to a UTF-8 encoded byte array sized to include a null-terminating character. - - The string to convert to UTF-8 - A byte array containing the converted string plus an extra 0 terminating byte at the end of the array. - - - - Convert a DateTime to a UTF-8 encoded, zero-terminated byte array. - - - This function is a convenience function, which first calls ToString() on the DateTime, and then calls ToUTF8() with the - string result. - - The DateTime to convert. - The UTF-8 encoded string, including a 0 terminating byte at the end of the array. - - - - Converts a UTF-8 encoded IntPtr of the specified length into a .NET string - - The pointer to the memory where the UTF-8 string is encoded - The number of bytes to decode - A string containing the translated character(s) - - - - Converts a UTF-8 encoded IntPtr of the specified length into a .NET string - - The pointer to the memory where the UTF-8 string is encoded - The number of bytes to decode - A string containing the translated character(s) - - - - Converts a string into a DateTime, using the DateTimeFormat, DateTimeKind, - and DateTimeFormatString specified for the connection when it was opened. - - - Acceptable ISO8601 DateTime formats are: - - THHmmssK - THHmmK - HH:mm:ss.FFFFFFFK - HH:mm:ssK - HH:mmK - yyyy-MM-dd HH:mm:ss.FFFFFFFK - yyyy-MM-dd HH:mm:ssK - yyyy-MM-dd HH:mmK - yyyy-MM-ddTHH:mm:ss.FFFFFFFK - yyyy-MM-ddTHH:mmK - yyyy-MM-ddTHH:mm:ssK - yyyyMMddHHmmssK - yyyyMMddHHmmK - yyyyMMddTHHmmssFFFFFFFK - THHmmss - THHmm - HH:mm:ss.FFFFFFF - HH:mm:ss - HH:mm - yyyy-MM-dd HH:mm:ss.FFFFFFF - yyyy-MM-dd HH:mm:ss - yyyy-MM-dd HH:mm - yyyy-MM-ddTHH:mm:ss.FFFFFFF - yyyy-MM-ddTHH:mm - yyyy-MM-ddTHH:mm:ss - yyyyMMddHHmmss - yyyyMMddHHmm - yyyyMMddTHHmmssFFFFFFF - yyyy-MM-dd - yyyyMMdd - yy-MM-dd - - If the string cannot be matched to one of the above formats -OR- - the DateTimeFormatString if one was provided, an exception will - be thrown. - - The string containing either a long integer number of 100-nanosecond units since - System.DateTime.MinValue, a Julian day double, an integer number of seconds since the Unix epoch, a - culture-independent formatted date and time string, a formatted date and time string in the current - culture, or an ISO8601-format string. - A DateTime value - - - - Converts a string into a DateTime, using the specified DateTimeFormat, - DateTimeKind and DateTimeFormatString. - - - Acceptable ISO8601 DateTime formats are: - - THHmmssK - THHmmK - HH:mm:ss.FFFFFFFK - HH:mm:ssK - HH:mmK - yyyy-MM-dd HH:mm:ss.FFFFFFFK - yyyy-MM-dd HH:mm:ssK - yyyy-MM-dd HH:mmK - yyyy-MM-ddTHH:mm:ss.FFFFFFFK - yyyy-MM-ddTHH:mmK - yyyy-MM-ddTHH:mm:ssK - yyyyMMddHHmmssK - yyyyMMddHHmmK - yyyyMMddTHHmmssFFFFFFFK - THHmmss - THHmm - HH:mm:ss.FFFFFFF - HH:mm:ss - HH:mm - yyyy-MM-dd HH:mm:ss.FFFFFFF - yyyy-MM-dd HH:mm:ss - yyyy-MM-dd HH:mm - yyyy-MM-ddTHH:mm:ss.FFFFFFF - yyyy-MM-ddTHH:mm - yyyy-MM-ddTHH:mm:ss - yyyyMMddHHmmss - yyyyMMddHHmm - yyyyMMddTHHmmssFFFFFFF - yyyy-MM-dd - yyyyMMdd - yy-MM-dd - - If the string cannot be matched to one of the above formats -OR- - the DateTimeFormatString if one was provided, an exception will - be thrown. - - The string containing either a long integer number of 100-nanosecond units since - System.DateTime.MinValue, a Julian day double, an integer number of seconds since the Unix epoch, a - culture-independent formatted date and time string, a formatted date and time string in the current - culture, or an ISO8601-format string. - The SQLiteDateFormats to use. - The DateTimeKind to use. - The DateTime format string to use. - A DateTime value - - - - Converts a julianday value into a DateTime - - The value to convert - A .NET DateTime - - - - Converts a julianday value into a DateTime - - The value to convert - The DateTimeKind to use. - A .NET DateTime - - - - Converts the specified number of seconds from the Unix epoch into a - value. - - - The number of whole seconds since the Unix epoch. - - - Either Utc or Local time. - - - The new value. - - - - - Converts the specified number of ticks since the epoch into a - value. - - - The number of whole ticks since the epoch. - - - Either Utc or Local time. - - - The new value. - - - - - Converts a DateTime struct to a JulianDay double - - The DateTime to convert - The JulianDay value the Datetime represents - - - - Converts a DateTime struct to the whole number of seconds since the - Unix epoch. - - The DateTime to convert - The whole number of seconds since the Unix epoch - - - - Returns the DateTime format string to use for the specified DateTimeKind. - If is not null, it will be returned verbatim. - - The DateTimeKind to use. - The DateTime format string to use. - - The DateTime format string to use for the specified DateTimeKind. - - - - - Converts a string into a DateTime, using the DateTimeFormat, DateTimeKind, - and DateTimeFormatString specified for the connection when it was opened. - - The DateTime value to convert - Either a string containing the long integer number of 100-nanosecond units since System.DateTime.MinValue, a - Julian day double, an integer number of seconds since the Unix epoch, a culture-independent formatted date and time - string, a formatted date and time string in the current culture, or an ISO8601-format date/time string. - - - - Internal function to convert a UTF-8 encoded IntPtr of the specified length to a DateTime. - - - This is a convenience function, which first calls ToString() on the IntPtr to convert it to a string, then calls - ToDateTime() on the string to return a DateTime. - - A pointer to the UTF-8 encoded string - The length in bytes of the string - The parsed DateTime value - - - - Smart method of splitting a string. Skips quoted elements, removes the quotes. - - - This split function works somewhat like the String.Split() function in that it breaks apart a string into - pieces and returns the pieces as an array. The primary differences are: - - Only one character can be provided as a separator character - Quoted text inside the string is skipped over when searching for the separator, and the quotes are removed. - - Thus, if splitting the following string looking for a comma:
- One,Two, "Three, Four", Five
-
- The resulting array would contain
- [0] One
- [1] Two
- [2] Three, Four
- [3] Five
-
- Note that the leading and trailing spaces were removed from each item during the split. -
- Source string to split apart - Separator character - A string array of the split up elements -
- - - Splits the specified string into multiple strings based on a separator - and returns the result as an array of strings. - - - The string to split into pieces based on the separator character. If - this string is null, null will always be returned. If this string is - empty, an array of zero strings will always be returned. - - - The character used to divide the original string into sub-strings. - This character cannot be a backslash or a double-quote; otherwise, no - work will be performed and null will be returned. - - - If this parameter is non-zero, all double-quote characters will be - retained in the returned list of strings; otherwise, they will be - dropped. - - - Upon failure, this parameter will be modified to contain an appropriate - error message. - - - The new array of strings or null if the input string is null -OR- the - separator character is a backslash or a double-quote -OR- the string - contains an unbalanced backslash or double-quote character. - - - - - Queries and returns the string representation for an object, using the - specified (or current) format provider. - - - The object instance to return the string representation for. - - - The format provider to use -OR- null if the current format provider for - the thread should be used instead. - - - The string representation for the object instance -OR- null if the - object instance is also null. - - - - - Convert a value to true or false. - - A string or number representing true or false - - - - - Convert a string to true or false. - - A string representing true or false - - - "yes", "no", "y", "n", "0", "1", "on", "off" as well as Boolean.FalseString and Boolean.TrueString will all be - converted to a proper boolean value. - - - - - Converts a SQLiteType to a .NET Type object - - The SQLiteType to convert - Returns a .NET Type object - - - - For a given intrinsic type, return a DbType - - The native type to convert - The corresponding (closest match) DbType - - - - Returns the ColumnSize for the given DbType - - The DbType to get the size of - - - - - Determines the type name for the given database value type. - - The connection context for custom type mappings, if any. - The database value type. - The flags associated with the parent connection object. - The type name or an empty string if it cannot be determined. - - - - Convert a DbType to a Type - - The DbType to convert from - The closest-match .NET type - - - - For a given type, return the closest-match SQLite TypeAffinity, which only understands a very limited subset of types. - - The type to evaluate - The SQLite type affinity for that type. - - - - Builds and returns a map containing the database column types - recognized by this provider. - - - A map containing the database column types recognized by this - provider. - - - - - For a given type name, return a closest-match .NET type - - The connection context for custom type mappings, if any. - The name of the type to match - The flags associated with the parent connection object. - The .NET DBType the text evaluates to. - - - - The error code used for logging exceptions caught in user-provided - code. - - - - - Sets the status of the memory usage tracking subsystem in the SQLite core library. By default, this is enabled. - If this is disabled, memory usage tracking will not be performed. This is not really a per-connection value, it is - global to the process. - - Non-zero to enable memory usage tracking, zero otherwise. - A standard SQLite return code (i.e. zero for success and non-zero for failure). - - - - Attempts to free as much heap memory as possible for the database connection. - - A standard SQLite return code (i.e. zero for success and non-zero for failure). - - - - Shutdown the SQLite engine so that it can be restarted with different config options. - We depend on auto initialization to recover. - - - - - Determines if the associated native connection handle is open. - - - Non-zero if a database connection is open. - - - - - Opens a database. - - - Implementers should call SQLiteFunction.BindFunctions() and save the array after opening a connection - to bind all attributed user-defined functions and collating sequences to the new connection. - - The filename of the database to open. SQLite automatically creates it if it doesn't exist. - The flags associated with the parent connection object - The open flags to use when creating the connection - The maximum size of the pool for the given filename - If true, the connection can be pulled from the connection pool - - - - Closes the currently-open database. - - - After the database has been closed implemeters should call SQLiteFunction.UnbindFunctions() to deallocate all interop allocated - memory associated with the user-defined functions and collating sequences tied to the closed connection. - - Non-zero if the operation is allowed to throw exceptions, zero otherwise. - - - - Sets the busy timeout on the connection. SQLiteCommand will call this before executing any command. - - The number of milliseconds to wait before returning SQLITE_BUSY - - - - Returns the text of the last error issued by SQLite - - - - - - Returns the text of the last error issued by SQLite -OR- the specified default error text if - none is available from the SQLite core library. - - - The error text to return in the event that one is not available from the SQLite core library. - - - The error text. - - - - - When pooling is enabled, force this connection to be disposed rather than returned to the pool - - - - - When pooling is enabled, returns the number of pool entries matching the current file name. - - The number of pool entries matching the current file name. - - - - Prepares a SQL statement for execution. - - The source connection preparing the command. Can be null for any caller except LINQ - The SQL command text to prepare - The previous statement in a multi-statement command, or null if no previous statement exists - The timeout to wait before aborting the prepare - The remainder of the statement that was not processed. Each call to prepare parses the - SQL up to to either the end of the text or to the first semi-colon delimiter. The remaining text is returned - here for a subsequent call to Prepare() until all the text has been processed. - Returns an initialized SQLiteStatement. - - - - Steps through a prepared statement. - - The SQLiteStatement to step through - True if a row was returned, False if not. - - - - Resets a prepared statement so it can be executed again. If the error returned is SQLITE_SCHEMA, - transparently attempt to rebuild the SQL statement and throw an error if that was not possible. - - The statement to reset - Returns -1 if the schema changed while resetting, 0 if the reset was sucessful or 6 (SQLITE_LOCKED) if the reset failed due to a lock - - - - Attempts to interrupt the query currently executing on the associated - native database connection. - - - - - This function binds a user-defined functions to the connection. - - - The object instance containing - the metadata for the function to be bound. - - - The object instance that implements the - function to be bound. - - - The flags associated with the parent connection object. - - - - - Calls the native SQLite core library in order to create a disposable - module containing the implementation of a virtual table. - - - The module object to be used when creating the native disposable module. - - - The flags for the associated object instance. - - - - - Calls the native SQLite core library in order to cleanup the resources - associated with a module containing the implementation of a virtual table. - - - The module object previously passed to the - method. - - - The flags for the associated object instance. - - - - - Calls the native SQLite core library in order to declare a virtual table - in response to a call into the - or virtual table methods. - - - The virtual table module that is to be responsible for the virtual table - being declared. - - - The string containing the SQL statement describing the virtual table to - be declared. - - - Upon success, the contents of this parameter are undefined. Upon failure, - it should contain an appropriate error message. - - - A standard SQLite return code. - - - - - Calls the native SQLite core library in order to declare a virtual table - function in response to a call into the - or virtual table methods. - - - The virtual table module that is to be responsible for the virtual table - function being declared. - - - The number of arguments to the function being declared. - - - The name of the function being declared. - - - Upon success, the contents of this parameter are undefined. Upon failure, - it should contain an appropriate error message. - - - A standard SQLite return code. - - - - - Enables or disabled extension loading by SQLite. - - - True to enable loading of extensions, false to disable. - - - - - Loads a SQLite extension library from the named file. - - - The name of the dynamic link library file containing the extension. - - - The name of the exported function used to initialize the extension. - If null, the default "sqlite3_extension_init" will be used. - - - - - Enables or disabled extened result codes returned by SQLite - - true to enable extended result codes, false to disable. - - - - - Returns the numeric result code for the most recent failed SQLite API call - associated with the database connection. - - Result code - - - - Returns the extended numeric result code for the most recent failed SQLite API call - associated with the database connection. - - Extended result code - - - - Add a log message via the SQLite sqlite3_log interface. - - Error code to be logged with the message. - String to be logged. Unlike the SQLite sqlite3_log() - interface, this should be pre-formatted. Consider using the - String.Format() function. - - - - - Checks if the SQLite core library has been initialized in the current process. - - - Non-zero if the SQLite core library has been initialized in the current process, - zero otherwise. - - - - - Creates a new SQLite backup object based on the provided destination - database connection. The source database connection is the one - associated with this object. The source and destination database - connections cannot be the same. - - The destination database connection. - The destination database name. - The source database name. - The newly created backup object. - - - - Copies up to N pages from the source database to the destination - database associated with the specified backup object. - - The backup object to use. - - The number of pages to copy or negative to copy all remaining pages. - - - Set to true if the operation needs to be retried due to database - locking issues. - - - True if there are more pages to be copied, false otherwise. - - - - - Returns the number of pages remaining to be copied from the source - database to the destination database associated with the specified - backup object. - - The backup object to check. - The number of pages remaining to be copied. - - - - Returns the total number of pages in the source database associated - with the specified backup object. - - The backup object to check. - The total number of pages in the source database. - - - - Destroys the backup object, rolling back any backup that may be in - progess. - - The backup object to destroy. - - - - Returns the error message for the specified SQLite return code using - the internal static lookup table. - - The SQLite return code. - The error message or null if it cannot be found. - - - - Returns the error message for the specified SQLite return code using - the sqlite3_errstr() function, falling back to the internal lookup - table if necessary. - - The SQLite return code. - The error message or null if it cannot be found. - - - - Returns a string representing the active version of SQLite - - - - - Returns an integer representing the active version of SQLite - - - - - Returns the rowid of the most recent successful INSERT into the database from this connection. - - - - - Returns the number of changes the last executing insert/update caused. - - - - - Returns the amount of memory (in bytes) currently in use by the SQLite core library. This is not really a per-connection - value, it is global to the process. - - - - - Returns the maximum amount of memory (in bytes) used by the SQLite core library since the high-water mark was last reset. - This is not really a per-connection value, it is global to the process. - - - - - Returns non-zero if the underlying native connection handle is owned by this instance. - - - - - Returns non-zero if the given database connection is in autocommit mode. - Autocommit mode is on by default. Autocommit mode is disabled by a BEGIN - statement. Autocommit mode is re-enabled by a COMMIT or ROLLBACK. - - - - - The opaque pointer returned to us by the sqlite provider - - - - - The user-defined functions registered on this connection - - - - - The modules created using this connection. - - - - - Constructs the object used to interact with the SQLite core library - using the UTF-8 text encoding. - - - The DateTime format to be used when converting string values to a - DateTime and binding DateTime parameters. - - - The to be used when creating DateTime - values. - - - The format string to be used when parsing and formatting DateTime - values. - - - The native handle to be associated with the database connection. - - - The fully qualified file name associated with . - - - Non-zero if the newly created object instance will need to dispose - of when it is no longer needed. - - - - - This method attempts to dispose of all the derived - object instances currently associated with the native database connection. - - - - - Attempts to interrupt the query currently executing on the associated - native database connection. - - - - - This function binds a user-defined function to the connection. - - - The object instance containing - the metadata for the function to be bound. - - - The object instance that implements the - function to be bound. - - - The flags associated with the parent connection object. - - - - - Attempts to free as much heap memory as possible for the database connection. - - A standard SQLite return code (i.e. zero for success and non-zero for failure). - - - - Attempts to free N bytes of heap memory by deallocating non-essential memory - allocations held by the database library. Memory used to cache database pages - to improve performance is an example of non-essential memory. This is a no-op - returning zero if the SQLite core library was not compiled with the compile-time - option SQLITE_ENABLE_MEMORY_MANAGEMENT. Optionally, attempts to reset and/or - compact the Win32 native heap, if applicable. - - - The requested number of bytes to free. - - - Non-zero to attempt a heap reset. - - - Non-zero to attempt heap compaction. - - - The number of bytes actually freed. This value may be zero. - - - This value will be non-zero if the heap reset was successful. - - - The size of the largest committed free block in the heap, in bytes. - This value will be zero unless heap compaction is enabled. - - - A standard SQLite return code (i.e. zero for success and non-zero - for failure). - - - - - Shutdown the SQLite engine so that it can be restarted with different - configuration options. We depend on auto initialization to recover. - - Returns a standard SQLite result code. - - - - Shutdown the SQLite engine so that it can be restarted with different - configuration options. We depend on auto initialization to recover. - - - Non-zero to reset the database and temporary directories to their - default values, which should be null for both. This parameter has no - effect on non-Windows operating systems. - - Returns a standard SQLite result code. - - - - Determines if the associated native connection handle is open. - - - Non-zero if the associated native connection handle is open. - - - - - Calls the native SQLite core library in order to create a disposable - module containing the implementation of a virtual table. - - - The module object to be used when creating the native disposable module. - - - The flags for the associated object instance. - - - - - Calls the native SQLite core library in order to cleanup the resources - associated with a module containing the implementation of a virtual table. - - - The module object previously passed to the - method. - - - The flags for the associated object instance. - - - - - Calls the native SQLite core library in order to declare a virtual table - in response to a call into the - or virtual table methods. - - - The virtual table module that is to be responsible for the virtual table - being declared. - - - The string containing the SQL statement describing the virtual table to - be declared. - - - Upon success, the contents of this parameter are undefined. Upon failure, - it should contain an appropriate error message. - - - A standard SQLite return code. - - - - - Calls the native SQLite core library in order to declare a virtual table - function in response to a call into the - or virtual table methods. - - - The virtual table module that is to be responsible for the virtual table - function being declared. - - - The number of arguments to the function being declared. - - - The name of the function being declared. - - - Upon success, the contents of this parameter are undefined. Upon failure, - it should contain an appropriate error message. - - - A standard SQLite return code. - - - - - Enables or disabled extension loading by SQLite. - - - True to enable loading of extensions, false to disable. - - - - - Loads a SQLite extension library from the named file. - - - The name of the dynamic link library file containing the extension. - - - The name of the exported function used to initialize the extension. - If null, the default "sqlite3_extension_init" will be used. - - - - Enables or disabled extended result codes returned by SQLite - - - Gets the last SQLite error code - - - Gets the last SQLite extended error code - - - Add a log message via the SQLite sqlite3_log interface. - - - Add a log message via the SQLite sqlite3_log interface. - - - - Allows the setting of a logging callback invoked by SQLite when a - log event occurs. Only one callback may be set. If NULL is passed, - the logging callback is unregistered. - - The callback function to invoke. - Returns a result code - - - - Creates a new SQLite backup object based on the provided destination - database connection. The source database connection is the one - associated with this object. The source and destination database - connections cannot be the same. - - The destination database connection. - The destination database name. - The source database name. - The newly created backup object. - - - - Copies up to N pages from the source database to the destination - database associated with the specified backup object. - - The backup object to use. - - The number of pages to copy, negative to copy all remaining pages. - - - Set to true if the operation needs to be retried due to database - locking issues; otherwise, set to false. - - - True if there are more pages to be copied, false otherwise. - - - - - Returns the number of pages remaining to be copied from the source - database to the destination database associated with the specified - backup object. - - The backup object to check. - The number of pages remaining to be copied. - - - - Returns the total number of pages in the source database associated - with the specified backup object. - - The backup object to check. - The total number of pages in the source database. - - - - Destroys the backup object, rolling back any backup that may be in - progess. - - The backup object to destroy. - - - - Determines if the SQLite core library has been initialized for the - current process. - - - A boolean indicating whether or not the SQLite core library has been - initialized for the current process. - - - - - Determines if the SQLite core library has been initialized for the - current process. - - - A boolean indicating whether or not the SQLite core library has been - initialized for the current process. - - - - - Helper function to retrieve a column of data from an active statement. - - The statement being step()'d through - The flags associated with the connection. - The column index to retrieve - The type of data contained in the column. If Uninitialized, this function will retrieve the datatype information. - Returns the data in the column - - - - Returns non-zero if the underlying native connection handle is owned - by this instance. - - - - - Alternate SQLite3 object, overriding many text behaviors to support UTF-16 (Unicode) - - - - - Constructs the object used to interact with the SQLite core library - using the UTF-8 text encoding. - - - The DateTime format to be used when converting string values to a - DateTime and binding DateTime parameters. - - - The to be used when creating DateTime - values. - - - The format string to be used when parsing and formatting DateTime - values. - - - The native handle to be associated with the database connection. - - - The fully qualified file name associated with . - - - Non-zero if the newly created object instance will need to dispose - of when it is no longer needed. - - - - - Overrides SQLiteConvert.ToString() to marshal UTF-16 strings instead of UTF-8 - - A pointer to a UTF-16 string - The length (IN BYTES) of the string - A .NET string - - - - Represents a single SQL backup in SQLite. - - - - - The underlying SQLite object this backup is bound to. - - - - - The actual backup handle. - - - - - The destination database for the backup. - - - - - The destination database name for the backup. - - - - - The source database for the backup. - - - - - The source database name for the backup. - - - - - The last result from the StepBackup method of the SQLite3 class. - This is used to determine if the call to the FinishBackup method of - the SQLite3 class should throw an exception when it receives a non-Ok - return code from the core SQLite library. - - - - - Initializes the backup. - - The base SQLite object. - The backup handle. - The destination database for the backup. - The destination database name for the backup. - The source database for the backup. - The source database name for the backup. - - - - Disposes and finalizes the backup. - - - - - The extra behavioral flags that can be applied to a connection. - - - - - No extra flags. - - - - - Enable logging of all SQL statements to be prepared. - - - - - Enable logging of all bound parameter types and raw values. - - - - - Enable logging of all bound parameter strongly typed values. - - - - - Enable logging of all exceptions caught from user-provided - managed code called from native code via delegates. - - - - - Enable logging of backup API errors. - - - - - Skip adding the extension functions provided by the native - interop assembly. - - - - - When binding parameter values with the - type, use the interop method that accepts an - value. - - - - - When binding parameter values, always bind them as though they were - plain text (i.e. no numeric, date/time, or other conversions should - be attempted). - - - - - When returning column values, always return them as though they were - plain text (i.e. no numeric, date/time, or other conversions should - be attempted). - - - - - Prevent this object instance from - loading extensions. - - - - - Prevent this object instance from - creating virtual table modules. - - - - - Skip binding any functions provided by other managed assemblies when - opening the connection. - - - - - Skip setting the logging related properties of the - object instance that was passed to - the method. - - - - - Enable logging of all virtual table module errors seen by the - method. - - - - - Enable logging of certain virtual table module exceptions that cannot - be easily discovered via other means. - - - - - Enable tracing of potentially important [non-fatal] error conditions - that cannot be easily reported through other means. - - - - - When binding parameter values, always use the invariant culture when - converting their values from strings. - - - - - When binding parameter values, always use the invariant culture when - converting their values to strings. - - - - - Disable using the connection pool by default. If the "Pooling" - connection string property is specified, its value will override - this flag. The precise outcome of combining this flag with the - flag is unspecified; however, - one of the flags will be in effect. - - - - - Enable using the connection pool by default. If the "Pooling" - connection string property is specified, its value will override - this flag. The precise outcome of combining this flag with the - flag is unspecified; however, - one of the flags will be in effect. - - - - - Enable using per-connection mappings between type names and - values. Also see the - , - , and - methods. These - per-connection mappings, when present, override the corresponding - global mappings. - - - - - Disable using global mappings between type names and - values. This may be useful in some very narrow - cases; however, if there are no per-connection type mappings, the - fallback defaults will be used for both type names and their - associated values. Therefore, use of this flag - is not recommended. - - - - - When binding parameter values or returning column values, always - treat them as though they were plain text (i.e. no numeric, - date/time, or other conversions should be attempted). - - - - - When binding parameter values, always use the invariant culture when - converting their values to strings or from strings. - - - - - When binding parameter values or returning column values, always - treat them as though they were plain text (i.e. no numeric, - date/time, or other conversions should be attempted) and always - use the invariant culture when converting their values to strings. - - - - - When binding parameter values or returning column values, always - treat them as though they were plain text (i.e. no numeric, - date/time, or other conversions should be attempted) and always - use the invariant culture when converting their values to strings - or from strings. - - - - - Enable all logging. - - - - - The default extra flags for new connections. - - - - - SQLite implementation of DbCommand. - - - - - The default connection string to be used when creating a temporary - connection to execute a command via the static - or - - methods. - - - - - The command text this command is based on - - - - - The connection the command is associated with - - - - - The version of the connection the command is associated with - - - - - Indicates whether or not a DataReader is active on the command. - - - - - The timeout for the command, kludged because SQLite doesn't support per-command timeout values - - - - - Designer support - - - - - Used by DbDataAdapter to determine updating behavior - - - - - The collection of parameters for the command - - - - - The SQL command text, broken into individual SQL statements as they are executed - - - - - Unprocessed SQL text that has not been executed - - - - - Transaction associated with this command - - - - - Constructs a new SQLiteCommand - - - Default constructor - - - - - Initializes the command with the given command text - - The SQL command text - - - - Initializes the command with the given SQL command text and attach the command to the specified - connection. - - The SQL command text - The connection to associate with the command - - - - Initializes the command and associates it with the specified connection. - - The connection to associate with the command - - - - Initializes a command with the given SQL, connection and transaction - - The SQL command text - The connection to associate with the command - The transaction the command should be associated with - - - - Disposes of the command and clears all member variables - - Whether or not the class is being explicitly or implicitly disposed - - - - This method attempts to query the flags associated with the database - connection in use. If the database connection is disposed, the default - flags will be returned. - - - The command containing the databse connection to query the flags from. - - - The connection flags value. - - - - - Clears and destroys all statements currently prepared - - - - - Builds an array of prepared statements for each complete SQL statement in the command text - - - - - Not implemented - - - - - Forwards to the local CreateParameter() function - - - - - - Create a new parameter - - - - - - This function ensures there are no active readers, that we have a valid connection, - that the connection is open, that all statements are prepared and all parameters are assigned - in preparation for allocating a data reader. - - - - - Creates a new SQLiteDataReader to execute/iterate the array of SQLite prepared statements - - The behavior the data reader should adopt - Returns a SQLiteDataReader object - - - - This method creates a new connection, executes the query using the given - execution type, closes the connection, and returns the results. If the - connection string is null, a temporary in-memory database connection will - be used. - - - The text of the command to be executed. - - - The execution type for the command. This is used to determine which method - of the command object to call, which then determines the type of results - returned, if any. - - - The connection string to the database to be opened, used, and closed. If - this parameter is null, a temporary in-memory databse will be used. - - - The SQL parameter values to be used when building the command object to be - executed, if any. - - - The results of the query -OR- null if no results were produced from the - given execution type. - - - - - This method creates a new connection, executes the query using the given - execution type and command behavior, closes the connection, and returns - the results. If the connection string is null, a temporary in-memory - database connection will be used. - - - The text of the command to be executed. - - - The execution type for the command. This is used to determine which method - of the command object to call, which then determines the type of results - returned, if any. - - - The command behavior flags for the command. - - - The connection string to the database to be opened, used, and closed. If - this parameter is null, a temporary in-memory databse will be used. - - - The SQL parameter values to be used when building the command object to be - executed, if any. - - - The results of the query -OR- null if no results were produced from the - given execution type. - - - - - Overrides the default behavior to return a SQLiteDataReader specialization class - - The flags to be associated with the reader. - A SQLiteDataReader - - - - Overrides the default behavior of DbDataReader to return a specialized SQLiteDataReader class - - A SQLiteDataReader - - - - Called by the SQLiteDataReader when the data reader is closed. - - - - - Execute the command and return the number of rows inserted/updated affected by it. - - The number of rows inserted/updated affected by it. - - - - Execute the command and return the number of rows inserted/updated affected by it. - - The flags to be associated with the reader. - The number of rows inserted/updated affected by it. - - - - Execute the command and return the first column of the first row of the resultset - (if present), or null if no resultset was returned. - - The first column of the first row of the first resultset from the query. - - - - Execute the command and return the first column of the first row of the resultset - (if present), or null if no resultset was returned. - - The flags to be associated with the reader. - The first column of the first row of the first resultset from the query. - - - - Does nothing. Commands are prepared as they are executed the first time, and kept in prepared state afterwards. - - - - - Clones a command, including all its parameters - - A new SQLiteCommand with the same commandtext, connection and parameters - - - - The SQL command text associated with the command - - - - - The amount of time to wait for the connection to become available before erroring out - - - - - The type of the command. SQLite only supports CommandType.Text - - - - - The connection associated with this command - - - - - Forwards to the local Connection property - - - - - Returns the SQLiteParameterCollection for the given command - - - - - Forwards to the local Parameters property - - - - - The transaction associated with this command. SQLite only supports one transaction per connection, so this property forwards to the - command's underlying connection. - - - - - Forwards to the local Transaction property - - - - - Sets the method the SQLiteCommandBuilder uses to determine how to update inserted or updated rows in a DataTable. - - - - - Determines if the command is visible at design time. Defaults to True. - - - - - SQLite implementation of DbCommandBuilder. - - - - - Default constructor - - - - - Initializes the command builder and associates it with the specified data adapter. - - - - - - Minimal amount of parameter processing. Primarily sets the DbType for the parameter equal to the provider type in the schema - - The parameter to use in applying custom behaviors to a row - The row to apply the parameter to - The type of statement - Whether the application of the parameter is part of a WHERE clause - - - - Returns a valid named parameter - - The name of the parameter - Error - - - - Returns a named parameter for the given ordinal - - The i of the parameter - Error - - - - Returns a placeholder character for the specified parameter i. - - The index of the parameter to provide a placeholder for - Returns a named parameter - - - - Sets the handler for receiving row updating events. Used by the DbCommandBuilder to autogenerate SQL - statements that may not have previously been generated. - - A data adapter to receive events on. - - - - Returns the automatically-generated SQLite command to delete rows from the database - - - - - - Returns the automatically-generated SQLite command to delete rows from the database - - - - - - - Returns the automatically-generated SQLite command to update rows in the database - - - - - - Returns the automatically-generated SQLite command to update rows in the database - - - - - - - Returns the automatically-generated SQLite command to insert rows into the database - - - - - - Returns the automatically-generated SQLite command to insert rows into the database - - - - - - - Places brackets around an identifier - - The identifier to quote - The bracketed identifier - - - - Removes brackets around an identifier - - The quoted (bracketed) identifier - The undecorated identifier - - - - Override helper, which can help the base command builder choose the right keys for the given query - - - - - - - Gets/sets the DataAdapter for this CommandBuilder - - - - - Overridden to hide its property from the designer - - - - - Overridden to hide its property from the designer - - - - - Overridden to hide its property from the designer - - - - - Overridden to hide its property from the designer - - - - - Overridden to hide its property from the designer - - - - - Event data for connection event handlers. - - - - - The type of event being raised. - - - - - The associated with this event, if any. - - - - - The transaction associated with this event, if any. - - - - - The command associated with this event, if any. - - - - - The data reader associated with this event, if any. - - - - - The critical handle associated with this event, if any. - - - - - Command or message text associated with this event, if any. - - - - - Extra data associated with this event, if any. - - - - - Constructs the object. - - The type of event being raised. - The base associated - with this event, if any. - The transaction associated with this event, if any. - The command associated with this event, if any. - The data reader associated with this event, if any. - The critical handle associated with this event, if any. - The command or message text, if any. - The extra data, if any. - - - - Raised when an event pertaining to a connection occurs. - - The connection involved. - Extra information about the event. - - - - SQLite implentation of DbConnection. - - - The property can contain the following parameter(s), delimited with a semi-colon: - - - Parameter - Values - Required - Default - - - Data Source - - This may be a file name, the string ":memory:", or any supported URI (starting with SQLite 3.7.7). - Starting with release 1.0.86.0, in order to use more than one consecutive backslash (e.g. for a - UNC path), each of the adjoining backslash characters must be doubled (e.g. "\\Network\Share\test.db" - would become "\\\\Network\Share\test.db"). - - Y - - - - Version - 3 - N - 3 - - - UseUTF16Encoding - True
False
- N - False -
- - DateTimeFormat - - Ticks - Use the value of DateTime.Ticks.
- ISO8601 - Use the ISO-8601 format. Uses the "yyyy-MM-dd HH:mm:ss.FFFFFFFK" format for UTC - DateTime values and "yyyy-MM-dd HH:mm:ss.FFFFFFF" format for local DateTime values).
- JulianDay - The interval of time in days and fractions of a day since January 1, 4713 BC.
- UnixEpoch - The whole number of seconds since the Unix epoch (January 1, 1970).
- InvariantCulture - Any culture-independent string value that the .NET Framework can interpret as a valid DateTime.
- CurrentCulture - Any string value that the .NET Framework can interpret as a valid DateTime using the current culture.
- N - ISO8601 -
- - DateTimeKind - Unspecified - Not specified as either UTC or local time.
Utc - The time represented is UTC.
Local - The time represented is local time.
- N - Unspecified -
- - DateTimeFormatString - The exact DateTime format string to use for all formatting and parsing of all DateTime - values for this connection. - N - null - - - BaseSchemaName - Some base data classes in the framework (e.g. those that build SQL queries dynamically) - assume that an ADO.NET provider cannot support an alternate catalog (i.e. database) without supporting - alternate schemas as well; however, SQLite does not fit into this model. Therefore, this value is used - as a placeholder and removed prior to preparing any SQL statements that may contain it. - N - sqlite_default_schema - - - BinaryGUID - True - Store GUID columns in binary form
False - Store GUID columns as text
- N - True -
- - Cache Size - {size in bytes} - N - 2000 - - - Synchronous - Normal - Normal file flushing behavior
Full - Full flushing after all writes
Off - Underlying OS flushes I/O's
- N - Full -
- - Page Size - {size in bytes} - N - 1024 - - - Password - {password} - Using this parameter requires that the CryptoAPI based codec be enabled at compile-time for both the native interop assembly and the core managed assemblies; otherwise, using this parameter may result in an exception being thrown when attempting to open the connection. - N - - - - HexPassword - {hexPassword} - Must contain a sequence of zero or more hexadecimal encoded byte values without a leading "0x" prefix. Using this parameter requires that the CryptoAPI based codec be enabled at compile-time for both the native interop assembly and the core managed assemblies; otherwise, using this parameter may result in an exception being thrown when attempting to open the connection. - N - - - - Enlist - Y - Automatically enlist in distributed transactions
N - No automatic enlistment
- N - Y -
- - Pooling - - True - Use connection pooling.
- False - Do not use connection pooling.

- WARNING: When using the default connection pool implementation, - setting this property to True should be avoided by applications that make - use of COM (either directly or indirectly) due to possible deadlocks that - can occur during the finalization of some COM objects. -
- N - False -
- - FailIfMissing - True - Don't create the database if it does not exist, throw an error instead
False - Automatically create the database if it does not exist
- N - False -
- - Max Page Count - {size in pages} - Limits the maximum number of pages (limits the size) of the database - N - 0 - - - Legacy Format - True - Use the more compatible legacy 3.x database format
False - Use the newer 3.3x database format which compresses numbers more effectively
- N - False -
- - Default Timeout - {time in seconds}
The default command timeout
- N - 30 -
- - Journal Mode - Delete - Delete the journal file after a commit
Persist - Zero out and leave the journal file on disk after a commit
Off - Disable the rollback journal entirely
- N - Delete -
- - Read Only - True - Open the database for read only access
False - Open the database for normal read/write access
- N - False -
- - Max Pool Size - The maximum number of connections for the given connection string that can be in the connection pool - N - 100 - - - Default IsolationLevel - The default transaciton isolation level - N - Serializable - - - Foreign Keys - Enable foreign key constraints - N - False - - - Flags - Extra behavioral flags for the connection. See the enumeration for possible values. - N - Default - - - SetDefaults - - True - Apply the default connection settings to the opened database.
- False - Skip applying the default connection settings to the opened database. -
- N - True -
- - ToFullPath - - True - Attempt to expand the data source file name to a fully qualified path before opening.
- False - Skip attempting to expand the data source file name to a fully qualified path before opening. -
- N - True -
-
-
-
- - - The default "stub" (i.e. placeholder) base schema name to use when - returning column schema information. Used as the initial value of - the BaseSchemaName property. This should start with "sqlite_*" - because those names are reserved for use by SQLite (i.e. they cannot - be confused with the names of user objects). - - - - - The managed assembly containing this type. - - - - - Object used to synchronize access to the static instance data - for this class. - - - - - State of the current connection - - - - - The connection string - - - - - Nesting level of the transactions open on the connection - - - - - If set, then the connection is currently being disposed. - - - - - The default isolation level for new transactions - - - - - Whether or not the connection is enlisted in a distrubuted transaction - - - - - The per-connection mappings between type names and - values. These mappings override the corresponding global mappings. - - - - - The base SQLite object to interop with - - - - - The database filename minus path and extension - - - - - Temporary password storage, emptied after the database has been opened - - - - - The "stub" (i.e. placeholder) base schema name to use when returning - column schema information. - - - - - The extra behavioral flags for this connection, if any. See the - enumeration for a list of - possible values. - - - - - Default command timeout - - - - - Non-zero if the built-in (i.e. framework provided) connection string - parser should be used when opening the connection. - - - - - Constructs a new SQLiteConnection object - - - Default constructor - - - - - Initializes the connection with the specified connection string. - - The connection string to use. - - - - Initializes the connection with a pre-existing native connection handle. - This constructor overload is intended to be used only by the private - method. - - - The native connection handle to use. - - - The file name corresponding to the native connection handle. - - - Non-zero if this instance owns the native connection handle and - should dispose of it when it is no longer needed. - - - - - Initializes the connection with the specified connection string. - - - The connection string to use. - - - Non-zero to parse the connection string using the built-in (i.e. - framework provided) parser when opening the connection. - - - - - Clones the settings and connection string from an existing connection. If the existing connection is already open, this - function will open its own connection, enumerate any attached databases of the original connection, and automatically - attach to them. - - The connection to copy the settings from. - - - - Raises the event. - - - The connection associated with this event. If this parameter is not - null and the specified connection cannot raise events, then the - registered event handlers will not be invoked. - - - A that contains the event data. - - - - - Creates and returns a new managed database connection handle. This - method is intended to be used by implementations of the - interface only. In theory, it - could be used by other classes; however, that usage is not supported. - - - This must be a native database connection handle returned by the - SQLite core library and it must remain valid and open during the - entire duration of the calling method. - - - The new managed database connection handle or null if it cannot be - created. - - - - - Backs up the database, using the specified database connection as the - destination. - - The destination database connection. - The destination database name. - The source database name. - - The number of pages to copy or negative to copy all remaining pages. - - - The method to invoke between each step of the backup process. This - parameter may be null (i.e. no callbacks will be performed). - - - The number of milliseconds to sleep after encountering a locking error - during the backup process. A value less than zero means that no sleep - should be performed. - - - - - Clears the per-connection type mappings. - - - The total number of per-connection type mappings cleared. - - - - - Returns the per-connection type mappings. - - - The per-connection type mappings -OR- null if they are unavailable. - - - - - Adds a per-connection type mapping, possibly replacing one or more - that already exist. - - - The case-insensitive database type name (e.g. "MYDATE"). The value - of this parameter cannot be null. Using an empty string value (or - a string value consisting entirely of whitespace) for this parameter - is not recommended. - - - The value that should be associated with the - specified type name. - - - Non-zero if this mapping should be considered to be the primary one - for the specified . - - - A negative value if nothing was done. Zero if no per-connection type - mappings were replaced (i.e. it was a pure add operation). More than - zero if some per-connection type mappings were replaced. - - - - - Attempts to bind the specified object - instance to this connection. - - - The object instance containing - the metadata for the function to be bound. - - - The object instance that implements the - function to be bound. - - - - - Creates a clone of the connection. All attached databases and user-defined functions are cloned. If the existing connection is open, the cloned connection - will also be opened. - - - - - - Creates a database file. This just creates a zero-byte file which SQLite - will turn into a database when the file is opened properly. - - The file to create - - - - Raises the state change event when the state of the connection changes - - The new connection state. If this is different - from the previous state, the event is - raised. - The event data created for the raised event, if - it was actually raised. - - - - Determines and returns the fallback default isolation level when one cannot be - obtained from an existing connection instance. - - - The fallback default isolation level for this connection instance -OR- - if it cannot be determined. - - - - - Determines and returns the default isolation level for this connection instance. - - - The default isolation level for this connection instance -OR- - if it cannot be determined. - - - - - OBSOLETE. Creates a new SQLiteTransaction if one isn't already active on the connection. - - This parameter is ignored. - When TRUE, SQLite defers obtaining a write lock until a write operation is requested. - When FALSE, a writelock is obtained immediately. The default is TRUE, but in a multi-threaded multi-writer - environment, one may instead choose to lock the database immediately to avoid any possible writer deadlock. - Returns a SQLiteTransaction object. - - - - OBSOLETE. Creates a new SQLiteTransaction if one isn't already active on the connection. - - When TRUE, SQLite defers obtaining a write lock until a write operation is requested. - When FALSE, a writelock is obtained immediately. The default is false, but in a multi-threaded multi-writer - environment, one may instead choose to lock the database immediately to avoid any possible writer deadlock. - Returns a SQLiteTransaction object. - - - - Creates a new if one isn't already active on the connection. - - Supported isolation levels are Serializable, ReadCommitted and Unspecified. - - Unspecified will use the default isolation level specified in the connection string. If no isolation level is specified in the - connection string, Serializable is used. - Serializable transactions are the default. In this mode, the engine gets an immediate lock on the database, and no other threads - may begin a transaction. Other threads may read from the database, but not write. - With a ReadCommitted isolation level, locks are deferred and elevated as needed. It is possible for multiple threads to start - a transaction in ReadCommitted mode, but if a thread attempts to commit a transaction while another thread - has a ReadCommitted lock, it may timeout or cause a deadlock on both threads until both threads' CommandTimeout's are reached. - - Returns a SQLiteTransaction object. - - - - Creates a new if one isn't already - active on the connection. - - Returns the new transaction object. - - - - Forwards to the local function - - Supported isolation levels are Unspecified, Serializable, and ReadCommitted - - - - - This method is not implemented; however, the - event will still be raised. - - - - - - When the database connection is closed, all commands linked to this connection are automatically reset. - - - - - Clears the connection pool associated with the connection. Any other active connections using the same database file - will be discarded instead of returned to the pool when they are closed. - - - - - - Clears all connection pools. Any active connections will be discarded instead of sent to the pool when they are closed. - - - - - Create a new and associate it with this connection. - - Returns a new command object already assigned to this connection. - - - - Forwards to the local function. - - - - - - Parses the connection string into component parts using the custom - connection string parser. - - The connection string to parse - An array of key-value pairs representing each parameter of the connection string - - - - Parses a connection string using the built-in (i.e. framework provided) - connection string parser class and returns the key/value pairs. An - exception may be thrown if the connection string is invalid or cannot be - parsed. When compiled for the .NET Compact Framework, the custom - connection string parser is always used instead because the framework - provided one is unavailable there. - - - The connection string to parse. - - - Non-zero to throw an exception if any connection string values are not of - the type. - - The list of key/value pairs. - - - - Manual distributed transaction enlistment support - - The distributed transaction to enlist in - - - - Looks for a key in the array of key/values of the parameter string. If not found, return the specified default value - - The list to look in - The key to find - The default value to return if the key is not found - The value corresponding to the specified key, or the default value if not found. - - - - Attempts to convert the string value to an enumerated value of the specified type. - - The enumerated type to convert the string value to. - The string value to be converted. - Non-zero to make the conversion case-insensitive. - The enumerated value upon success or null upon error. - - - - Attempts to convert an input string into a byte value. - - - The string value to be converted. - - - The number styles to use for the conversion. - - - Upon sucess, this will contain the parsed byte value. - Upon failure, the value of this parameter is undefined. - - - Non-zero upon success; zero on failure. - - - - - Enables or disabled extension loading. - - - True to enable loading of extensions, false to disable. - - - - - Loads a SQLite extension library from the named dynamic link library file. - - - The name of the dynamic link library file containing the extension. - - - - - Loads a SQLite extension library from the named dynamic link library file. - - - The name of the dynamic link library file containing the extension. - - - The name of the exported function used to initialize the extension. - If null, the default "sqlite3_extension_init" will be used. - - - - - Creates a disposable module containing the implementation of a virtual - table. - - - The module object to be used when creating the disposable module. - - - - - Parses a string containing a sequence of zero or more hexadecimal - encoded byte values and returns the resulting byte array. The - "0x" prefix is not allowed on the input string. - - - The input string containing zero or more hexadecimal encoded byte - values. - - - A byte array containing the parsed byte values or null if an error - was encountered. - - - - - Creates and returns a string containing the hexadecimal encoded byte - values from the input array. - - - The input array of bytes. - - - The resulting string or null upon failure. - - - - - Parses a string containing a sequence of zero or more hexadecimal - encoded byte values and returns the resulting byte array. The - "0x" prefix is not allowed on the input string. - - - The input string containing zero or more hexadecimal encoded byte - values. - - - Upon failure, this will contain an appropriate error message. - - - A byte array containing the parsed byte values or null if an error - was encountered. - - - - - This method figures out what the default connection pool setting should - be based on the connection flags. When present, the "Pooling" connection - string property value always overrides the value returned by this method. - - - Non-zero if the connection pool should be enabled by default; otherwise, - zero. - - - - - Opens the connection using the parameters found in the . - - - - - Opens the connection using the parameters found in the and then returns it. - - The current connection object. - - - - This method causes any pending database operation to abort and return at - its earliest opportunity. This routine is typically called in response - to a user action such as pressing "Cancel" or Ctrl-C where the user wants - a long query operation to halt immediately. It is safe to call this - routine from any thread. However, it is not safe to call this routine - with a database connection that is closed or might close before this method - returns. - - - - - Returns various global memory statistics for the SQLite core library via - a dictionary of key/value pairs. Currently, only the "MemoryUsed" and - "MemoryHighwater" keys are returned and they have values that correspond - to the values that could be obtained via the - and connection properties. - - - This dictionary will be populated with the global memory statistics. It - will be created if necessary. - - - - - Attempts to free as much heap memory as possible for this database connection. - - - - - Attempts to free N bytes of heap memory by deallocating non-essential memory - allocations held by the database library. Memory used to cache database pages - to improve performance is an example of non-essential memory. This is a no-op - returning zero if the SQLite core library was not compiled with the compile-time - option SQLITE_ENABLE_MEMORY_MANAGEMENT. Optionally, attempts to reset and/or - compact the Win32 native heap, if applicable. - - - The requested number of bytes to free. - - - Non-zero to attempt a heap reset. - - - Non-zero to attempt heap compaction. - - - The number of bytes actually freed. This value may be zero. - - - This value will be non-zero if the heap reset was successful. - - - The size of the largest committed free block in the heap, in bytes. - This value will be zero unless heap compaction is enabled. - - - A standard SQLite return code (i.e. zero for success and non-zero - for failure). - - - - - Sets the status of the memory usage tracking subsystem in the SQLite core library. By default, this is enabled. - If this is disabled, memory usage tracking will not be performed. This is not really a per-connection value, it is - global to the process. - - Non-zero to enable memory usage tracking, zero otherwise. - A standard SQLite return code (i.e. zero for success and non-zero for failure). - - - - Passes a shutdown request to the SQLite core library. Does not throw - an exception if the shutdown request fails. - - - A standard SQLite return code (i.e. zero for success and non-zero for - failure). - - - - - Passes a shutdown request to the SQLite core library. Throws an - exception if the shutdown request fails and the no-throw parameter - is non-zero. - - - Non-zero to reset the database and temporary directories to their - default values, which should be null for both. - - - When non-zero, throw an exception if the shutdown request fails. - - - - Enables or disabled extended result codes returned by SQLite - - - Enables or disabled extended result codes returned by SQLite - - - Enables or disabled extended result codes returned by SQLite - - - Add a log message via the SQLite sqlite3_log interface. - - - Add a log message via the SQLite sqlite3_log interface. - - - - Change the password (or assign a password) to an open database. - - - No readers or writers may be active for this process. The database must already be open - and if it already was password protected, the existing password must already have been supplied. - - The new password to assign to the database - - - - Change the password (or assign a password) to an open database. - - - No readers or writers may be active for this process. The database must already be open - and if it already was password protected, the existing password must already have been supplied. - - The new password to assign to the database - - - - Sets the password for a password-protected database. A password-protected database is - unusable for any operation until the password has been set. - - The password for the database - - - - Sets the password for a password-protected database. A password-protected database is - unusable for any operation until the password has been set. - - The password for the database - - - - Queries or modifies the number of retries or the retry interval (in milliseconds) for - certain I/O operations that may fail due to anti-virus software. - - The number of times to retry the I/O operation. A negative value - will cause the current count to be queried and replace that negative value. - The number of milliseconds to wait before retrying the I/O - operation. This number is multiplied by the number of retry attempts so far to come - up with the final number of milliseconds to wait. A negative value will cause the - current interval to be queried and replace that negative value. - Zero for success, non-zero for error. - - - - Removes one set of surrounding single -OR- double quotes from the string - value and returns the resulting string value. If the string is null, empty, - or contains quotes that are not balanced, nothing is done and the original - string value will be returned. - - The string value to process. - - The string value, modified to remove one set of surrounding single -OR- - double quotes, if applicable. - - - - - Expand the filename of the data source, resolving the |DataDirectory| - macro as appropriate. - - The database filename to expand - - Non-zero if the returned file name should be converted to a full path - (except when using the .NET Compact Framework). - - The expanded path and filename of the filename - - - - The following commands are used to extract schema information out of the database. Valid schema types are: - - - MetaDataCollections - - - DataSourceInformation - - - Catalogs - - - Columns - - - ForeignKeys - - - Indexes - - - IndexColumns - - - Tables - - - Views - - - ViewColumns - - - - - Returns the MetaDataCollections schema - - A DataTable of the MetaDataCollections schema - - - - Returns schema information of the specified collection - - The schema collection to retrieve - A DataTable of the specified collection - - - - Retrieves schema information using the specified constraint(s) for the specified collection - - The collection to retrieve - The restrictions to impose - A DataTable of the specified collection - - - - Builds a MetaDataCollections schema datatable - - DataTable - - - - Builds a DataSourceInformation datatable - - DataTable - - - - Build a Columns schema - - The catalog (attached database) to query, can be null - The table to retrieve schema information for, must not be null - The column to retrieve schema information for, can be null - DataTable - - - - Returns index information for the given database and catalog - - The catalog (attached database) to query, can be null - The name of the index to retrieve information for, can be null - The table to retrieve index information for, can be null - DataTable - - - - Retrieves table schema information for the database and catalog - - The catalog (attached database) to retrieve tables on - The table to retrieve, can be null - The table type, can be null - DataTable - - - - Retrieves view schema information for the database - - The catalog (attached database) to retrieve views on - The view name, can be null - DataTable - - - - Retrieves catalog (attached databases) schema information for the database - - The catalog to retrieve, can be null - DataTable - - - - Returns the base column information for indexes in a database - - The catalog to retrieve indexes for (can be null) - The table to restrict index information by (can be null) - The index to restrict index information by (can be null) - The source column to restrict index information by (can be null) - A DataTable containing the results - - - - Returns detailed column information for a specified view - - The catalog to retrieve columns for (can be null) - The view to restrict column information by (can be null) - The source column to restrict column information by (can be null) - A DataTable containing the results - - - - Retrieves foreign key information from the specified set of filters - - An optional catalog to restrict results on - An optional table to restrict results on - An optional foreign key name to restrict results on - A DataTable with the results of the query - - - - Static variable to store the connection event handlers to call. - - - - - This event is raised whenever the database is opened or closed. - - - - - This event is raised when events related to the lifecycle of a - SQLiteConnection object occur. - - - - - This property is used to obtain or set the custom connection pool - implementation to use, if any. Setting this property to null will - cause the default connection pool implementation to be used. - - - - - Returns the number of pool entries for the file name associated with this connection. - - - - - The connection string containing the parameters for the connection - - - - - Parameter - Values - Required - Default - - - Data Source - - This may be a file name, the string ":memory:", or any supported URI (starting with SQLite 3.7.7). - Starting with release 1.0.86.0, in order to use more than one consecutive backslash (e.g. for a - UNC path), each of the adjoining backslash characters must be doubled (e.g. "\\Network\Share\test.db" - would become "\\\\Network\Share\test.db"). - - Y - - - - Version - 3 - N - 3 - - - UseUTF16Encoding - True
False
- N - False -
- - DateTimeFormat - - Ticks - Use the value of DateTime.Ticks.
- ISO8601 - Use the ISO-8601 format. Uses the "yyyy-MM-dd HH:mm:ss.FFFFFFFK" format for UTC - DateTime values and "yyyy-MM-dd HH:mm:ss.FFFFFFF" format for local DateTime values).
- JulianDay - The interval of time in days and fractions of a day since January 1, 4713 BC.
- UnixEpoch - The whole number of seconds since the Unix epoch (January 1, 1970).
- InvariantCulture - Any culture-independent string value that the .NET Framework can interpret as a valid DateTime.
- CurrentCulture - Any string value that the .NET Framework can interpret as a valid DateTime using the current culture.
- N - ISO8601 -
- - DateTimeKind - Unspecified - Not specified as either UTC or local time.
Utc - The time represented is UTC.
Local - The time represented is local time.
- N - Unspecified -
- - DateTimeFormatString - The exact DateTime format string to use for all formatting and parsing of all DateTime - values for this connection. - N - null - - - BaseSchemaName - Some base data classes in the framework (e.g. those that build SQL queries dynamically) - assume that an ADO.NET provider cannot support an alternate catalog (i.e. database) without supporting - alternate schemas as well; however, SQLite does not fit into this model. Therefore, this value is used - as a placeholder and removed prior to preparing any SQL statements that may contain it. - N - sqlite_default_schema - - - BinaryGUID - True - Store GUID columns in binary form
False - Store GUID columns as text
- N - True -
- - Cache Size - {size in bytes} - N - 2000 - - - Synchronous - Normal - Normal file flushing behavior
Full - Full flushing after all writes
Off - Underlying OS flushes I/O's
- N - Full -
- - Page Size - {size in bytes} - N - 1024 - - - Password - {password} - Using this parameter requires that the CryptoAPI based codec be enabled at compile-time for both the native interop assembly and the core managed assemblies; otherwise, using this parameter may result in an exception being thrown when attempting to open the connection. - N - - - - HexPassword - {hexPassword} - Must contain a sequence of zero or more hexadecimal encoded byte values without a leading "0x" prefix. Using this parameter requires that the CryptoAPI based codec be enabled at compile-time for both the native interop assembly and the core managed assemblies; otherwise, using this parameter may result in an exception being thrown when attempting to open the connection. - N - - - - Enlist - Y - Automatically enlist in distributed transactions
N - No automatic enlistment
- N - Y -
- - Pooling - - True - Use connection pooling.
- False - Do not use connection pooling.

- WARNING: When using the default connection pool implementation, - setting this property to True should be avoided by applications that - make use of COM (either directly or indirectly) due to possible - deadlocks that can occur during the finalization of some COM objects. -
- N - False -
- - FailIfMissing - True - Don't create the database if it does not exist, throw an error instead
False - Automatically create the database if it does not exist
- N - False -
- - Max Page Count - {size in pages} - Limits the maximum number of pages (limits the size) of the database - N - 0 - - - Legacy Format - True - Use the more compatible legacy 3.x database format
False - Use the newer 3.3x database format which compresses numbers more effectively
- N - False -
- - Default Timeout - {time in seconds}
The default command timeout
- N - 30 -
- - Journal Mode - Delete - Delete the journal file after a commit
Persist - Zero out and leave the journal file on disk after a commit
Off - Disable the rollback journal entirely
- N - Delete -
- - Read Only - True - Open the database for read only access
False - Open the database for normal read/write access
- N - False -
- - Max Pool Size - The maximum number of connections for the given connection string that can be in the connection pool - N - 100 - - - Default IsolationLevel - The default transaciton isolation level - N - Serializable - - - Foreign Keys - Enable foreign key constraints - N - False - - - Flags - Extra behavioral flags for the connection. See the enumeration for possible values. - N - Default - - - SetDefaults - - True - Apply the default connection settings to the opened database.
- False - Skip applying the default connection settings to the opened database. -
- N - True -
- - ToFullPath - - True - Attempt to expand the data source file name to a fully qualified path before opening.
- False - Skip attempting to expand the data source file name to a fully qualified path before opening. -
- N - True -
-
-
-
- - - Returns the data source file name without extension or path. - - - - - Returns the string "main". - - - - - Gets/sets the default command timeout for newly-created commands. This is especially useful for - commands used internally such as inside a SQLiteTransaction, where setting the timeout is not possible. - This can also be set in the ConnectionString with "Default Timeout" - - - - - Non-zero if the built-in (i.e. framework provided) connection string - parser should be used when opening the connection. - - - - - Gets/sets the extra behavioral flags for this connection. See the - enumeration for a list of - possible values. - - - - - Returns non-zero if the underlying native connection handle is - owned by this instance. - - - - - Returns the version of the underlying SQLite database engine - - - - - Returns the rowid of the most recent successful INSERT into the database from this connection. - - - - - Returns the number of rows changed by the last INSERT, UPDATE, or DELETE statement executed on - this connection. - - - - - Returns non-zero if the given database connection is in autocommit mode. - Autocommit mode is on by default. Autocommit mode is disabled by a BEGIN - statement. Autocommit mode is re-enabled by a COMMIT or ROLLBACK. - - - - - Returns the amount of memory (in bytes) currently in use by the SQLite core library. - - - - - Returns the maximum amount of memory (in bytes) used by the SQLite core library since the high-water mark was last reset. - - - - - Returns a string containing the define constants (i.e. compile-time - options) used to compile the core managed assembly, delimited with - spaces. - - - - - Returns the version of the underlying SQLite core library. - - - - - This method returns the string whose value is the same as the - SQLITE_SOURCE_ID C preprocessor macro used when compiling the - SQLite core library. - - - - - Returns a string containing the compile-time options used to - compile the SQLite core native library, delimited with spaces. - - - - - This method returns the version of the interop SQLite assembly - used. If the SQLite interop assembly is not in use or the - necessary information cannot be obtained for any reason, a null - value may be returned. - - - - - This method returns the string whose value contains the unique - identifier for the source checkout used to build the interop - assembly. If the SQLite interop assembly is not in use or the - necessary information cannot be obtained for any reason, a null - value may be returned. - - - - - Returns a string containing the compile-time options used to - compile the SQLite interop assembly, delimited with spaces. - - - - - This method returns the version of the managed components used - to interact with the SQLite core library. If the necessary - information cannot be obtained for any reason, a null value may - be returned. - - - - - This method returns the string whose value contains the unique - identifier for the source checkout used to build the managed - components currently executing. If the necessary information - cannot be obtained for any reason, a null value may be returned. - - - - - Returns the state of the connection. - - - - - This event is raised whenever SQLite encounters an action covered by the - authorizer during query preparation. Changing the value of the - property will determine if - the specific action will be allowed, ignored, or denied. For the entire - duration of the event, the associated connection and statement objects - must not be modified, either directly or indirectly, by the called code. - - - - - This event is raised whenever SQLite makes an update/delete/insert into the database on - this connection. It only applies to the given connection. - - - - - This event is raised whenever SQLite is committing a transaction. - Return non-zero to trigger a rollback. - - - - - This event is raised whenever SQLite statement first begins executing on - this connection. It only applies to the given connection. - - - - - This event is raised whenever SQLite is rolling back a transaction. - - - - - Returns the instance. - - - - - The I/O file cache flushing behavior for the connection - - - - - Normal file flushing at critical sections of the code - - - - - Full file flushing after every write operation - - - - - Use the default operating system's file flushing, SQLite does not explicitly flush the file buffers after writing - - - - - Raised when authorization is required to perform an action contained - within a SQL query. - - The connection performing the action. - A that contains the - event data. - - - - Raised when a transaction is about to be committed. To roll back a transaction, set the - rollbackTrans boolean value to true. - - The connection committing the transaction - Event arguments on the transaction - - - - Raised when data is inserted, updated and deleted on a given connection - - The connection committing the transaction - The event parameters which triggered the event - - - - Raised when a statement first begins executing on a given connection - - The connection executing the statement - Event arguments of the trace - - - - Raised between each backup step. - - - The source database connection. - - - The source database name. - - - The destination database connection. - - - The destination database name. - - - The number of pages copied with each step. - - - The number of pages remaining to be copied. - - - The total number of pages in the source database. - - - Set to true if the operation needs to be retried due to database - locking issues; otherwise, set to false. - - - True to continue with the backup process or false to halt the backup - process, rolling back any changes that have been made so far. - - - - - The data associated with a call into the authorizer. - - - - - The user-defined native data associated with this event. Currently, - this will always contain the value of . - - - - - The action code responsible for the current call into the authorizer. - - - - - The first string argument for the current call into the authorizer. - The exact value will vary based on the action code, see the - enumeration for possible - values. - - - - - The second string argument for the current call into the authorizer. - The exact value will vary based on the action code, see the - enumeration for possible - values. - - - - - The database name for the current call into the authorizer, if - applicable. - - - - - The name of the inner-most trigger or view that is responsible for - the access attempt or a null value if this access attempt is directly - from top-level SQL code. - - - - - The return code for the current call into the authorizer. - - - - - Constructs an instance of this class with default property values. - - - - - Constructs an instance of this class with specific property values. - - - The user-defined native data associated with this event. - - - The authorizer action code. - - - The first authorizer argument. - - - The second authorizer argument. - - - The database name, if applicable. - - - The name of the inner-most trigger or view that is responsible for - the access attempt or a null value if this access attempt is directly - from top-level SQL code. - - - The authorizer return code. - - - - - Whenever an update event is triggered on a connection, this enum will indicate - exactly what type of operation is being performed. - - - - - A row is being deleted from the given database and table - - - - - A row is being inserted into the table. - - - - - A row is being updated in the table. - - - - - Passed during an Update callback, these event arguments detail the type of update operation being performed - on the given connection. - - - - - The name of the database being updated (usually "main" but can be any attached or temporary database) - - - - - The name of the table being updated - - - - - The type of update being performed (insert/update/delete) - - - - - The RowId affected by this update. - - - - - Event arguments raised when a transaction is being committed - - - - - Set to true to abort the transaction and trigger a rollback - - - - - Passed during an Trace callback, these event arguments contain the UTF-8 rendering of the SQL statement text - - - - - SQL statement text as the statement first begins executing - - - - - This interface represents a custom connection pool implementation - usable by System.Data.SQLite. - - - - - Counts the number of pool entries matching the specified file name. - - - The file name to match or null to match all files. - - - The pool entry counts for each matching file. - - - The total number of connections successfully opened from any pool. - - - The total number of connections successfully closed from any pool. - - - The total number of pool entries for all matching files. - - - - - Disposes of all pooled connections associated with the specified - database file name. - - - The database file name. - - - - - Disposes of all pooled connections. - - - - - Adds a connection to the pool of those associated with the - specified database file name. - - - The database file name. - - - The database connection handle. - - - The connection pool version at the point the database connection - handle was received from the connection pool. This is also the - connection pool version that the database connection handle was - created under. - - - - - Removes a connection from the pool of those associated with the - specified database file name with the intent of using it to - interact with the database. - - - The database file name. - - - The new maximum size of the connection pool for the specified - database file name. - - - The connection pool version associated with the returned database - connection handle, if any. - - - The database connection handle associated with the specified - database file name or null if it cannot be obtained. - - - - - This default method implementations in this class should not be used by - applications that make use of COM (either directly or indirectly) due - to possible deadlocks that can occur during finalization of some COM - objects. - - - - - This field is used to synchronize access to the private static data - in this class. - - - - - When this field is non-null, it will be used to provide the - implementation of all the connection pool methods; otherwise, - the default method implementations will be used. - - - - - The dictionary of connection pools, based on the normalized file - name of the SQLite database. - - - - - The default version number new pools will get. - - - - - The number of connections successfully opened from any pool. - This value is incremented by the Remove method. - - - - - The number of connections successfully closed from any pool. - This value is incremented by the Add method. - - - - - Counts the number of pool entries matching the specified file name. - - - The file name to match or null to match all files. - - - The pool entry counts for each matching file. - - - The total number of connections successfully opened from any pool. - - - The total number of connections successfully closed from any pool. - - - The total number of pool entries for all matching files. - - - - - Disposes of all pooled connections associated with the specified - database file name. - - - The database file name. - - - - - Disposes of all pooled connections. - - - - - Adds a connection to the pool of those associated with the - specified database file name. - - - The database file name. - - - The database connection handle. - - - The connection pool version at the point the database connection - handle was received from the connection pool. This is also the - connection pool version that the database connection handle was - created under. - - - - - Removes a connection from the pool of those associated with the - specified database file name with the intent of using it to - interact with the database. - - - The database file name. - - - The new maximum size of the connection pool for the specified - database file name. - - - The connection pool version associated with the returned database - connection handle, if any. - - - The database connection handle associated with the specified - database file name or null if it cannot be obtained. - - - - - This method is used to obtain a reference to the custom connection - pool implementation currently in use, if any. - - - The custom connection pool implementation or null if the default - connection pool implementation should be used. - - - - - This method is used to set the reference to the custom connection - pool implementation to use, if any. - - - The custom connection pool implementation to use or null if the - default connection pool implementation should be used. - - - - - We do not have to thread-lock anything in this function, because it - is only called by other functions above which already take the lock. - - - The pool queue to resize. - - - If a function intends to add to the pool, this is true, which - forces the resize to take one more than it needs from the pool. - - - - - Keeps track of connections made on a specified file. The PoolVersion - dictates whether old objects get returned to the pool or discarded - when no longer in use. - - - - - The queue of weak references to the actual database connection - handles. - - - - - This pool version associated with the database connection - handles in this pool queue. - - - - - The maximum size of this pool queue. - - - - - Constructs a connection pool queue using the specified version - and maximum size. Normally, all the database connection - handles in this pool are associated with a single database file - name. - - - The initial pool version for this connection pool queue. - - - The initial maximum size for this connection pool queue. - - - - - SQLite implementation of DbConnectionStringBuilder. - - - - - Properties of this class - - - - - Constructs a new instance of the class - - - Default constructor - - - - - Constructs a new instance of the class using the specified connection string. - - The connection string to parse - - - - Private initializer, which assigns the connection string and resets the builder - - The connection string to assign - - - - Helper function for retrieving values from the connectionstring - - The keyword to retrieve settings for - The resulting parameter value - Returns true if the value was found and returned - - - - Fallback method for MONO, which doesn't implement DbConnectionStringBuilder.GetProperties() - - The hashtable to fill with property descriptors - - - - Gets/Sets the default version of the SQLite engine to instantiate. Currently the only valid value is 3, indicating version 3 of the sqlite library. - - - - - Gets/Sets the synchronization mode (file flushing) of the connection string. Default is "Normal". - - - - - Gets/Sets the encoding for the connection string. The default is "False" which indicates UTF-8 encoding. - - - - - Gets/Sets whether or not to use connection pooling. The default is "False" - - - - - Gets/Sets whethor not to store GUID's in binary format. The default is True - which saves space in the database. - - - - - Gets/Sets the filename to open on the connection string. - - - - - An alternate to the data source property - - - - - An alternate to the data source property that uses the SQLite URI syntax. - - - - - Gets/sets the default command timeout for newly-created commands. This is especially useful for - commands used internally such as inside a SQLiteTransaction, where setting the timeout is not possible. - - - - - Determines whether or not the connection will automatically participate - in the current distributed transaction (if one exists) - - - - - If set to true, will throw an exception if the database specified in the connection - string does not exist. If false, the database will be created automatically. - - - - - If enabled, uses the legacy 3.xx format for maximum compatibility, but results in larger - database sizes. - - - - - When enabled, the database will be opened for read-only access and writing will be disabled. - - - - - Gets/sets the database encryption password - - - - - Gets/sets the database encryption hexadecimal password - - - - - Gets/Sets the page size for the connection. - - - - - Gets/Sets the maximum number of pages the database may hold - - - - - Gets/Sets the cache size for the connection. - - - - - Gets/Sets the DateTime format for the connection. - - - - - Gets/Sets the DateTime kind for the connection. - - - - - Gets/sets the DateTime format string used for formatting - and parsing purposes. - - - - - Gets/Sets the placeholder base schema name used for - .NET Framework compatibility purposes. - - - - - Determines how SQLite handles the transaction journal file. - - - - - Sets the default isolation level for transactions on the connection. - - - - - If enabled, use foreign key constraints - - - - - Gets/Sets the extra behavioral flags. - - - - - If enabled, apply the default connection settings to opened databases. - - - - - If enabled, attempt to resolve the provided data source file name to a - full path before opening. - - - - - SQLite has very limited types, and is inherently text-based. The first 5 types below represent the sum of all types SQLite - understands. The DateTime extension to the spec is for internal use only. - - - - - Not used - - - - - All integers in SQLite default to Int64 - - - - - All floating point numbers in SQLite default to double - - - - - The default data type of SQLite is text - - - - - Typically blob types are only seen when returned from a function - - - - - Null types can be returned from functions - - - - - Used internally by this provider - - - - - Used internally by this provider - - - - - These are the event types associated with the - - delegate (and its corresponding event) and the - class. - - - - - Not used. - - - - - Not used. - - - - - The connection is being opened. - - - - - The connection string has been parsed. - - - - - The connection was opened. - - - - - The method was called on the - connection. - - - - - A transaction was created using the connection. - - - - - The connection was enlisted into a transaction. - - - - - A command was created using the connection. - - - - - A data reader was created using the connection. - - - - - An instance of a derived class has - been created to wrap a native resource. - - - - - The connection is being closed. - - - - - The connection was closed. - - - - - This implementation of SQLite for ADO.NET can process date/time fields in - databases in one of six formats. - - - ISO8601 format is more compatible, readable, fully-processable, but less - accurate as it does not provide time down to fractions of a second. - JulianDay is the numeric format the SQLite uses internally and is arguably - the most compatible with 3rd party tools. It is not readable as text - without post-processing. Ticks less compatible with 3rd party tools that - query the database, and renders the DateTime field unreadable as text - without post-processing. UnixEpoch is more compatible with Unix systems. - InvariantCulture allows the configured format for the invariant culture - format to be used and is human readable. CurrentCulture allows the - configured format for the current culture to be used and is also human - readable. - - The preferred order of choosing a DateTime format is JulianDay, ISO8601, - and then Ticks. Ticks is mainly present for legacy code support. - - - - - Use the value of DateTime.Ticks. This value is not recommended and is not well supported with LINQ. - - - - - Use the ISO-8601 format. Uses the "yyyy-MM-dd HH:mm:ss.FFFFFFFK" format for UTC DateTime values and - "yyyy-MM-dd HH:mm:ss.FFFFFFF" format for local DateTime values). - - - - - The interval of time in days and fractions of a day since January 1, 4713 BC. - - - - - The whole number of seconds since the Unix epoch (January 1, 1970). - - - - - Any culture-independent string value that the .NET Framework can interpret as a valid DateTime. - - - - - Any string value that the .NET Framework can interpret as a valid DateTime using the current culture. - - - - - The default format for this provider. - - - - - This enum determines how SQLite treats its journal file. - - - By default SQLite will create and delete the journal file when needed during a transaction. - However, for some computers running certain filesystem monitoring tools, the rapid - creation and deletion of the journal file can cause those programs to fail, or to interfere with SQLite. - - If a program or virus scanner is interfering with SQLite's journal file, you may receive errors like "unable to open database file" - when starting a transaction. If this is happening, you may want to change the default journal mode to Persist. - - - - - The default mode, this causes SQLite to use the existing journaling mode for the database. - - - - - SQLite will create and destroy the journal file as-needed. - - - - - When this is set, SQLite will keep the journal file even after a transaction has completed. It's contents will be erased, - and the journal re-used as often as needed. If it is deleted, it will be recreated the next time it is needed. - - - - - This option disables the rollback journal entirely. Interrupted transactions or a program crash can cause database - corruption in this mode! - - - - - SQLite will truncate the journal file to zero-length instead of deleting it. - - - - - SQLite will store the journal in volatile RAM. This saves disk I/O but at the expense of database safety and integrity. - If the application using SQLite crashes in the middle of a transaction when the MEMORY journaling mode is set, then the - database file will very likely go corrupt. - - - - - SQLite uses a write-ahead log instead of a rollback journal to implement transactions. The WAL journaling mode is persistent; - after being set it stays in effect across multiple database connections and after closing and reopening the database. A database - in WAL journaling mode can only be accessed by SQLite version 3.7.0 or later. - - - - - Possible values for the "synchronous" database setting. This setting determines - how often the database engine calls the xSync method of the VFS. - - - - - Use the default "synchronous" database setting. Currently, this should be - the same as using the FULL mode. - - - - - The database engine continues without syncing as soon as it has handed - data off to the operating system. If the application running SQLite - crashes, the data will be safe, but the database might become corrupted - if the operating system crashes or the computer loses power before that - data has been written to the disk surface. - - - - - The database engine will still sync at the most critical moments, but - less often than in FULL mode. There is a very small (though non-zero) - chance that a power failure at just the wrong time could corrupt the - database in NORMAL mode. - - - - - The database engine will use the xSync method of the VFS to ensure that - all content is safely written to the disk surface prior to continuing. - This ensures that an operating system crash or power failure will not - corrupt the database. FULL synchronous is very safe, but it is also - slower. - - - - - The requested command execution type. This controls which method of the - object will be called. - - - - - Do nothing. No method will be called. - - - - - The command is not expected to return a result -OR- the result is not - needed. The or - method - will be called. - - - - - The command is expected to return a scalar result -OR- the result should - be limited to a scalar result. The - or method will - be called. - - - - - The command is expected to return result. - The or - method will - be called. - - - - - Use the default command execution type. Using this value is the same - as using the value. - - - - - The action code responsible for the current call into the authorizer. - - - - - No action is being performed. This value should not be used from - external code. - - - - - No longer used. - - - - - An index will be created. The action-specific arguments are the - index name and the table name. - - - - - - A table will be created. The action-specific arguments are the - table name and a null value. - - - - - A temporary index will be created. The action-specific arguments - are the index name and the table name. - - - - - A temporary table will be created. The action-specific arguments - are the table name and a null value. - - - - - A temporary trigger will be created. The action-specific arguments - are the trigger name and the table name. - - - - - A temporary view will be created. The action-specific arguments are - the view name and a null value. - - - - - A trigger will be created. The action-specific arguments are the - trigger name and the table name. - - - - - A view will be created. The action-specific arguments are the view - name and a null value. - - - - - A DELETE statement will be executed. The action-specific arguments - are the table name and a null value. - - - - - An index will be dropped. The action-specific arguments are the - index name and the table name. - - - - - A table will be dropped. The action-specific arguments are the tables - name and a null value. - - - - - A temporary index will be dropped. The action-specific arguments are - the index name and the table name. - - - - - A temporary table will be dropped. The action-specific arguments are - the table name and a null value. - - - - - A temporary trigger will be dropped. The action-specific arguments - are the trigger name and the table name. - - - - - A temporary view will be dropped. The action-specific arguments are - the view name and a null value. - - - - - A trigger will be dropped. The action-specific arguments are the - trigger name and the table name. - - - - - A view will be dropped. The action-specific arguments are the view - name and a null value. - - - - - An INSERT statement will be executed. The action-specific arguments - are the table name and a null value. - - - - - A PRAGMA statement will be executed. The action-specific arguments - are the name of the PRAGMA and the new value or a null value. - - - - - A table column will be read. The action-specific arguments are the - table name and the column name. - - - - - A SELECT statement will be executed. The action-specific arguments - are both null values. - - - - - A transaction will be started, committed, or rolled back. The - action-specific arguments are the name of the operation (BEGIN, - COMMIT, or ROLLBACK) and a null value. - - - - - An UPDATE statement will be executed. The action-specific arguments - are the table name and the column name. - - - - - A database will be attached to the connection. The action-specific - arguments are the database file name and a null value. - - - - - A database will be detached from the connection. The action-specific - arguments are the database name and a null value. - - - - - The schema of a table will be altered. The action-specific arguments - are the database name and the table name. - - - - - An index will be deleted and then recreated. The action-specific - arguments are the index name and a null value. - - - - - A table will be analyzed to gathers statistics about it. The - action-specific arguments are the table name and a null value. - - - - - A virtual table will be created. The action-specific arguments are - the table name and the module name. - - - - - A virtual table will be dropped. The action-specific arguments are - the table name and the module name. - - - - - A SQL function will be called. The action-specific arguments are a - null value and the function name. - - - - - A savepoint will be created, released, or rolled back. The - action-specific arguments are the name of the operation (BEGIN, - RELEASE, or ROLLBACK) and the savepoint name. - - - - - A recursive query will be executed. The action-specific arguments - are two null values. - - - - - The return code for the current call into the authorizer. - - - - - The action will be allowed. - - - - - The overall action will be disallowed and an error message will be - returned from the query preparation method. - - - - - The specific action will be disallowed; however, the overall action - will continue. The exact effects of this return code vary depending - on the specific action, please refer to the SQLite core library - documentation for futher details. - - - - - Class used internally to determine the datatype of a column in a resultset - - - - - The DbType of the column, or DbType.Object if it cannot be determined - - - - - The affinity of a column, used for expressions or when Type is DbType.Object - - - - - SQLite implementation of DbDataAdapter. - - - - - This class is just a shell around the DbDataAdapter. Nothing from - DbDataAdapter is overridden here, just a few constructors are defined. - - - Default constructor. - - - - - Constructs a data adapter using the specified select command. - - - The select command to associate with the adapter. - - - - - Constructs a data adapter with the supplied select command text and - associated with the specified connection. - - - The select command text to associate with the data adapter. - - - The connection to associate with the select command. - - - - - Constructs a data adapter with the specified select command text, - and using the specified database connection string. - - - The select command text to use to construct a select command. - - - A connection string suitable for passing to a new SQLiteConnection, - which is associated with the select command. - - - - - Constructs a data adapter with the specified select command text, - and using the specified database connection string. - - - The select command text to use to construct a select command. - - - A connection string suitable for passing to a new SQLiteConnection, - which is associated with the select command. - - - Non-zero to parse the connection string using the built-in (i.e. - framework provided) parser when opening the connection. - - - - - Raised by the underlying DbDataAdapter when a row is being updated - - The event's specifics - - - - Raised by DbDataAdapter after a row is updated - - The event's specifics - - - - Row updating event handler - - - - - Row updated event handler - - - - - Gets/sets the select command for this DataAdapter - - - - - Gets/sets the insert command for this DataAdapter - - - - - Gets/sets the update command for this DataAdapter - - - - - Gets/sets the delete command for this DataAdapter - - - - - SQLite implementation of DbDataReader. - - - - - Underlying command this reader is attached to - - - - - Index of the current statement in the command being processed - - - - - Current statement being Read() - - - - - State of the current statement being processed. - -1 = First Step() executed, so the first Read() will be ignored - 0 = Actively reading - 1 = Finished reading - 2 = Non-row-returning statement, no records - - - - - Number of records affected by the insert/update statements executed on the command - - - - - Count of fields (columns) in the row-returning statement currently being processed - - - - - Maps the field (column) names to their corresponding indexes within the results. - - - - - Datatypes of active fields (columns) in the current statement, used for type-restricting data - - - - - The behavior of the datareader - - - - - If set, then dispose of the command object when the reader is finished - - - - - If set, then raise an exception when the object is accessed after being disposed. - - - - - An array of rowid's for the active statement if CommandBehavior.KeyInfo is specified - - - - - Matches the version of the connection. - - - - - The "stub" (i.e. placeholder) base schema name to use when returning - column schema information. Matches the base schema name used by the - associated connection. - - - - - Internal constructor, initializes the datareader and sets up to begin executing statements - - The SQLiteCommand this data reader is for - The expected behavior of the data reader - - - - Dispose of all resources used by this datareader. - - - - - - Closes the datareader, potentially closing the connection as well if CommandBehavior.CloseConnection was specified. - - - - - Throw an error if the datareader is closed - - - - - Throw an error if a row is not loaded - - - - - Enumerator support - - Returns a DbEnumerator object. - - - - SQLite is inherently un-typed. All datatypes in SQLite are natively strings. The definition of the columns of a table - and the affinity of returned types are all we have to go on to type-restrict data in the reader. - - This function attempts to verify that the type of data being requested of a column matches the datatype of the column. In - the case of columns that are not backed into a table definition, we attempt to match up the affinity of a column (int, double, string or blob) - to a set of known types that closely match that affinity. It's not an exact science, but its the best we can do. - - - This function throws an InvalidTypeCast() exception if the requested type doesn't match the column's definition or affinity. - - The index of the column to type-check - The type we want to get out of the column - - - - Retrieves the column as a boolean value - - The index of the column to retrieve - bool - - - - Retrieves the column as a single byte value - - The index of the column to retrieve - byte - - - - Retrieves a column as an array of bytes (blob) - - The index of the column to retrieve - The zero-based index of where to begin reading the data - The buffer to write the bytes into - The zero-based index of where to begin writing into the array - The number of bytes to retrieve - The actual number of bytes written into the array - - To determine the number of bytes in the column, pass a null value for the buffer. The total length will be returned. - - - - - Returns the column as a single character - - The index of the column to retrieve - char - - - - Retrieves a column as an array of chars (blob) - - The index of the column to retrieve - The zero-based index of where to begin reading the data - The buffer to write the characters into - The zero-based index of where to begin writing into the array - The number of bytes to retrieve - The actual number of characters written into the array - - To determine the number of characters in the column, pass a null value for the buffer. The total length will be returned. - - - - - Retrieves the name of the back-end datatype of the column - - The index of the column to retrieve - string - - - - Retrieve the column as a date/time value - - The index of the column to retrieve - DateTime - - - - Retrieve the column as a decimal value - - The index of the column to retrieve - decimal - - - - Returns the column as a double - - The index of the column to retrieve - double - - - - Returns the .NET type of a given column - - The index of the column to retrieve - Type - - - - Returns a column as a float value - - The index of the column to retrieve - float - - - - Returns the column as a Guid - - The index of the column to retrieve - Guid - - - - Returns the column as a short - - The index of the column to retrieve - Int16 - - - - Retrieves the column as an int - - The index of the column to retrieve - Int32 - - - - Retrieves the column as a long - - The index of the column to retrieve - Int64 - - - - Retrieves the name of the column - - The index of the column to retrieve - string - - - - Retrieves the i of a column, given its name - - The name of the column to retrieve - The int i of the column - - - - Schema information in SQLite is difficult to map into .NET conventions, so a lot of work must be done - to gather the necessary information so it can be represented in an ADO.NET manner. - - Returns a DataTable containing the schema information for the active SELECT statement being processed. - - - - Retrieves the column as a string - - The index of the column to retrieve - string - - - - Retrieves the column as an object corresponding to the underlying datatype of the column - - The index of the column to retrieve - object - - - - Retreives the values of multiple columns, up to the size of the supplied array - - The array to fill with values from the columns in the current resultset - The number of columns retrieved - - - - Returns a collection containing all the column names and values for the - current row of data in the current resultset, if any. If there is no - current row or no current resultset, an exception may be thrown. - - - The collection containing the column name and value information for the - current row of data in the current resultset or null if this information - cannot be obtained. - - - - - Returns True if the specified column is null - - The index of the column to retrieve - True or False - - - - Moves to the next resultset in multiple row-returning SQL command. - - True if the command was successful and a new resultset is available, False otherwise. - - - - This method attempts to query the database connection associated with - the data reader in use. If the underlying command or connection is - unavailable, a null value will be returned. - - - The connection object -OR- null if it is unavailable. - - - - - This method attempts to query the flags associated with the database - connection in use. If the database connection is disposed, the default - flags will be returned. - - - The data reader containing the databse connection to query the flags from. - - - The connection flags value. - - - - - Retrieves the SQLiteType for a given column, and caches it to avoid repetetive interop calls. - - The index of the column to retrieve - A SQLiteType structure - - - - Reads the next row from the resultset - - True if a new row was successfully loaded and is ready for processing - - - - Not implemented. Returns 0 - - - - - Returns the number of columns in the current resultset - - - - - Returns the number of visible fields in the current resultset - - - - - Returns True if the resultset has rows that can be fetched - - - - - Returns True if the data reader is closed - - - - - Retrieve the count of records affected by an update/insert command. Only valid once the data reader is closed! - - - - - Indexer to retrieve data from a column given its name - - The name of the column to retrieve data for - The value contained in the column - - - - Indexer to retrieve data from a column given its i - - The index of the column to retrieve - The value contained in the column - - - - SQLite exception class. - - - - - Private constructor for use with serialization. - - - Holds the serialized object data about the exception being thrown. - - - Contains contextual information about the source or destination. - - - - - Public constructor for generating a SQLite exception given the error - code and message. - - - The SQLite return code to report. - - - Message text to go along with the return code message text. - - - - - Public constructor that uses the base class constructor for the error - message. - - Error message text. - - - - Public constructor that uses the default base class constructor. - - - - - Public constructor that uses the base class constructor for the error - message and inner exception. - - Error message text. - The original (inner) exception. - - - - Adds extra information to the serialized object data specific to this - class type. This is only used for serialization. - - - Holds the serialized object data about the exception being thrown. - - - Contains contextual information about the source or destination. - - - - - Returns the error message for the specified SQLite return code. - - The SQLite return code. - The error message or null if it cannot be found. - - - - Returns the composite error message based on the SQLite return code - and the optional detailed error message. - - The SQLite return code. - Optional detailed error message. - Error message text for the return code. - - - - Gets the associated SQLite result code for this exception as a - . This property returns the same - underlying value as the property. - - - - - Gets the associated SQLite return code for this exception as an - . For desktop versions of the .NET Framework, - this property overrides the property of the same name within the - - class. This property returns the same underlying value as the - property. - - - - - SQLite error codes. Actually, this enumeration represents a return code, - which may also indicate success in one of several ways (e.g. SQLITE_OK, - SQLITE_ROW, and SQLITE_DONE). Therefore, the name of this enumeration is - something of a misnomer. - - - - - The error code is unknown. This error code - is only used by the managed wrapper itself. - - - - - Successful result - - - - - SQL error or missing database - - - - - Internal logic error in SQLite - - - - - Access permission denied - - - - - Callback routine requested an abort - - - - - The database file is locked - - - - - A table in the database is locked - - - - - A malloc() failed - - - - - Attempt to write a readonly database - - - - - Operation terminated by sqlite3_interrupt() - - - - - Some kind of disk I/O error occurred - - - - - The database disk image is malformed - - - - - Unknown opcode in sqlite3_file_control() - - - - - Insertion failed because database is full - - - - - Unable to open the database file - - - - - Database lock protocol error - - - - - Database is empty - - - - - The database schema changed - - - - - String or BLOB exceeds size limit - - - - - Abort due to constraint violation - - - - - Data type mismatch - - - - - Library used incorrectly - - - - - Uses OS features not supported on host - - - - - Authorization denied - - - - - Auxiliary database format error - - - - - 2nd parameter to sqlite3_bind out of range - - - - - File opened that is not a database file - - - - - Notifications from sqlite3_log() - - - - - Warnings from sqlite3_log() - - - - - sqlite3_step() has another row ready - - - - - sqlite3_step() has finished executing - - - - - Used to mask off extended result codes - - - - - SQLite implementation of . - - - SQLite implementation of . - - - - - Constructs a new instance. - - - - - Static instance member which returns an instanced class. - - - - - Creates and returns a new object. - - The new object. - - - - Creates and returns a new object. - - The new object. - - - - Creates and returns a new object. - - The new object. - - - - Creates and returns a new object. - - The new object. - - - - Creates and returns a new object. - - The new object. - - - - Creates and returns a new object. - - The new object. - - - - Will provide a object in .NET 3.5. - - The class or interface type to query for. - - - - - This event is raised whenever SQLite raises a logging event. - Note that this should be set as one of the first things in the - application. This event is provided for backward compatibility only. - New code should use the class instead. - - - - - This abstract class is designed to handle user-defined functions easily. An instance of the derived class is made for each - connection to the database. - - - Although there is one instance of a class derived from SQLiteFunction per database connection, the derived class has no access - to the underlying connection. This is necessary to deter implementers from thinking it would be a good idea to make database - calls during processing. - - It is important to distinguish between a per-connection instance, and a per-SQL statement context. One instance of this class - services all SQL statements being stepped through on that connection, and there can be many. One should never store per-statement - information in member variables of user-defined function classes. - - For aggregate functions, always create and store your per-statement data in the contextData object on the 1st step. This data will - be automatically freed for you (and Dispose() called if the item supports IDisposable) when the statement completes. - - - - - The base connection this function is attached to - - - - - Internal array used to keep track of aggregate function context data - - - - - The connection flags associated with this object (this should be the - same value as the flags associated with the parent connection object). - - - - - Holds a reference to the callback function for user functions - - - - - Holds a reference to the callbakc function for stepping in an aggregate function - - - - - Holds a reference to the callback function for finalizing an aggregate function - - - - - Holds a reference to the callback function for collation sequences - - - - - Current context of the current callback. Only valid during a callback - - - - - This static list contains all the user-defined functions declared using the proper attributes. - - - - - Internal constructor, initializes the function's internal variables. - - - - - Constructs an instance of this class using the specified data-type - conversion parameters. - - - The DateTime format to be used when converting string values to a - DateTime and binding DateTime parameters. - - - The to be used when creating DateTime - values. - - - The format string to be used when parsing and formatting DateTime - values. - - - Non-zero to create a UTF-16 data-type conversion context; otherwise, - a UTF-8 data-type conversion context will be created. - - - - - Disposes of any active contextData variables that were not automatically cleaned up. Sometimes this can happen if - someone closes the connection while a DataReader is open. - - - - - Placeholder for a user-defined disposal routine - - True if the object is being disposed explicitly - - - - Scalar functions override this method to do their magic. - - - Parameters passed to functions have only an affinity for a certain data type, there is no underlying schema available - to force them into a certain type. Therefore the only types you will ever see as parameters are - DBNull.Value, Int64, Double, String or byte[] array. - - The arguments for the command to process - You may return most simple types as a return value, null or DBNull.Value to return null, DateTime, or - you may return an Exception-derived class if you wish to return an error to SQLite. Do not actually throw the error, - just return it! - - - - Aggregate functions override this method to do their magic. - - - Typically you'll be updating whatever you've placed in the contextData field and returning as quickly as possible. - - The arguments for the command to process - The 1-based step number. This is incrememted each time the step method is called. - A placeholder for implementers to store contextual data pertaining to the current context. - - - - Aggregate functions override this method to finish their aggregate processing. - - - If you implemented your aggregate function properly, - you've been recording and keeping track of your data in the contextData object provided, and now at this stage you should have - all the information you need in there to figure out what to return. - NOTE: It is possible to arrive here without receiving a previous call to Step(), in which case the contextData will - be null. This can happen when no rows were returned. You can either return null, or 0 or some other custom return value - if that is the case. - - Your own assigned contextData, provided for you so you can return your final results. - You may return most simple types as a return value, null or DBNull.Value to return null, DateTime, or - you may return an Exception-derived class if you wish to return an error to SQLite. Do not actually throw the error, - just return it! - - - - - User-defined collation sequences override this method to provide a custom string sorting algorithm. - - The first string to compare - The second strnig to compare - 1 if param1 is greater than param2, 0 if they are equal, or -1 if param1 is less than param2 - - - - Converts an IntPtr array of context arguments to an object array containing the resolved parameters the pointers point to. - - - Parameters passed to functions have only an affinity for a certain data type, there is no underlying schema available - to force them into a certain type. Therefore the only types you will ever see as parameters are - DBNull.Value, Int64, Double, String or byte[] array. - - The number of arguments - A pointer to the array of arguments - An object array of the arguments once they've been converted to .NET values - - - - Takes the return value from Invoke() and Final() and figures out how to return it to SQLite's context. - - The context the return value applies to - The parameter to return to SQLite - - - - Internal scalar callback function, which wraps the raw context pointer and calls the virtual Invoke() method. - WARNING: Must not throw exceptions. - - A raw context pointer - Number of arguments passed in - A pointer to the array of arguments - - - - Internal collation sequence function, which wraps up the raw string pointers and executes the Compare() virtual function. - WARNING: Must not throw exceptions. - - Not used - Length of the string pv1 - Pointer to the first string to compare - Length of the string pv2 - Pointer to the second string to compare - Returns -1 if the first string is less than the second. 0 if they are equal, or 1 if the first string is greater - than the second. Returns 0 if an exception is caught. - - - - Internal collation sequence function, which wraps up the raw string pointers and executes the Compare() virtual function. - WARNING: Must not throw exceptions. - - Not used - Length of the string pv1 - Pointer to the first string to compare - Length of the string pv2 - Pointer to the second string to compare - Returns -1 if the first string is less than the second. 0 if they are equal, or 1 if the first string is greater - than the second. Returns 0 if an exception is caught. - - - - The internal aggregate Step function callback, which wraps the raw context pointer and calls the virtual Step() method. - WARNING: Must not throw exceptions. - - - This function takes care of doing the lookups and getting the important information put together to call the Step() function. - That includes pulling out the user's contextData and updating it after the call is made. We use a sorted list for this so - binary searches can be done to find the data. - - A raw context pointer - Number of arguments passed in - A pointer to the array of arguments - - - - An internal aggregate Final function callback, which wraps the context pointer and calls the virtual Final() method. - WARNING: Must not throw exceptions. - - A raw context pointer - - - - Using reflection, enumerate all assemblies in the current appdomain looking for classes that - have a SQLiteFunctionAttribute attribute, and registering them accordingly. - - - - - Manual method of registering a function. The type must still have the SQLiteFunctionAttributes in order to work - properly, but this is a workaround for the Compact Framework where enumerating assemblies is not currently supported. - - The type of the function to register - - - - Called by SQLiteBase derived classes, this function binds all user-defined functions to a connection. - It is done this way so that all user-defined functions will access the database using the same encoding scheme - as the connection (UTF-8 or UTF-16). - - - The wrapper functions that interop with SQLite will create a unique cookie value, which internally is a pointer to - all the wrapped callback functions. The interop function uses it to map CDecl callbacks to StdCall callbacks. - - The base object on which the functions are to bind - The flags associated with the parent connection object - Returns a logical list of functions which the connection should retain until it is closed. - - - - This function binds a user-defined functions to a connection. - - - The object instance associated with the - that the function should be bound to. - - - The object instance containing - the metadata for the function to be bound. - - - The object instance that implements the - function to be bound. - - - The flags associated with the parent connection object. - - - - - Returns a reference to the underlying connection's SQLiteConvert class, which can be used to convert - strings and DateTime's into the current connection's encoding schema. - - - - - Extends SQLiteFunction and allows an inherited class to obtain the collating sequence associated with a function call. - - - User-defined functions can call the GetCollationSequence() method in this class and use it to compare strings and char arrays. - - - - - Obtains the collating sequence in effect for the given function. - - - - - - The type of user-defined function to declare - - - - - Scalar functions are designed to be called and return a result immediately. Examples include ABS(), Upper(), Lower(), etc. - - - - - Aggregate functions are designed to accumulate data until the end of a call and then return a result gleaned from the accumulated data. - Examples include SUM(), COUNT(), AVG(), etc. - - - - - Collation sequences are used to sort textual data in a custom manner, and appear in an ORDER BY clause. Typically text in an ORDER BY is - sorted using a straight case-insensitive comparison function. Custom collating sequences can be used to alter the behavior of text sorting - in a user-defined manner. - - - - - An internal callback delegate declaration. - - Raw native context pointer for the user function. - Total number of arguments to the user function. - Raw native pointer to the array of raw native argument pointers. - - - - An internal final callback delegate declaration. - - Raw context pointer for the user function - - - - Internal callback delegate for implementing collation sequences - - Not used - Length of the string pv1 - Pointer to the first string to compare - Length of the string pv2 - Pointer to the second string to compare - Returns -1 if the first string is less than the second. 0 if they are equal, or 1 if the first string is greater - than the second. - - - - The type of collating sequence - - - - - The built-in BINARY collating sequence - - - - - The built-in NOCASE collating sequence - - - - - The built-in REVERSE collating sequence - - - - - A custom user-defined collating sequence - - - - - The encoding type the collation sequence uses - - - - - The collation sequence is UTF8 - - - - - The collation sequence is UTF16 little-endian - - - - - The collation sequence is UTF16 big-endian - - - - - A struct describing the collating sequence a function is executing in - - - - - The name of the collating sequence - - - - - The type of collating sequence - - - - - The text encoding of the collation sequence - - - - - Context of the function that requested the collating sequence - - - - - Calls the base collating sequence to compare two strings - - The first string to compare - The second string to compare - -1 if s1 is less than s2, 0 if s1 is equal to s2, and 1 if s1 is greater than s2 - - - - Calls the base collating sequence to compare two character arrays - - The first array to compare - The second array to compare - -1 if c1 is less than c2, 0 if c1 is equal to c2, and 1 if c1 is greater than c2 - - - - A simple custom attribute to enable us to easily find user-defined functions in - the loaded assemblies and initialize them in SQLite as connections are made. - - - - - Default constructor, initializes the internal variables for the function. - - - - - Constructs an instance of this class. - - - The name of the function, as seen by the SQLite core library. - - - The number of arguments that the function will accept. - - - The type of function being declared. This will either be Scalar, - Aggregate, or Collation. - - - - - The function's name as it will be used in SQLite command text. - - - - - The number of arguments this function expects. -1 if the number of arguments is variable. - - - - - The type of function this implementation will be. - - - - - The object instance that describes the class - containing the implementation for the associated function. - - - - - This class provides key info for a given SQLite statement. - - Providing key information for a given statement is non-trivial :( - - - - - - This function does all the nasty work at determining what keys need to be returned for - a given statement. - - - - - - - - Make sure all the subqueries are open and ready and sync'd with the current rowid - of the table they're supporting - - - - - Release any readers on any subqueries - - - - - Append all the columns we've added to the original query to the schema - - - - - - How many additional columns of keyinfo we're holding - - - - - Used to support CommandBehavior.KeyInfo - - - - - A single sub-query for a given table/database. - - - - - Event data for logging event handlers. - - - - - The error code. The type of this object value should be - or . - - - - - SQL statement text as the statement first begins executing - - - - - Extra data associated with this event, if any. - - - - - Constructs the object. - - Should be null. - - The error code. The type of this object value should be - or . - - The error message, if any. - The extra data, if any. - - - - Raised when a log event occurs. - - The current connection - Event arguments of the trace - - - - Manages the SQLite custom logging functionality and the associated - callback for the whole process. - - - - - Object used to synchronize access to the static instance data - for this class. - - - - - Member variable to store the AppDomain.DomainUnload event handler. - - - - - The default log event handler. - - - - - The log callback passed to native SQLite engine. This must live - as long as the SQLite library has a pointer to it. - - - - - The base SQLite object to interop with. - - - - - This will be non-zero if logging is currently enabled. - - - - - Initializes the SQLite logging facilities. - - - - - Handles the AppDomain being unloaded. - - Should be null. - The data associated with this event. - - - - Log a message to all the registered log event handlers without going - through the SQLite library. - - The message to be logged. - - - - Log a message to all the registered log event handlers without going - through the SQLite library. - - The SQLite error code. - The message to be logged. - - - - Log a message to all the registered log event handlers without going - through the SQLite library. - - The integer error code. - The message to be logged. - - - - Log a message to all the registered log event handlers without going - through the SQLite library. - - - The error code. The type of this object value should be - System.Int32 or SQLiteErrorCode. - - The message to be logged. - - - - Creates and initializes the default log event handler. - - - - - Adds the default log event handler to the list of handlers. - - - - - Removes the default log event handler from the list of handlers. - - - - - Internal proxy function that calls any registered application log - event handlers. - - WARNING: This method is used more-or-less directly by native code, - do not modify its type signature. - - - The extra data associated with this message, if any. - - - The error code associated with this message. - - - The message string to be logged. - - - - - Default logger. Currently, uses the Trace class (i.e. sends events - to the current trace listeners, if any). - - Should be null. - The data associated with this event. - - - - Member variable to store the application log handler to call. - - - - - This event is raised whenever SQLite raises a logging event. - Note that this should be set as one of the first things in the - application. - - - - - If this property is true, logging is enabled; otherwise, logging is - disabled. When logging is disabled, no logging events will fire. - - - - - MetaDataCollections specific to SQLite - - - - - Returns a list of databases attached to the connection - - - - - Returns column information for the specified table - - - - - Returns index information for the optionally-specified table - - - - - Returns base columns for the given index - - - - - Returns the tables in the given catalog - - - - - Returns user-defined views in the given catalog - - - - - Returns underlying column information on the given view - - - - - Returns foreign key information for the given catalog - - - - - Returns the triggers on the database - - - - - SQLite implementation of DbParameter. - - - - - The data type of the parameter - - - - - The version information for mapping the parameter - - - - - The value of the data in the parameter - - - - - The source column for the parameter - - - - - The column name - - - - - The data size, unused by SQLite - - - - - Default constructor - - - - - Constructs a named parameter given the specified parameter name - - The parameter name - - - - Constructs a named parameter given the specified parameter name and initial value - - The parameter name - The initial value of the parameter - - - - Constructs a named parameter of the specified type - - The parameter name - The datatype of the parameter - - - - Constructs a named parameter of the specified type and source column reference - - The parameter name - The data type - The source column - - - - Constructs a named parameter of the specified type, source column and row version - - The parameter name - The data type - The source column - The row version information - - - - Constructs an unnamed parameter of the specified data type - - The datatype of the parameter - - - - Constructs an unnamed parameter of the specified data type and sets the initial value - - The datatype of the parameter - The initial value of the parameter - - - - Constructs an unnamed parameter of the specified data type and source column - - The datatype of the parameter - The source column - - - - Constructs an unnamed parameter of the specified data type, source column and row version - - The data type - The source column - The row version information - - - - Constructs a named parameter of the specified type and size - - The parameter name - The data type - The size of the parameter - - - - Constructs a named parameter of the specified type, size and source column - - The name of the parameter - The data type - The size of the parameter - The source column - - - - Constructs a named parameter of the specified type, size, source column and row version - - The name of the parameter - The data type - The size of the parameter - The source column - The row version information - - - - Constructs a named parameter of the specified type, size, source column and row version - - The name of the parameter - The data type - The size of the parameter - Only input parameters are supported in SQLite - Ignored - Ignored - Ignored - The source column - The row version information - The initial value to assign the parameter - - - - Constructs a named parameter, yet another flavor - - The name of the parameter - The data type - The size of the parameter - Only input parameters are supported in SQLite - Ignored - Ignored - The source column - The row version information - Whether or not this parameter is for comparing NULL's - The intial value to assign the parameter - - - - Constructs an unnamed parameter of the specified type and size - - The data type - The size of the parameter - - - - Constructs an unnamed parameter of the specified type, size, and source column - - The data type - The size of the parameter - The source column - - - - Constructs an unnamed parameter of the specified type, size, source column and row version - - The data type - The size of the parameter - The source column - The row version information - - - - Resets the DbType of the parameter so it can be inferred from the value - - - - - Clones a parameter - - A new, unassociated SQLiteParameter - - - - Whether or not the parameter can contain a null value - - - - - Returns the datatype of the parameter - - - - - Supports only input parameters - - - - - Returns the parameter name - - - - - Returns the size of the parameter - - - - - Gets/sets the source column - - - - - Used by DbCommandBuilder to determine the mapping for nullable fields - - - - - Gets and sets the row version - - - - - Gets and sets the parameter value. If no datatype was specified, the datatype will assume the type from the value given. - - - - - SQLite implementation of DbParameterCollection. - - - - - The underlying command to which this collection belongs - - - - - The internal array of parameters in this collection - - - - - Determines whether or not all parameters have been bound to their statement(s) - - - - - Initializes the collection - - The command to which the collection belongs - - - - Retrieves an enumerator for the collection - - An enumerator for the underlying array - - - - Adds a parameter to the collection - - The parameter name - The data type - The size of the value - The source column - A SQLiteParameter object - - - - Adds a parameter to the collection - - The parameter name - The data type - The size of the value - A SQLiteParameter object - - - - Adds a parameter to the collection - - The parameter name - The data type - A SQLiteParameter object - - - - Adds a parameter to the collection - - The parameter to add - A zero-based index of where the parameter is located in the array - - - - Adds a parameter to the collection - - The parameter to add - A zero-based index of where the parameter is located in the array - - - - Adds a named/unnamed parameter and its value to the parameter collection. - - Name of the parameter, or null to indicate an unnamed parameter - The initial value of the parameter - Returns the SQLiteParameter object created during the call. - - - - Adds an array of parameters to the collection - - The array of parameters to add - - - - Adds an array of parameters to the collection - - The array of parameters to add - - - - Clears the array and resets the collection - - - - - Determines if the named parameter exists in the collection - - The name of the parameter to check - True if the parameter is in the collection - - - - Determines if the parameter exists in the collection - - The SQLiteParameter to check - True if the parameter is in the collection - - - - Not implemented - - - - - - - Retrieve a parameter by name from the collection - - The name of the parameter to fetch - A DbParameter object - - - - Retrieves a parameter by its index in the collection - - The index of the parameter to retrieve - A DbParameter object - - - - Returns the index of a parameter given its name - - The name of the parameter to find - -1 if not found, otherwise a zero-based index of the parameter - - - - Returns the index of a parameter - - The parameter to find - -1 if not found, otherwise a zero-based index of the parameter - - - - Inserts a parameter into the array at the specified location - - The zero-based index to insert the parameter at - The parameter to insert - - - - Removes a parameter from the collection - - The parameter to remove - - - - Removes a parameter from the collection given its name - - The name of the parameter to remove - - - - Removes a parameter from the collection given its index - - The zero-based parameter index to remove - - - - Re-assign the named parameter to a new parameter object - - The name of the parameter to replace - The new parameter - - - - Re-assign a parameter at the specified index - - The zero-based index of the parameter to replace - The new parameter - - - - Un-binds all parameters from their statements - - - - - This function attempts to map all parameters in the collection to all statements in a Command. - Since named parameters may span multiple statements, this function makes sure all statements are bound - to the same named parameter. Unnamed parameters are bound in sequence. - - - - - Returns false - - - - - Returns false - - - - - Returns false - - - - - Returns null - - - - - Returns a count of parameters in the collection - - - - - Overloaded to specialize the return value of the default indexer - - Name of the parameter to get/set - The specified named SQLite parameter - - - - Overloaded to specialize the return value of the default indexer - - The index of the parameter to get/set - The specified SQLite parameter - - - - Represents a single SQL statement in SQLite. - - - - - The underlying SQLite object this statement is bound to - - - - - The command text of this SQL statement - - - - - The actual statement pointer - - - - - An index from which unnamed parameters begin - - - - - Names of the parameters as SQLite understands them to be - - - - - Parameters for this statement - - - - - Command this statement belongs to (if any) - - - - - The flags associated with the parent connection object. - - - - - Initializes the statement and attempts to get all information about parameters in the statement - - The base SQLite object - The flags associated with the parent connection object - The statement - The command text for this statement - The previous command in a multi-statement command - - - - Disposes and finalizes the statement - - - - - If the underlying database connection is open, fetches the number of changed rows - resulting from the most recent query; otherwise, does nothing. - - - The number of changes when true is returned. - Undefined if false is returned. - - Non-zero if the number of changed rows was fetched. - - - - Called by SQLiteParameterCollection, this function determines if the specified parameter name belongs to - this statement, and if so, keeps a reference to the parameter so it can be bound later. - - The parameter name to map - The parameter to assign it - - - - Bind all parameters, making sure the caller didn't miss any - - - - - Attempts to convert an arbitrary object to the Boolean data type. - Null object values are converted to false. Throws a SQLiteException - upon failure. - - The object value to convert. - The format provider to use. - The converted boolean value. - - - - Perform the bind operation for an individual parameter - - The index of the parameter to bind - The parameter we're binding - - - - SQLite implementation of DbTransaction. - - - - - The connection to which this transaction is bound - - - - - Constructs the transaction object, binding it to the supplied connection - - The connection to open a transaction on - TRUE to defer the writelock, or FALSE to lock immediately - - - - Disposes the transaction. If it is currently active, any changes are rolled back. - - - - - Commits the current transaction. - - - - - Rolls back the active transaction. - - - - - Returns the underlying connection to which this transaction applies. - - - - - Forwards to the local Connection property - - - - - Gets the isolation level of the transaction. SQLite only supports Serializable transactions. - - - - - A strongly-typed resource class, for looking up localized strings, etc. - - - - - Returns the cached ResourceManager instance used by this class. - - - - - Overrides the current thread's CurrentUICulture property for all - resource lookups using this strongly typed resource class. - - - - - Looks up a localized string similar to <?xml version="1.0" standalone="yes"?> - <DocumentElement> - <DataTypes> - <TypeName>smallint</TypeName> - <ProviderDbType>10</ProviderDbType> - <ColumnSize>5</ColumnSize> - <DataType>System.Int16</DataType> - <CreateFormat>smallint</CreateFormat> - <IsAutoIncrementable>false</IsAutoIncrementable> - <IsCaseSensitive>false</IsCaseSensitive> - <IsFixedLength>true</IsFixedLength> - <IsFixedPrecisionScale>true</IsFixedPrecisionScale> - <IsLong>false</IsLong> - <IsNullable>true</ [rest of string was truncated]";. - - - - - Looks up a localized string similar to ALL,ALTER,AND,AS,AUTOINCREMENT,BETWEEN,BY,CASE,CHECK,COLLATE,COMMIT,CONSTRAINT,CREATE,CROSS,DEFAULT,DEFERRABLE,DELETE,DISTINCT,DROP,ELSE,ESCAPE,EXCEPT,FOREIGN,FROM,FULL,GROUP,HAVING,IN,INDEX,INNER,INSERT,INTERSECT,INTO,IS,ISNULL,JOIN,LEFT,LIMIT,NATURAL,NOT,NOTNULL,NULL,ON,OR,ORDER,OUTER,PRIMARY,REFERENCES,RIGHT,ROLLBACK,SELECT,SET,TABLE,THEN,TO,TRANSACTION,UNION,UNIQUE,UPDATE,USING,VALUES,WHEN,WHERE. - - - - - Looks up a localized string similar to <?xml version="1.0" encoding="utf-8" ?> - <DocumentElement> - <MetaDataCollections> - <CollectionName>MetaDataCollections</CollectionName> - <NumberOfRestrictions>0</NumberOfRestrictions> - <NumberOfIdentifierParts>0</NumberOfIdentifierParts> - </MetaDataCollections> - <MetaDataCollections> - <CollectionName>DataSourceInformation</CollectionName> - <NumberOfRestrictions>0</NumberOfRestrictions> - <NumberOfIdentifierParts>0</NumberOfIdentifierParts> - </MetaDataCollections> - <MetaDataC [rest of string was truncated]";. - - - - - The file extension used for dynamic link libraries. - - - - - The file extension used for the XML configuration file. - - - - - This is the name of the XML configuration file specific to the - System.Data.SQLite assembly. - - - - - This lock is used to protect the static _SQLiteNativeModuleFileName, - _SQLiteNativeModuleHandle, and processorArchitecturePlatforms fields. - - - - - This dictionary stores the mappings between processor architecture - names and platform names. These mappings are now used for two - purposes. First, they are used to determine if the assembly code - base should be used instead of the location, based upon whether one - or more of the named sub-directories exist within the assembly code - base. Second, they are used to assist in loading the appropriate - SQLite interop assembly into the current process. - - - - - For now, this method simply calls the Initialize method. - - - - - Attempts to initialize this class by pre-loading the native SQLite - library for the processor architecture of the current process. - - - - - Queries and returns the XML configuration file name for the assembly - containing the managed System.Data.SQLite components. - - - The XML configuration file name -OR- null if it cannot be determined - or does not exist. - - - - - Queries and returns the value of the specified setting, using the XML - configuration file and/or the environment variables for the current - process and/or the current system, when available. - - - The name of the setting. - - - The value to be returned if the setting has not been set explicitly - or cannot be determined. - - - The value of the setting -OR- the default value specified by - if it has not been set explicitly or - cannot be determined. By default, all references to existing - environment variables will be expanded to their corresponding values - within the value to be returned unless either the "No_Expand" or - "No_Expand_" environment variable is set [to - anything]. - - - - - Queries and returns the directory for the assembly currently being - executed. - - - The directory for the assembly currently being executed -OR- null if - it cannot be determined. - - - - - The name of the environment variable containing the processor - architecture of the current process. - - - - - This is the P/Invoke method that wraps the native Win32 LoadLibrary - function. See the MSDN documentation for full details on what it - does. - - - The name of the executable library. - - - The native module handle upon success -OR- IntPtr.Zero on failure. - - - - - The native module file name for the native SQLite library or null. - - - - - The native module handle for the native SQLite library or the value - IntPtr.Zero. - - - - - Searches for the native SQLite library in the directory containing - the assembly currently being executed as well as the base directory - for the current application domain. - - - Upon success, this parameter will be modified to refer to the base - directory containing the native SQLite library. - - - Upon success, this parameter will be modified to refer to the name - of the immediate directory (i.e. the offset from the base directory) - containing the native SQLite library. - - - Non-zero (success) if the native SQLite library was found; otherwise, - zero (failure). - - - - - Queries and returns the base directory of the current application - domain. - - - The base directory for the current application domain -OR- null if it - cannot be determined. - - - - - Determines if the dynamic link library file name requires a suffix - and adds it if necessary. - - - The original dynamic link library file name to inspect. - - - The dynamic link library file name, possibly modified to include an - extension. - - - - - Queries and returns the processor architecture of the current - process. - - - The processor architecture of the current process -OR- null if it - cannot be determined. - - - - - Given the processor architecture, returns the name of the platform. - - - The processor architecture to be translated to a platform name. - - - The platform name for the specified processor architecture -OR- null - if it cannot be determined. - - - - - Attempts to load the native SQLite library based on the specified - directory and processor architecture. - - - The base directory to use, null for default (the base directory of - the current application domain). This directory should contain the - processor architecture specific sub-directories. - - - The requested processor architecture, null for default (the - processor architecture of the current process). This caller should - almost always specify null for this parameter. - - - The candidate native module file name to load will be stored here, - if necessary. - - - The native module handle as returned by LoadLibrary will be stored - here, if necessary. This value will be IntPtr.Zero if the call to - LoadLibrary fails. - - - Non-zero if the native module was loaded successfully; otherwise, - zero. - - - - - This class represents a context from the SQLite core library that can - be passed to the sqlite3_result_*() and associated functions. - - - - - This interface represents a native handle provided by the SQLite core - library. - - - - - The native handle value. - - - - - The native context handle. - - - - - Constructs an instance of this class using the specified native - context handle. - - - The native context handle to use. - - - - - Sets the context result to NULL. - - - - - Sets the context result to the specified - value. - - - The value to use. - - - - - Sets the context result to the specified - value. - - - The value to use. - - - - - Sets the context result to the specified - value. - - - The value to use. - - - - - Sets the context result to the specified - value. - - - The value to use. This value will be - converted to the UTF-8 encoding prior to being used. - - - - - Sets the context result to the specified - value containing an error message. - - - The value containing the error message text. - This value will be converted to the UTF-8 encoding prior to being - used. - - - - - Sets the context result to the specified - value. - - - The value to use. - - - - - Sets the context result to contain the error code SQLITE_TOOBIG. - - - - - Sets the context result to contain the error code SQLITE_NOMEM. - - - - - Sets the context result to the specified array - value. - - - The array value to use. - - - - - Sets the context result to a BLOB of zeros of the specified size. - - - The number of zero bytes to use for the BLOB context result. - - - - - Sets the context result to the specified . - - - The to use. - - - - - Returns the underlying SQLite native handle associated with this - object instance. - - - - - This class represents a value from the SQLite core library that can be - passed to the sqlite3_value_*() and associated functions. - - - - - The native value handle. - - - - - Constructs an instance of this class using the specified native - value handle. - - - The native value handle to use. - - - - - Invalidates the native value handle, thereby preventing further - access to it from this object instance. - - - - - Converts a logical array of native pointers to native sqlite3_value - structures into a managed array of - object instances. - - - The number of elements in the logical array of native sqlite3_value - structures. - - - The native pointer to the logical array of native sqlite3_value - structures to convert. - - - The managed array of object instances or - null upon failure. - - - - - Gets and returns the type affinity associated with this value. - - - The type affinity associated with this value. - - - - - Gets and returns the number of bytes associated with this value, if - it refers to a UTF-8 encoded string. - - - The number of bytes associated with this value. The returned value - may be zero. - - - - - Gets and returns the associated with this - value. - - - The associated with this value. - - - - - Gets and returns the associated with - this value. - - - The associated with this value. - - - - - Gets and returns the associated with this - value. - - - The associated with this value. - - - - - Gets and returns the associated with this - value. - - - The associated with this value. The value is - converted from the UTF-8 encoding prior to being returned. - - - - - Gets and returns the array associated with this - value. - - - The array associated with this value. - - - - - Uses the native value handle to obtain and store the managed value - for this object instance, thus saving it for later use. The type - of the managed value is determined by the type affinity of the - native value. If the type affinity is not recognized by this - method, no work is done and false is returned. - - - Non-zero if the native value was persisted successfully. - - - - - Returns the underlying SQLite native handle associated with this - object instance. - - - - - Returns non-zero if the native SQLite value has been successfully - persisted as a managed value within this object instance (i.e. the - property may then be read successfully). - - - - - If the managed value for this object instance is available (i.e. it - has been previously persisted via the ) method, - that value is returned; otherwise, an exception is thrown. The - returned value may be null. - - - - - These are the allowed values for the operators that are part of a - constraint term in the WHERE clause of a query that uses a virtual - table. - - - - - This value represents the equality operator. - - - - - This value represents the greater than operator. - - - - - This value represents the less than or equal to operator. - - - - - This value represents the less than operator. - - - - - This value represents the greater than or equal to operator. - - - - - This value represents the MATCH operator. - - - - - This class represents the native sqlite3_index_constraint structure - from the SQLite core library. - - - - - Constructs an instance of this class using the specified native - sqlite3_index_constraint structure. - - - The native sqlite3_index_constraint structure to use. - - - - - Constructs an instance of this class using the specified field - values. - - - Column on left-hand side of constraint. - - - Constraint operator (). - - - True if this constraint is usable. - - - Used internally - - should ignore. - - - - - Column on left-hand side of constraint. - - - - - Constraint operator (). - - - - - True if this constraint is usable. - - - - - Used internally - - should ignore. - - - - - This class represents the native sqlite3_index_orderby structure from - the SQLite core library. - - - - - Constructs an instance of this class using the specified native - sqlite3_index_orderby structure. - - - The native sqlite3_index_orderby structure to use. - - - - - Constructs an instance of this class using the specified field - values. - - - Column number. - - - True for DESC. False for ASC. - - - - - Column number. - - - - - True for DESC. False for ASC. - - - - - This class represents the native sqlite3_index_constraint_usage - structure from the SQLite core library. - - - - - Constructs an instance of this class using the specified native - sqlite3_index_constraint_usage structure. - - - The native sqlite3_index_constraint_usage structure to use. - - - - - Constructs an instance of this class using the specified field - values. - - - If greater than 0, constraint is part of argv to xFilter. - - - Do not code a test for this constraint. - - - - - If greater than 0, constraint is part of argv to xFilter. - - - - - Do not code a test for this constraint. - - - - - This class represents the various inputs provided by the SQLite core - library to the method. - - - - - Constructs an instance of this class. - - - The number of instances to - pre-allocate space for. - - - The number of instances to - pre-allocate space for. - - - - - An array of object instances, - each containing information supplied by the SQLite core library. - - - - - An array of object instances, - each containing information supplied by the SQLite core library. - - - - - This class represents the various outputs provided to the SQLite core - library by the method. - - - - - Constructs an instance of this class. - - - The number of instances - to pre-allocate space for. - - - - - Determines if the native estimatedRows field can be used, based on - the available version of the SQLite core library. - - - Non-zero if the property is supported - by the SQLite core library. - - - - - An array of object - instances, each containing information to be supplied to the SQLite - core library. - - - - - Number used to help identify the selected index. This value will - later be provided to the - method. - - - - - String used to help identify the selected index. This value will - later be provided to the - method. - - - - - Non-zero if the index string must be freed by the SQLite core - library. - - - - - True if output is already ordered. - - - - - Estimated cost of using this index. Using a null value here - indicates that a default estimated cost value should be used. - - - - - Estimated number of rows returned. Using a null value here - indicates that a default estimated rows value should be used. - - - - - This class represents the various inputs and outputs used with the - method. - - - - - Constructs an instance of this class. - - - The number of (and - ) instances to - pre-allocate space for. - - - The number of instances to - pre-allocate space for. - - - - - Converts a native pointer to a native sqlite3_index_info structure - into a new object instance. - - - The native pointer to the native sqlite3_index_info structure to - convert. - - - Upon success, this parameter will be modified to contain the newly - created object instance. - - - - - Populates the outputs of a pre-allocated native sqlite3_index_info - structure using an existing object - instance. - - - The existing object instance containing - the output data to use. - - - The native pointer to the pre-allocated native sqlite3_index_info - structure. - - - - - The object instance containing - the inputs to the - method. - - - - - The object instance containing - the outputs from the - method. - - - - - This class represents a managed virtual table implementation. It is - not sealed and should be used as the base class for any user-defined - virtual table classes implemented in managed code. - - - - - The index within the array of strings provided to the - and - methods containing the - name of the module implementing this virtual table. - - - - - The index within the array of strings provided to the - and - methods containing the - name of the database containing this virtual table. - - - - - The index within the array of strings provided to the - and - methods containing the - name of the virtual table. - - - - - Constructs an instance of this class. - - - The original array of strings provided to the - and - methods. - - - - - This method should normally be used by the - method in order to - perform index selection based on the constraints provided by the - SQLite core library. - - - The object instance containing all the - data for the inputs and outputs relating to index selection. - - - Non-zero upon success. - - - - - Attempts to record the renaming of the virtual table associated - with this object instance. - - - The new name for the virtual table. - - - Non-zero upon success. - - - - - Disposes of this object instance. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is being called - from the finalizer. - - - - - Finalizes this object instance. - - - - - The original array of strings provided to the - and - methods. - - - - - The name of the module implementing this virtual table. - - - - - The name of the database containing this virtual table. - - - - - The name of the virtual table. - - - - - The object instance containing all the - data for the inputs and outputs relating to the most recent index - selection. - - - - - Returns the underlying SQLite native handle associated with this - object instance. - - - - - This class represents a managed virtual table cursor implementation. - It is not sealed and should be used as the base class for any - user-defined virtual table cursor classes implemented in managed code. - - - - - This value represents an invalid integer row sequence number. - - - - - The field holds the integer row sequence number for the current row - pointed to by this cursor object instance. - - - - - Constructs an instance of this class. - - - The object instance associated - with this object instance. - - - - - Constructs an instance of this class. - - - - - Attempts to persist the specified object - instances in order to make them available after the - method returns. - - - The array of object instances to be - persisted. - - - The number of object instances that were - successfully persisted. - - - - - This method should normally be used by the - method in order to - perform filtering of the result rows and/or to record the filtering - criteria provided by the SQLite core library. - - - Number used to help identify the selected index. - - - String used to help identify the selected index. - - - The values corresponding to each column in the selected index. - - - - - Determines the integer row sequence number for the current row. - - - The integer row sequence number for the current row -OR- zero if - it cannot be determined. - - - - - Adjusts the integer row sequence number so that it refers to the - next row. - - - - - Disposes of this object instance. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is being called - from the finalizer. - - - - - Finalizes this object instance. - - - - - The object instance associated - with this object instance. - - - - - Number used to help identify the selected index. This value will - be set via the method. - - - - - String used to help identify the selected index. This value will - be set via the method. - - - - - The values used to filter the rows returned via this cursor object - instance. This value will be set via the - method. - - - - - Returns the underlying SQLite native handle associated with this - object instance. - - - - - This interface represents a virtual table implementation written in - native code. - - - - - - This method is called to create a new instance of a virtual table - in response to a CREATE VIRTUAL TABLE statement. The db parameter - is a pointer to the SQLite database connection that is executing - the CREATE VIRTUAL TABLE statement. The pAux argument is the copy - of the client data pointer that was the fourth argument to the - sqlite3_create_module() or sqlite3_create_module_v2() call that - registered the virtual table module. The argv parameter is an - array of argc pointers to null terminated strings. The first - string, argv[0], is the name of the module being invoked. The - module name is the name provided as the second argument to - sqlite3_create_module() and as the argument to the USING clause of - the CREATE VIRTUAL TABLE statement that is running. The second, - argv[1], is the name of the database in which the new virtual table - is being created. The database name is "main" for the primary - database, or "temp" for TEMP database, or the name given at the - end of the ATTACH statement for attached databases. The third - element of the array, argv[2], is the name of the new virtual - table, as specified following the TABLE keyword in the CREATE - VIRTUAL TABLE statement. If present, the fourth and subsequent - strings in the argv[] array report the arguments to the module name - in the CREATE VIRTUAL TABLE statement. - - - The job of this method is to construct the new virtual table object - (an sqlite3_vtab object) and return a pointer to it in *ppVTab. - - - As part of the task of creating a new sqlite3_vtab structure, this - method must invoke sqlite3_declare_vtab() to tell the SQLite core - about the columns and datatypes in the virtual table. The - sqlite3_declare_vtab() API has the following prototype: - - - - int sqlite3_declare_vtab(sqlite3 *db, const char *zCreateTable) - - - - The first argument to sqlite3_declare_vtab() must be the same - database connection pointer as the first parameter to this method. - The second argument to sqlite3_declare_vtab() must a - zero-terminated UTF-8 string that contains a well-formed CREATE - TABLE statement that defines the columns in the virtual table and - their data types. The name of the table in this CREATE TABLE - statement is ignored, as are all constraints. Only the column names - and datatypes matter. The CREATE TABLE statement string need not to - be held in persistent memory. The string can be deallocated and/or - reused as soon as the sqlite3_declare_vtab() routine returns. - - - - The native database connection handle. - - - The original native pointer value that was provided to the - sqlite3_create_module(), sqlite3_create_module_v2() or - sqlite3_create_disposable_module() functions. - - - The number of arguments from the CREATE VIRTUAL TABLE statement. - - - The array of string arguments from the CREATE VIRTUAL TABLE - statement. - - - Upon success, this parameter must be modified to point to the newly - created native sqlite3_vtab derived structure. - - - Upon failure, this parameter must be modified to point to the error - message, with the underlying memory having been obtained from the - sqlite3_malloc() function. - - - A standard SQLite return code. - - - - - - The xConnect method is very similar to xCreate. It has the same - parameters and constructs a new sqlite3_vtab structure just like - xCreate. And it must also call sqlite3_declare_vtab() like xCreate. - - - The difference is that xConnect is called to establish a new - connection to an existing virtual table whereas xCreate is called - to create a new virtual table from scratch. - - - The xCreate and xConnect methods are only different when the - virtual table has some kind of backing store that must be - initialized the first time the virtual table is created. The - xCreate method creates and initializes the backing store. The - xConnect method just connects to an existing backing store. - - - As an example, consider a virtual table implementation that - provides read-only access to existing comma-separated-value (CSV) - files on disk. There is no backing store that needs to be created - or initialized for such a virtual table (since the CSV files - already exist on disk) so the xCreate and xConnect methods will be - identical for that module. - - - Another example is a virtual table that implements a full-text - index. The xCreate method must create and initialize data - structures to hold the dictionary and posting lists for that index. - The xConnect method, on the other hand, only has to locate and use - an existing dictionary and posting lists that were created by a - prior xCreate call. - - - The xConnect method must return SQLITE_OK if it is successful in - creating the new virtual table, or SQLITE_ERROR if it is not - successful. If not successful, the sqlite3_vtab structure must not - be allocated. An error message may optionally be returned in *pzErr - if unsuccessful. Space to hold the error message string must be - allocated using an SQLite memory allocation function like - sqlite3_malloc() or sqlite3_mprintf() as the SQLite core will - attempt to free the space using sqlite3_free() after the error has - been reported up to the application. - - - The xConnect method is required for every virtual table - implementation, though the xCreate and xConnect pointers of the - sqlite3_module object may point to the same function the virtual - table does not need to initialize backing store. - - - - The native database connection handle. - - - The original native pointer value that was provided to the - sqlite3_create_module(), sqlite3_create_module_v2() or - sqlite3_create_disposable_module() functions. - - - The number of arguments from the CREATE VIRTUAL TABLE statement. - - - The array of string arguments from the CREATE VIRTUAL TABLE - statement. - - - Upon success, this parameter must be modified to point to the newly - created native sqlite3_vtab derived structure. - - - Upon failure, this parameter must be modified to point to the error - message, with the underlying memory having been obtained from the - sqlite3_malloc() function. - - - A standard SQLite return code. - - - - - - SQLite uses the xBestIndex method of a virtual table module to - determine the best way to access the virtual table. The xBestIndex - method has a prototype like this: - - - int (*xBestIndex)(sqlite3_vtab *pVTab, sqlite3_index_info*); - - - The SQLite core communicates with the xBestIndex method by filling - in certain fields of the sqlite3_index_info structure and passing a - pointer to that structure into xBestIndex as the second parameter. - The xBestIndex method fills out other fields of this structure - which forms the reply. The sqlite3_index_info structure looks like - this: - - - struct sqlite3_index_info { - /* Inputs */ - const int nConstraint; /* Number of entries in aConstraint */ - const struct sqlite3_index_constraint { - int iColumn; /* Column on left-hand side of - * constraint */ - unsigned char op; /* Constraint operator */ - unsigned char usable; /* True if this constraint is usable */ - int iTermOffset; /* Used internally - xBestIndex should - * ignore */ - } *const aConstraint; /* Table of WHERE clause constraints */ - const int nOrderBy; /* Number of terms in the ORDER BY - * clause */ - const struct sqlite3_index_orderby { - int iColumn; /* Column number */ - unsigned char desc; /* True for DESC. False for ASC. */ - } *const aOrderBy; /* The ORDER BY clause */ - /* Outputs */ - struct sqlite3_index_constraint_usage { - int argvIndex; /* if greater than zero, constraint is - * part of argv to xFilter */ - unsigned char omit; /* Do not code a test for this - * constraint */ - } *const aConstraintUsage; - int idxNum; /* Number used to identify the index */ - char *idxStr; /* String, possibly obtained from - * sqlite3_malloc() */ - int needToFreeIdxStr; /* Free idxStr using sqlite3_free() if - * true */ - int orderByConsumed; /* True if output is already ordered */ - double estimatedCost; /* Estimated cost of using this index */ - }; - - - In addition, there are some defined constants: - - - #define SQLITE_INDEX_CONSTRAINT_EQ 2 - #define SQLITE_INDEX_CONSTRAINT_GT 4 - #define SQLITE_INDEX_CONSTRAINT_LE 8 - #define SQLITE_INDEX_CONSTRAINT_LT 16 - #define SQLITE_INDEX_CONSTRAINT_GE 32 - #define SQLITE_INDEX_CONSTRAINT_MATCH 64 - - - The SQLite core calls the xBestIndex method when it is compiling a - query that involves a virtual table. In other words, SQLite calls - this method when it is running sqlite3_prepare() or the equivalent. - By calling this method, the SQLite core is saying to the virtual - table that it needs to access some subset of the rows in the - virtual table and it wants to know the most efficient way to do - that access. The xBestIndex method replies with information that - the SQLite core can then use to conduct an efficient search of the - virtual table. - - - While compiling a single SQL query, the SQLite core might call - xBestIndex multiple times with different settings in - sqlite3_index_info. The SQLite core will then select the - combination that appears to give the best performance. - - - Before calling this method, the SQLite core initializes an instance - of the sqlite3_index_info structure with information about the - query that it is currently trying to process. This information - derives mainly from the WHERE clause and ORDER BY or GROUP BY - clauses of the query, but also from any ON or USING clauses if the - query is a join. The information that the SQLite core provides to - the xBestIndex method is held in the part of the structure that is - marked as "Inputs". The "Outputs" section is initialized to zero. - - - The information in the sqlite3_index_info structure is ephemeral - and may be overwritten or deallocated as soon as the xBestIndex - method returns. If the xBestIndex method needs to remember any part - of the sqlite3_index_info structure, it should make a copy. Care - must be take to store the copy in a place where it will be - deallocated, such as in the idxStr field with needToFreeIdxStr set - to 1. - - - Note that xBestIndex will always be called before xFilter, since - the idxNum and idxStr outputs from xBestIndex are required inputs - to xFilter. However, there is no guarantee that xFilter will be - called following a successful xBestIndex. - - - The xBestIndex method is required for every virtual table - implementation. - - - 2.3.1 Inputs - - - The main thing that the SQLite core is trying to communicate to the - virtual table is the constraints that are available to limit the - number of rows that need to be searched. The aConstraint[] array - contains one entry for each constraint. There will be exactly - nConstraint entries in that array. - - - Each constraint will correspond to a term in the WHERE clause or in - a USING or ON clause that is of the form - - - column OP EXPR - - - Where "column" is a column in the virtual table, OP is an operator - like "=" or "<", and EXPR is an arbitrary expression. So, for - example, if the WHERE clause contained a term like this: - - - a = 5 - - - Then one of the constraints would be on the "a" column with - operator "=" and an expression of "5". Constraints need not have a - literal representation of the WHERE clause. The query optimizer - might make transformations to the WHERE clause in order to extract - as many constraints as it can. So, for example, if the WHERE clause - contained something like this: - - - x BETWEEN 10 AND 100 AND 999>y - - - The query optimizer might translate this into three separate - constraints: - - - x >= 10 - x <= 100 - y < 999 - - - For each constraint, the aConstraint[].iColumn field indicates - which column appears on the left-hand side of the constraint. The - first column of the virtual table is column 0. The rowid of the - virtual table is column -1. The aConstraint[].op field indicates - which operator is used. The SQLITE_INDEX_CONSTRAINT_* constants map - integer constants into operator values. Columns occur in the order - they were defined by the call to sqlite3_declare_vtab() in the - xCreate or xConnect method. Hidden columns are counted when - determining the column index. - - - The aConstraint[] array contains information about all constraints - that apply to the virtual table. But some of the constraints might - not be usable because of the way tables are ordered in a join. The - xBestIndex method must therefore only consider constraints that - have an aConstraint[].usable flag which is true. - - - In addition to WHERE clause constraints, the SQLite core also tells - the xBestIndex method about the ORDER BY clause. (In an aggregate - query, the SQLite core might put in GROUP BY clause information in - place of the ORDER BY clause information, but this fact should not - make any difference to the xBestIndex method.) If all terms of the - ORDER BY clause are columns in the virtual table, then nOrderBy - will be the number of terms in the ORDER BY clause and the - aOrderBy[] array will identify the column for each term in the - order by clause and whether or not that column is ASC or DESC. - - - 2.3.2 Outputs - - - Given all of the information above, the job of the xBestIndex - method it to figure out the best way to search the virtual table. - - - The xBestIndex method fills the idxNum and idxStr fields with - information that communicates an indexing strategy to the xFilter - method. The information in idxNum and idxStr is arbitrary as far as - the SQLite core is concerned. The SQLite core just copies the - information through to the xFilter method. Any desired meaning can - be assigned to idxNum and idxStr as long as xBestIndex and xFilter - agree on what that meaning is. - - - The idxStr value may be a string obtained from an SQLite memory - allocation function such as sqlite3_mprintf(). If this is the case, - then the needToFreeIdxStr flag must be set to true so that the - SQLite core will know to call sqlite3_free() on that string when it - has finished with it, and thus avoid a memory leak. - - - If the virtual table will output rows in the order specified by the - ORDER BY clause, then the orderByConsumed flag may be set to true. - If the output is not automatically in the correct order then - orderByConsumed must be left in its default false setting. This - will indicate to the SQLite core that it will need to do a separate - sorting pass over the data after it comes out of the virtual table. - - - The estimatedCost field should be set to the estimated number of - disk access operations required to execute this query against the - virtual table. The SQLite core will often call xBestIndex multiple - times with different constraints, obtain multiple cost estimates, - then choose the query plan that gives the lowest estimate. - - - The aConstraintUsage[] array contains one element for each of the - nConstraint constraints in the inputs section of the - sqlite3_index_info structure. The aConstraintUsage[] array is used - by xBestIndex to tell the core how it is using the constraints. - - - The xBestIndex method may set aConstraintUsage[].argvIndex entries - to values greater than one. Exactly one entry should be set to 1, - another to 2, another to 3, and so forth up to as many or as few as - the xBestIndex method wants. The EXPR of the corresponding - constraints will then be passed in as the argv[] parameters to - xFilter. - - - For example, if the aConstraint[3].argvIndex is set to 1, then when - xFilter is called, the argv[0] passed to xFilter will have the EXPR - value of the aConstraint[3] constraint. - - - By default, the SQLite core double checks all constraints on each - row of the virtual table that it receives. If such a check is - redundant, the xBestFilter method can suppress that double-check by - setting aConstraintUsage[].omit. - - - - The native pointer to the sqlite3_vtab derived structure. - - - The native pointer to the sqlite3_index_info structure. - - - A standard SQLite return code. - - - - - - This method releases a connection to a virtual table. Only the - sqlite3_vtab object is destroyed. The virtual table is not - destroyed and any backing store associated with the virtual table - persists. This method undoes the work of xConnect. - - - This method is a destructor for a connection to the virtual table. - Contrast this method with xDestroy. The xDestroy is a destructor - for the entire virtual table. - - - The xDisconnect method is required for every virtual table - implementation, though it is acceptable for the xDisconnect and - xDestroy methods to be the same function if that makes sense for - the particular virtual table. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - This method releases a connection to a virtual table, just like the - xDisconnect method, and it also destroys the underlying table - implementation. This method undoes the work of xCreate. - - - The xDisconnect method is called whenever a database connection - that uses a virtual table is closed. The xDestroy method is only - called when a DROP TABLE statement is executed against the virtual - table. - - - The xDestroy method is required for every virtual table - implementation, though it is acceptable for the xDisconnect and - xDestroy methods to be the same function if that makes sense for - the particular virtual table. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - The xOpen method creates a new cursor used for accessing (read - and/or writing) a virtual table. A successful invocation of this - method will allocate the memory for the sqlite3_vtab_cursor (or a - subclass), initialize the new object, and make *ppCursor point to - the new object. The successful call then returns SQLITE_OK. - - - For every successful call to this method, the SQLite core will - later invoke the xClose method to destroy the allocated cursor. - - - The xOpen method need not initialize the pVtab field of the - sqlite3_vtab_cursor structure. The SQLite core will take care of - that chore automatically. - - - A virtual table implementation must be able to support an arbitrary - number of simultaneously open cursors. - - - When initially opened, the cursor is in an undefined state. The - SQLite core will invoke the xFilter method on the cursor prior to - any attempt to position or read from the cursor. - - - The xOpen method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab derived structure. - - - Upon success, this parameter must be modified to point to the newly - created native sqlite3_vtab_cursor derived structure. - - - A standard SQLite return code. - - - - - - The xClose method closes a cursor previously opened by xOpen. The - SQLite core will always call xClose once for each cursor opened - using xOpen. - - - This method must release all resources allocated by the - corresponding xOpen call. The routine will not be called again even - if it returns an error. The SQLite core will not use the - sqlite3_vtab_cursor again after it has been closed. - - - The xClose method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - A standard SQLite return code. - - - - - - This method begins a search of a virtual table. The first argument - is a cursor opened by xOpen. The next two argument define a - particular search index previously chosen by xBestIndex. The - specific meanings of idxNum and idxStr are unimportant as long as - xFilter and xBestIndex agree on what that meaning is. - - - The xBestIndex function may have requested the values of certain - expressions using the aConstraintUsage[].argvIndex values of the - sqlite3_index_info structure. Those values are passed to xFilter - using the argc and argv parameters. - - - If the virtual table contains one or more rows that match the - search criteria, then the cursor must be left point at the first - row. Subsequent calls to xEof must return false (zero). If there - are no rows match, then the cursor must be left in a state that - will cause the xEof to return true (non-zero). The SQLite engine - will use the xColumn and xRowid methods to access that row content. - The xNext method will be used to advance to the next row. - - - This method must return SQLITE_OK if successful, or an sqlite error - code if an error occurs. - - - The xFilter method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - Number used to help identify the selected index. - - - The native pointer to the UTF-8 encoded string containing the - string used to help identify the selected index. - - - The number of native pointers to sqlite3_value structures specified - in . - - - An array of native pointers to sqlite3_value structures containing - filtering criteria for the selected index. - - - A standard SQLite return code. - - - - - - The xNext method advances a virtual table cursor to the next row of - a result set initiated by xFilter. If the cursor is already - pointing at the last row when this routine is called, then the - cursor no longer points to valid data and a subsequent call to the - xEof method must return true (non-zero). If the cursor is - successfully advanced to another row of content, then subsequent - calls to xEof must return false (zero). - - - This method must return SQLITE_OK if successful, or an sqlite error - code if an error occurs. - - - The xNext method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - A standard SQLite return code. - - - - - - The xEof method must return false (zero) if the specified cursor - currently points to a valid row of data, or true (non-zero) - otherwise. This method is called by the SQL engine immediately - after each xFilter and xNext invocation. - - - The xEof method is required for every virtual table implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - Non-zero if no more rows are available; zero otherwise. - - - - - - The SQLite core invokes this method in order to find the value for - the N-th column of the current row. N is zero-based so the first - column is numbered 0. The xColumn method may return its result back - to SQLite using one of the following interface: - - - sqlite3_result_blob() - sqlite3_result_double() - sqlite3_result_int() - sqlite3_result_int64() - sqlite3_result_null() - sqlite3_result_text() - sqlite3_result_text16() - sqlite3_result_text16le() - sqlite3_result_text16be() - sqlite3_result_zeroblob() - - - If the xColumn method implementation calls none of the functions - above, then the value of the column defaults to an SQL NULL. - - - To raise an error, the xColumn method should use one of the - result_text() methods to set the error message text, then return an - appropriate error code. The xColumn method must return SQLITE_OK on - success. - - - The xColumn method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - The native pointer to the sqlite3_context structure to be used - for returning the specified column value to the SQLite core - library. - - - The zero-based index corresponding to the column containing the - value to be returned. - - - A standard SQLite return code. - - - - - - A successful invocation of this method will cause *pRowid to be - filled with the rowid of row that the virtual table cursor pCur is - currently pointing at. This method returns SQLITE_OK on success. It - returns an appropriate error code on failure. - - - The xRowid method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the current row for the specified cursor. - - - A standard SQLite return code. - - - - - - All changes to a virtual table are made using the xUpdate method. - This one method can be used to insert, delete, or update. - - - The argc parameter specifies the number of entries in the argv - array. The value of argc will be 1 for a pure delete operation or - N+2 for an insert or replace or update where N is the number of - columns in the table. In the previous sentence, N includes any - hidden columns. - - - Every argv entry will have a non-NULL value in C but may contain - the SQL value NULL. In other words, it is always true that - argv[i]!=0 for i between 0 and argc-1. However, it might be the - case that sqlite3_value_type(argv[i])==SQLITE_NULL. - - - The argv[0] parameter is the rowid of a row in the virtual table - to be deleted. If argv[0] is an SQL NULL, then no deletion occurs. - - - The argv[1] parameter is the rowid of a new row to be inserted into - the virtual table. If argv[1] is an SQL NULL, then the - implementation must choose a rowid for the newly inserted row. - Subsequent argv[] entries contain values of the columns of the - virtual table, in the order that the columns were declared. The - number of columns will match the table declaration that the - xConnect or xCreate method made using the sqlite3_declare_vtab() - call. All hidden columns are included. - - - When doing an insert without a rowid (argc>1, argv[1] is an SQL - NULL), the implementation must set *pRowid to the rowid of the - newly inserted row; this will become the value returned by the - sqlite3_last_insert_rowid() function. Setting this value in all the - other cases is a harmless no-op; the SQLite engine ignores the - *pRowid return value if argc==1 or argv[1] is not an SQL NULL. - - - Each call to xUpdate will fall into one of cases shown below. Note - that references to argv[i] mean the SQL value held within the - argv[i] object, not the argv[i] object itself. - - - argc = 1 - - - The single row with rowid equal to argv[0] is deleted. No - insert occurs. - - - argc > 1 - argv[0] = NULL - - - A new row is inserted with a rowid argv[1] and column - values in argv[2] and following. If argv[1] is an SQL NULL, - the a new unique rowid is generated automatically. - - - argc > 1 - argv[0] ? NULL - argv[0] = argv[1] - - - The row with rowid argv[0] is updated with new values in - argv[2] and following parameters. - - - argc > 1 - argv[0] ? NULL - argv[0] ? argv[1] - - - The row with rowid argv[0] is updated with rowid argv[1] - and new values in argv[2] and following parameters. This - will occur when an SQL statement updates a rowid, as in - the statement: - - - UPDATE table SET rowid=rowid+1 WHERE ...; - - - The xUpdate method must return SQLITE_OK if and only if it is - successful. If a failure occurs, the xUpdate must return an - appropriate error code. On a failure, the pVTab->zErrMsg element - may optionally be replaced with error message text stored in memory - allocated from SQLite using functions such as sqlite3_mprintf() or - sqlite3_malloc(). - - - If the xUpdate method violates some constraint of the virtual table - (including, but not limited to, attempting to store a value of the - wrong datatype, attempting to store a value that is too large or - too small, or attempting to change a read-only value) then the - xUpdate must fail with an appropriate error code. - - - There might be one or more sqlite3_vtab_cursor objects open and in - use on the virtual table instance and perhaps even on the row of - the virtual table when the xUpdate method is invoked. The - implementation of xUpdate must be prepared for attempts to delete - or modify rows of the table out from other existing cursors. If the - virtual table cannot accommodate such changes, the xUpdate method - must return an error code. - - - The xUpdate method is optional. If the xUpdate pointer in the - sqlite3_module for a virtual table is a NULL pointer, then the - virtual table is read-only. - - - - The native pointer to the sqlite3_vtab derived structure. - - - The number of new or modified column values contained in - . - - - The array of native pointers to sqlite3_value structures containing - the new or modified column values, if any. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the row that was inserted, if any. - - - A standard SQLite return code. - - - - - - This method begins a transaction on a virtual table. This is method - is optional. The xBegin pointer of sqlite3_module may be NULL. - - - This method is always followed by one call to either the xCommit or - xRollback method. Virtual table transactions do not nest, so the - xBegin method will not be invoked more than once on a single - virtual table without an intervening call to either xCommit or - xRollback. Multiple calls to other methods can and likely will - occur in between the xBegin and the corresponding xCommit or - xRollback. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - This method signals the start of a two-phase commit on a virtual - table. This is method is optional. The xSync pointer of - sqlite3_module may be NULL. - - - This method is only invoked after call to the xBegin method and - prior to an xCommit or xRollback. In order to implement two-phase - commit, the xSync method on all virtual tables is invoked prior to - invoking the xCommit method on any virtual table. If any of the - xSync methods fail, the entire transaction is rolled back. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - This method causes a virtual table transaction to commit. This is - method is optional. The xCommit pointer of sqlite3_module may be - NULL. - - - A call to this method always follows a prior call to xBegin and - xSync. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - This method causes a virtual table transaction to rollback. This is - method is optional. The xRollback pointer of sqlite3_module may be - NULL. - - - A call to this method always follows a prior call to xBegin. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - This method provides notification that the virtual table - implementation that the virtual table will be given a new name. If - this method returns SQLITE_OK then SQLite renames the table. If - this method returns an error code then the renaming is prevented. - - - The xRename method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab derived structure. - - - The number of arguments to the function being sought. - - - The name of the function being sought. - - - Upon success, this parameter must be modified to contain the - delegate responsible for implementing the specified function. - - - Upon success, this parameter must be modified to contain the - native user-data pointer associated with - . - - - Non-zero if the specified function was found; zero otherwise. - - - - - - This method provides notification that the virtual table - implementation that the virtual table will be given a new name. If - this method returns SQLITE_OK then SQLite renames the table. If - this method returns an error code then the renaming is prevented. - - - The xRename method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab derived structure. - - - The native pointer to the UTF-8 encoded string containing the new - name for the virtual table. - - - A standard SQLite return code. - - - - - - These methods provide the virtual table implementation an - opportunity to implement nested transactions. They are always - optional and will only be called in SQLite version 3.7.7 and later. - - - When xSavepoint(X,N) is invoked, that is a signal to the virtual - table X that it should save its current state as savepoint N. A - subsequent call to xRollbackTo(X,R) means that the state of the - virtual table should return to what it was when xSavepoint(X,R) was - last called. The call to xRollbackTo(X,R) will invalidate all - savepoints with N>R; none of the invalided savepoints will be - rolled back or released without first being reinitialized by a call - to xSavepoint(). A call to xRelease(X,M) invalidates all savepoints - where N>=M. - - - None of the xSavepoint(), xRelease(), or xRollbackTo() methods will - ever be called except in between calls to xBegin() and either - xCommit() or xRollback(). - - - - The native pointer to the sqlite3_vtab derived structure. - - - This is an integer identifier under which the the current state of - the virtual table should be saved. - - - A standard SQLite return code. - - - - - - These methods provide the virtual table implementation an - opportunity to implement nested transactions. They are always - optional and will only be called in SQLite version 3.7.7 and later. - - - When xSavepoint(X,N) is invoked, that is a signal to the virtual - table X that it should save its current state as savepoint N. A - subsequent call to xRollbackTo(X,R) means that the state of the - virtual table should return to what it was when xSavepoint(X,R) was - last called. The call to xRollbackTo(X,R) will invalidate all - savepoints with N>R; none of the invalided savepoints will be - rolled back or released without first being reinitialized by a call - to xSavepoint(). A call to xRelease(X,M) invalidates all savepoints - where N>=M. - - - None of the xSavepoint(), xRelease(), or xRollbackTo() methods will - ever be called except in between calls to xBegin() and either - xCommit() or xRollback(). - - - - The native pointer to the sqlite3_vtab derived structure. - - - This is an integer used to indicate that any saved states with an - identifier greater than or equal to this should be deleted by the - virtual table. - - - A standard SQLite return code. - - - - - - These methods provide the virtual table implementation an - opportunity to implement nested transactions. They are always - optional and will only be called in SQLite version 3.7.7 and later. - - - When xSavepoint(X,N) is invoked, that is a signal to the virtual - table X that it should save its current state as savepoint N. A - subsequent call to xRollbackTo(X,R) means that the state of the - virtual table should return to what it was when xSavepoint(X,R) was - last called. The call to xRollbackTo(X,R) will invalidate all - savepoints with N>R; none of the invalided savepoints will be - rolled back or released without first being reinitialized by a call - to xSavepoint(). A call to xRelease(X,M) invalidates all savepoints - where N>=M. - - - None of the xSavepoint(), xRelease(), or xRollbackTo() methods will - ever be called except in between calls to xBegin() and either - xCommit() or xRollback(). - - - - The native pointer to the sqlite3_vtab derived structure. - - - This is an integer identifier used to specify a specific saved - state for the virtual table for it to restore itself back to, which - should also have the effect of deleting all saved states with an - integer identifier greater than this one. - - - A standard SQLite return code. - - - - - This interface represents a virtual table implementation written in - managed code. - - - - - This method is called in response to the - method. - - - The object instance associated with - the virtual table. - - - The native user-data pointer associated with this module, as it was - provided to the SQLite core library when the native module instance - was created. - - - The module name, database name, virtual table name, and all other - arguments passed to the CREATE VIRTUAL TABLE statement. - - - Upon success, this parameter must be modified to contain the - object instance associated with - the virtual table. - - - Upon failure, this parameter must be modified to contain an error - message. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated with - the virtual table. - - - The native user-data pointer associated with this module, as it was - provided to the SQLite core library when the native module instance - was created. - - - The module name, database name, virtual table name, and all other - arguments passed to the CREATE VIRTUAL TABLE statement. - - - Upon success, this parameter must be modified to contain the - object instance associated with - the virtual table. - - - Upon failure, this parameter must be modified to contain an error - message. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The object instance containing all the - data for the inputs and outputs relating to index selection. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - Upon success, this parameter must be modified to contain the - object instance associated - with the newly opened virtual table cursor. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Number used to help identify the selected index. - - - String used to help identify the selected index. - - - The values corresponding to each column in the selected index. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Non-zero if no more rows are available; zero otherwise. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - The object instance to be used for - returning the specified column value to the SQLite core library. - - - The zero-based index corresponding to the column containing the - value to be returned. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the current row for the specified cursor. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The array of object instances containing - the new or modified column values, if any. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the row that was inserted, if any. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The number of arguments to the function being sought. - - - The name of the function being sought. - - - Upon success, this parameter must be modified to contain the - object instance responsible for - implementing the specified function. - - - Upon success, this parameter must be modified to contain the - native user-data pointer associated with - . - - - Non-zero if the specified function was found; zero otherwise. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The new name for the virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer identifier under which the the current state of - the virtual table should be saved. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer used to indicate that any saved states with an - identifier greater than or equal to this should be deleted by the - virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer identifier used to specify a specific saved - state for the virtual table for it to restore itself back to, which - should also have the effect of deleting all saved states with an - integer identifier greater than this one. - - - A standard SQLite return code. - - - - - Returns non-zero if the schema for the virtual table has been - declared. - - - - - Returns the name of the module as it was registered with the SQLite - core library. - - - - - This class contains static methods that are used to allocate, - manipulate, and free native memory provided by the SQLite core library. - - - - - Allocates at least the specified number of bytes of native memory - via the SQLite core library sqlite3_malloc() function and returns - the resulting native pointer. - - - The number of bytes to allocate. - - - The native pointer that points to a block of memory of at least the - specified size -OR- if the memory could - not be allocated. - - - - - Gets and returns the actual size of the specified memory block that - was previously obtained from the method. - - - The native pointer to the memory block previously obtained from the - method. - - - The actual size, in bytes, of the memory block specified via the - native pointer. - - - - - Frees a memory block previously obtained from the - method. - - - The native pointer to the memory block previously obtained from the - method. - - - - - This class contains static methods that are used to deal with native - UTF-8 string pointers to be used with the SQLite core library. - - - - - This is the maximum possible length for the native UTF-8 encoded - strings used with the SQLite core library. - - - - - This is the object instance used to handle - conversions from/to UTF-8. - - - - - Converts the specified managed string into the UTF-8 encoding and - returns the array of bytes containing its representation in that - encoding. - - - The managed string to convert. - - - The array of bytes containing the representation of the managed - string in the UTF-8 encoding or null upon failure. - - - - - Converts the specified array of bytes representing a string in the - UTF-8 encoding and returns a managed string. - - - The array of bytes to convert. - - - The managed string or null upon failure. - - - - - Probes a native pointer to a string in the UTF-8 encoding for its - terminating NUL character, within the specified length limit. - - - The native NUL-terminated string pointer. - - - The maximum length of the native string, in bytes. - - - The length of the native string, in bytes -OR- zero if the length - could not be determined. - - - - - Converts the specified native NUL-terminated UTF-8 string pointer - into a managed string. - - - The native NUL-terminated UTF-8 string pointer. - - - The managed string or null upon failure. - - - - - Converts the specified native UTF-8 string pointer of the specified - length into a managed string. - - - The native UTF-8 string pointer. - - - The length of the native string, in bytes. - - - The managed string or null upon failure. - - - - - Converts the specified managed string into a native NUL-terminated - UTF-8 string pointer using memory obtained from the SQLite core - library. - - - The managed string to convert. - - - The native NUL-terminated UTF-8 string pointer or - upon failure. - - - - - Converts a logical array of native NUL-terminated UTF-8 string - pointers into an array of managed strings. - - - The number of elements in the logical array of native - NUL-terminated UTF-8 string pointers. - - - The native pointer to the logical array of native NUL-terminated - UTF-8 string pointers to convert. - - - The array of managed strings or null upon failure. - - - - - Converts an array of managed strings into an array of native - NUL-terminated UTF-8 string pointers. - - - The array of managed strings to convert. - - - The array of native NUL-terminated UTF-8 string pointers or null - upon failure. - - - - - This class contains static methods that are used to deal with native - pointers to memory blocks that logically contain arrays of bytes to be - used with the SQLite core library. - - - - - Converts a native pointer to a logical array of bytes of the - specified length into a managed byte array. - - - The native pointer to the logical array of bytes to convert. - - - The length, in bytes, of the logical array of bytes to convert. - - - The managed byte array or null upon failure. - - - - - Converts a managed byte array into a native pointer to a logical - array of bytes. - - - The managed byte array to convert. - - - The native pointer to a logical byte array or null upon failure. - - - - - This class contains static methods that are used to perform several - low-level data marshalling tasks between native and managed code. - - - - - Returns a new object instance based on the - specified object instance and an integer - offset. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location that the new - object instance should point to. - - - The new object instance. - - - - - Rounds up an integer size to the next multiple of the alignment. - - - The size, in bytes, to be rounded up. - - - The required alignment for the return value. - - - The size, in bytes, rounded up to the next multiple of the - alignment. This value may end up being the same as the original - size. - - - - - Determines the offset, in bytes, of the next structure member. - - - The offset, in bytes, of the current structure member. - - - The size, in bytes, of the current structure member. - - - The alignment, in bytes, of the next structure member. - - - The offset, in bytes, of the next structure member. - - - - - Reads a value from the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be read is located. - - - The value at the specified memory location. - - - - - Reads a value from the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - to be read is located. - - - The value at the specified memory location. - - - - - Reads an value from the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be read is located. - - - The value at the specified memory location. - - - - - Writes an value to the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be written is located. - - - The value to write. - - - - - Writes an value to the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be written is located. - - - The value to write. - - - - - Writes a value to the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be written is located. - - - The value to write. - - - - - Writes a value to the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be written is located. - - - The value to write. - - - - - Generates a hash code value for the object. - - - The object instance used to calculate the hash code. - - - Non-zero if different object instances with the same value should - generate different hash codes, where applicable. This parameter - has no effect on the .NET Compact Framework. - - - The hash code value -OR- zero if the object is null. - - - - - This class represents a managed virtual table module implementation. - It is not sealed and must be used as the base class for any - user-defined virtual table module classes implemented in managed code. - - - - - The default version of the native sqlite3_module structure in use. - - - - - This field is used to store the native sqlite3_module structure - associated with this object instance. - - - - - This field is used to store the destructor delegate to be passed to - the SQLite core library via the sqlite3_create_disposable_module() - function. - - - - - This field is used to store a pointer to the native sqlite3_module - structure returned by the sqlite3_create_disposable_module - function. - - - - - This field is used to store the virtual table instances associated - with this module. The native pointer to the sqlite3_vtab derived - structure is used to key into this collection. - - - - - This field is used to store the virtual table cursor instances - associated with this module. The native pointer to the - sqlite3_vtab_cursor derived structure is used to key into this - collection. - - - - - This field is used to store the virtual table function instances - associated with this module. The case-insensitive function name - and the number of arguments (with -1 meaning "any") are used to - construct the string that is used to key into this collection. - - - - - Constructs an instance of this class. - - - The name of the module. This parameter cannot be null. - - - - - Calls the native SQLite core library in order to create a new - disposable module containing the implementation of a virtual table. - - - The native database connection pointer to use. - - - Non-zero upon success. - - - - - This method is called by the SQLite core library when the native - module associated with this object instance is being destroyed due - to its parent connection being closed. It may also be called by - the "vtshim" module if/when the sqlite3_dispose_module() function - is called. - - - The native user-data pointer associated with this module, as it was - provided to the SQLite core library when the native module instance - was created. - - - - - Creates and returns the native sqlite_module structure using the - configured (or default) - interface implementation. - - - The native sqlite_module structure using the configured (or - default) interface - implementation. - - - - - Creates and returns the native sqlite_module structure using the - specified interface - implementation. - - - The interface implementation to - use. - - - The native sqlite_module structure using the specified - interface implementation. - - - - - Creates a copy of the specified - object instance, - using default implementations for the contained delegates when - necessary. - - - The object - instance to copy. - - - The new object - instance. - - - - - Calls one of the virtual table initialization methods. - - - Non-zero to call the - method; otherwise, the - method will be called. - - - The native database connection handle. - - - The original native pointer value that was provided to the - sqlite3_create_module(), sqlite3_create_module_v2() or - sqlite3_create_disposable_module() functions. - - - The number of arguments from the CREATE VIRTUAL TABLE statement. - - - The array of string arguments from the CREATE VIRTUAL TABLE - statement. - - - Upon success, this parameter must be modified to point to the newly - created native sqlite3_vtab derived structure. - - - Upon failure, this parameter must be modified to point to the error - message, with the underlying memory having been obtained from the - sqlite3_malloc() function. - - - A standard SQLite return code. - - - - - Calls one of the virtual table finalization methods. - - - Non-zero to call the - method; otherwise, the - method will be - called. - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance to be used. - - - The native pointer to the sqlite3_vtab derived structure. - - - Non-zero if this error message should also be logged using the - class. - - - Non-zero if caught exceptions should be logged using the - class. - - - The error message. - - - Non-zero upon success. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance to be used. - - - The object instance used to - lookup the native pointer to the sqlite3_vtab derived structure. - - - Non-zero if this error message should also be logged using the - class. - - - Non-zero if caught exceptions should be logged using the - class. - - - The error message. - - - Non-zero upon success. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance to be used. - - - The native pointer to the sqlite3_vtab_cursor derived structure - used to get the native pointer to the sqlite3_vtab derived - structure. - - - Non-zero if this error message should also be logged using the - class. - - - Non-zero if caught exceptions should be logged using the - class. - - - The error message. - - - Non-zero upon success. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance to be used. - - - The object instance used to - lookup the native pointer to the sqlite3_vtab derived structure. - - - Non-zero if this error message should also be logged using the - class. - - - Non-zero if caught exceptions should be logged using the - class. - - - The error message. - - - Non-zero upon success. - - - - - Gets and returns the interface - implementation to be used when creating the native sqlite3_module - structure. Derived classes may override this method to supply an - alternate implementation for the - interface. - - - The interface implementation to - be used when populating the native sqlite3_module structure. If - the returned value is null, the private methods provided by the - class and relating to the - interface will be used to - create the necessary delegates. - - - - - Creates and returns the - interface implementation corresponding to the current - object instance. - - - The interface implementation - corresponding to the current object - instance. - - - - - Allocates a native sqlite3_vtab derived structure and returns a - native pointer to it. - - - A native pointer to a native sqlite3_vtab derived structure. - - - - - Zeros out the fields of a native sqlite3_vtab derived structure. - - - The native pointer to the native sqlite3_vtab derived structure to - zero. - - - - - Frees a native sqlite3_vtab structure using the provided native - pointer to it. - - - A native pointer to a native sqlite3_vtab derived structure. - - - - - Allocates a native sqlite3_vtab_cursor derived structure and - returns a native pointer to it. - - - A native pointer to a native sqlite3_vtab_cursor derived structure. - - - - - Frees a native sqlite3_vtab_cursor structure using the provided - native pointer to it. - - - A native pointer to a native sqlite3_vtab_cursor derived structure. - - - - - Reads and returns the native pointer to the sqlite3_vtab derived - structure based on the native pointer to the sqlite3_vtab_cursor - derived structure. - - - The object instance to be used. - - - The native pointer to the sqlite3_vtab_cursor derived structure - from which to read the native pointer to the sqlite3_vtab derived - structure. - - - The native pointer to the sqlite3_vtab derived structure -OR- - if it cannot be determined. - - - - - Reads and returns the native pointer to the sqlite3_vtab derived - structure based on the native pointer to the sqlite3_vtab_cursor - derived structure. - - - The native pointer to the sqlite3_vtab_cursor derived structure - from which to read the native pointer to the sqlite3_vtab derived - structure. - - - The native pointer to the sqlite3_vtab derived structure -OR- - if it cannot be determined. - - - - - Looks up and returns the object - instance based on the native pointer to the sqlite3_vtab derived - structure. - - - The native pointer to the sqlite3_vtab derived structure. - - - The object instance or null if - the corresponding one cannot be found. - - - - - Allocates and returns a native pointer to a sqlite3_vtab derived - structure and creates an association between it and the specified - object instance. - - - The object instance to be used - when creating the association. - - - The native pointer to a sqlite3_vtab derived structure or - if the method fails for any reason. - - - - - Looks up and returns the - object instance based on the native pointer to the - sqlite3_vtab_cursor derived structure. - - - The native pointer to the sqlite3_vtab derived structure. - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - The object instance or null - if the corresponding one cannot be found. - - - - - Allocates and returns a native pointer to a sqlite3_vtab_cursor - derived structure and creates an association between it and the - specified object instance. - - - The object instance to be - used when creating the association. - - - The native pointer to a sqlite3_vtab_cursor derived structure or - if the method fails for any reason. - - - - - Deterimines the key that should be used to identify and store the - object instance for the virtual table - (i.e. to be returned via the - method). - - - The number of arguments to the virtual table function. - - - The name of the virtual table function. - - - The object instance associated with - this virtual table function. - - - The string that should be used to identify and store the virtual - table function instance. This method cannot return null. If null - is returned from this method, the behavior is undefined. - - - - - Attempts to declare the schema for the virtual table using the - specified database connection. - - - The object instance to use when - declaring the schema of the virtual table. This parameter may not - be null. - - - The string containing the CREATE TABLE statement that completely - describes the schema for the virtual table. This parameter may not - be null. - - - Upon failure, this parameter must be modified to contain an error - message. - - - A standard SQLite return code. - - - - - Calls the native SQLite core library in order to declare a virtual - table function in response to a call into the - - or virtual table - methods. - - - The object instance to use when - declaring the schema of the virtual table. - - - The number of arguments to the function being declared. - - - The name of the function being declared. - - - Upon success, the contents of this parameter are undefined. Upon - failure, it should contain an appropriate error message. - - - A standard SQLite return code. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The native pointer to the sqlite3_vtab derived structure. - - - The error message. - - - Non-zero upon success. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance used to - lookup the native pointer to the sqlite3_vtab derived structure. - - - The error message. - - - Non-zero upon success. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance used to - lookup the native pointer to the sqlite3_vtab derived structure. - - - The error message. - - - Non-zero upon success. - - - - - Modifies the specified object instance - to contain the specified estimated cost. - - - The object instance to modify. - - - The estimated cost value to use. Using a null value means that the - default value provided by the SQLite core library should be used. - - - Non-zero upon success. - - - - - Modifies the specified object instance - to contain the default estimated cost. - - - The object instance to modify. - - - Non-zero upon success. - - - - - Modifies the specified object instance - to contain the specified estimated rows. - - - The object instance to modify. - - - The estimated rows value to use. Using a null value means that the - default value provided by the SQLite core library should be used. - - - Non-zero upon success. - - - - - Modifies the specified object instance - to contain the default estimated rows. - - - The object instance to modify. - - - Non-zero upon success. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - This method is called in response to the - method. - - - The object instance associated with - the virtual table. - - - The native user-data pointer associated with this module, as it was - provided to the SQLite core library when the native module instance - was created. - - - The module name, database name, virtual table name, and all other - arguments passed to the CREATE VIRTUAL TABLE statement. - - - Upon success, this parameter must be modified to contain the - object instance associated with - the virtual table. - - - Upon failure, this parameter must be modified to contain an error - message. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated with - the virtual table. - - - The native user-data pointer associated with this module, as it was - provided to the SQLite core library when the native module instance - was created. - - - The module name, database name, virtual table name, and all other - arguments passed to the CREATE VIRTUAL TABLE statement. - - - Upon success, this parameter must be modified to contain the - object instance associated with - the virtual table. - - - Upon failure, this parameter must be modified to contain an error - message. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The object instance containing all the - data for the inputs and outputs relating to index selection. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - Upon success, this parameter must be modified to contain the - object instance associated - with the newly opened virtual table cursor. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Number used to help identify the selected index. - - - String used to help identify the selected index. - - - The values corresponding to each column in the selected index. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Non-zero if no more rows are available; zero otherwise. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - The object instance to be used for - returning the specified column value to the SQLite core library. - - - The zero-based index corresponding to the column containing the - value to be returned. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the current row for the specified cursor. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The array of object instances containing - the new or modified column values, if any. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the row that was inserted, if any. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The number of arguments to the function being sought. - - - The name of the function being sought. - - - Upon success, this parameter must be modified to contain the - object instance responsible for - implementing the specified function. - - - Upon success, this parameter must be modified to contain the - native user-data pointer associated with - . - - - Non-zero if the specified function was found; zero otherwise. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The new name for the virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer identifier under which the the current state of - the virtual table should be saved. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer used to indicate that any saved states with an - identifier greater than or equal to this should be deleted by the - virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer identifier used to specify a specific saved - state for the virtual table for it to restore itself back to, which - should also have the effect of deleting all saved states with an - integer identifier greater than this one. - - - A standard SQLite return code. - - - - - Disposes of this object instance. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is being - called from the finalizer. - - - - - Finalizes this object instance. - - - - - Returns or sets a boolean value indicating whether virtual table - errors should be logged using the class. - - - - - Returns or sets a boolean value indicating whether exceptions - caught in the - method, - the method, - the method, - the method, - and the method should be logged using the - class. - - - - - Returns or sets a boolean value indicating whether virtual table - errors should be logged using the class. - - - - - Returns or sets a boolean value indicating whether exceptions - caught in the - method, - method, and the - method should be logged using the - class. - - - - - Returns non-zero if the schema for the virtual table has been - declared. - - - - - Returns the name of the module as it was registered with the SQLite - core library. - - - - - This class implements the - interface by forwarding those method calls to the - object instance it contains. If the - contained object instance is null, all - the methods simply generate an - error. - - - - - This is the value that is always used for the "logErrors" - parameter to the various static error handling methods provided - by the class. - - - - - This is the value that is always used for the "logExceptions" - parameter to the various static error handling methods provided - by the class. - - - - - This is the error message text used when the contained - object instance is not available - for any reason. - - - - - The object instance used to provide - an implementation of the - interface. - - - - - Constructs an instance of this class. - - - The object instance used to provide - an implementation of the - interface. - - - - - Sets the table error message to one that indicates the native - module implementation is not available. - - - The native pointer to the sqlite3_vtab derived structure. - - - The value of . - - - - - Sets the table error message to one that indicates the native - module implementation is not available. - - - The native pointer to the sqlite3_vtab_cursor derived - structure. - - - The value of . - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - Disposes of this object instance. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is being - called from the finalizer. - - - - - Finalizes this object instance. - - - - - This class represents a virtual table cursor to be used with the - class. It is not sealed and may - be used as the base class for any user-defined virtual table cursor - class that wraps an object instance. - - - - - The instance provided when this cursor - was created. - - - - - This value will be non-zero if false has been returned from the - method. - - - - - Constructs an instance of this class. - - - The object instance associated - with this object instance. - - - The instance to expose as a virtual - table cursor. - - - - - Advances to the next row of the virtual table cursor using the - method of the - object instance. - - - Non-zero if the current row is valid; zero otherwise. If zero is - returned, no further rows are available. - - - - - Resets the virtual table cursor position, also invalidating the - current row, using the method of - the object instance. - - - - - Closes the virtual table cursor. This method must not throw any - exceptions. - - - - - Throws an if the virtual - table cursor has been closed. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is - being called from the finalizer. - - - - - Returns the value for the current row of the virtual table cursor - using the property of the - object instance. - - - - - Returns non-zero if the end of the virtual table cursor has been - seen (i.e. no more rows are available, including the current one). - - - - - Returns non-zero if the virtual table cursor is open. - - - - - This class implements a virtual table module that exposes an - object instance as a read-only virtual - table. It is not sealed and may be used as the base class for any - user-defined virtual table class that wraps an - object instance. The following short - example shows it being used to treat an array of strings as a table - data source: - - public static class Sample - { - public static void Main() - { - using (SQLiteConnection connection = new SQLiteConnection( - "Data Source=:memory:;")) - { - connection.Open(); - - connection.CreateModule(new SQLiteModuleEnumerable( - "sampleModule", new string[] { "one", "two", "three" })); - - using (SQLiteCommand command = connection.CreateCommand()) - { - command.CommandText = - "CREATE VIRTUAL TABLE t1 USING sampleModule;"; - - command.ExecuteNonQuery(); - } - - using (SQLiteCommand command = connection.CreateCommand()) - { - command.CommandText = "SELECT * FROM t1;"; - - using (SQLiteDataReader dataReader = command.ExecuteReader()) - { - while (dataReader.Read()) - Console.WriteLine(dataReader[0].ToString()); - } - } - - connection.Close(); - } - } - } - - - - - - This class implements a virtual table module that does nothing by - providing "empty" implementations for all of the - interface methods. The result - codes returned by these "empty" method implementations may be - controlled on a per-method basis by using and/or overriding the - , - , - , - , and - methods from within derived classes. - - - - - This field is used to store the - values to return, on a per-method basis, for all methods that are - part of the interface. - - - - - Constructs an instance of this class. - - - The name of the module. This parameter cannot be null. - - - - - Determines the default value to be - returned by methods of the - interface that lack an overridden implementation in all classes - derived from the class. - - - The value that should be returned - by all interface methods unless - a more specific result code has been set for that interface method. - - - - - Converts a value into a boolean - return value for use with the - method. - - - The value to convert. - - - The value. - - - - - Converts a value into a boolean - return value for use with the - method. - - - The value to convert. - - - The value. - - - - - Determines the value that should be - returned by the specified - interface method if it lack an overridden implementation. If no - specific value is available (or set) - for the specified method, the value - returned by the method will be - returned instead. - - - The name of the method. Currently, this method must be part of - the interface. - - - The value that should be returned - by the interface method. - - - - - Sets the value that should be - returned by the specified - interface method if it lack an overridden implementation. - - - The name of the method. Currently, this method must be part of - the interface. - - - The value that should be returned - by the interface method. - - - Non-zero upon success. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is - being called from the finalizer. - - - - - The CREATE TABLE statement used to declare the schema for the - virtual table. - - - - - The instance containing the backing data - for the virtual table. - - - - - Non-zero if different object instances with the same value should - generate different row identifiers, where applicable. This has no - effect on the .NET Compact Framework. - - - - - Constructs an instance of this class. - - - The name of the module. This parameter cannot be null. - - - The instance to expose as a virtual - table. This parameter cannot be null. - - - - - Constructs an instance of this class. - - - The name of the module. This parameter cannot be null. - - - The instance to expose as a virtual - table. This parameter cannot be null. - - - Non-zero if different object instances with the same value should - generate different row identifiers, where applicable. This - parameter has no effect on the .NET Compact Framework. - - - - - Determines the SQL statement used to declare the virtual table. - This method should be overridden in derived classes if they require - a custom virtual table schema. - - - The SQL statement used to declare the virtual table -OR- null if it - cannot be determined. - - - - - Sets the table error message to one that indicates the virtual - table cursor is of the wrong type. - - - The object instance. - - - The value of . - - - - - Sets the table error message to one that indicates the virtual - table cursor has no current row. - - - The object instance. - - - The value of . - - - - - Determines the string to return as the column value for the object - instance value. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - The object instance to return a string representation for. - - - The string representation of the specified object instance or null - upon failure. - - - - - Constructs an unique row identifier from two - values. The first value - must contain the row sequence number for the current row and the - second value must contain the hash code of the enumerator value - for the current row. - - - The integer row sequence number for the current row. - - - The hash code of the enumerator value for the current row. - - - The unique row identifier or zero upon failure. - - - - - Determines the unique row identifier for the current row. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - The object instance to return a unique row identifier for. - - - The unique row identifier or zero upon failure. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is - being called from the finalizer. - - - - - This class represents a virtual table cursor to be used with the - class. It is not sealed and may - be used as the base class for any user-defined virtual table cursor - class that wraps an object instance. - - - - - The instance provided when this - cursor was created. - - - - - Constructs an instance of this class. - - - The object instance associated - with this object instance. - - - The instance to expose as a virtual - table cursor. - - - - - Closes the virtual table cursor. This method must not throw any - exceptions. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is - being called from the finalizer. - - - - - Returns the value for the current row of the virtual table cursor - using the property of the - object instance. - - - - - This class implements a virtual table module that exposes an - object instance as a read-only virtual - table. It is not sealed and may be used as the base class for any - user-defined virtual table class that wraps an - object instance. - - - - - The instance containing the backing - data for the virtual table. - - - - - Constructs an instance of this class. - - - The name of the module. This parameter cannot be null. - - - The instance to expose as a virtual - table. This parameter cannot be null. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is - being called from the finalizer. - - -
-
diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/2.0/x64/SQLite.Interop.dll b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/2.0/x64/SQLite.Interop.dll deleted file mode 100644 index 2ac14083..00000000 Binary files a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/2.0/x64/SQLite.Interop.dll and /dev/null differ diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/2.0/x86/SQLite.Interop.dll b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/2.0/x86/SQLite.Interop.dll deleted file mode 100644 index c04f0e7e..00000000 Binary files a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/2.0/x86/SQLite.Interop.dll and /dev/null differ diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/3.5/System.Data.SQLite.dll b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/3.5/System.Data.SQLite.dll deleted file mode 100644 index 2414373e..00000000 Binary files a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/3.5/System.Data.SQLite.dll and /dev/null differ diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/3.5/System.Data.SQLite.xml b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/3.5/System.Data.SQLite.xml deleted file mode 100644 index 6df7eb75..00000000 --- a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/3.5/System.Data.SQLite.xml +++ /dev/null @@ -1,13100 +0,0 @@ - - - - System.Data.SQLite - - - - - Defines a source code identifier custom attribute for an assembly - manifest. - - - - - Constructs an instance of this attribute class using the specified - source code identifier value. - - - The source code identifier value to use. - - - - - Gets the source code identifier value. - - - - - Defines a source code time-stamp custom attribute for an assembly - manifest. - - - - - Constructs an instance of this attribute class using the specified - source code time-stamp value. - - - The source code time-stamp value to use. - - - - - Gets the source code time-stamp value. - - - - - This is the method signature for the SQLite core library logging callback - function for use with sqlite3_log() and the SQLITE_CONFIG_LOG. - - WARNING: This delegate is used more-or-less directly by native code, do - not modify its type signature. - - - The extra data associated with this message, if any. - - - The error code associated with this message. - - - The message string to be logged. - - - - - This class implements SQLiteBase completely, and is the guts of the code that interop's SQLite with .NET - - - - - This internal class provides the foundation of SQLite support. It defines all the abstract members needed to implement - a SQLite data provider, and inherits from SQLiteConvert which allows for simple translations of string to and from SQLite. - - - - - This base class provides datatype conversion services for the SQLite provider. - - - - - The format string for DateTime values when using the InvariantCulture or CurrentCulture formats. - - - - - The value for the Unix epoch (e.g. January 1, 1970 at midnight, in UTC). - - - - - The value of the OLE Automation epoch represented as a Julian day. - - - - - An array of ISO-8601 DateTime formats that we support parsing. - - - - - The internal default format for UTC DateTime values when converting - to a string. - - - - - The internal default format for local DateTime values when converting - to a string. - - - - - An UTF-8 Encoding instance, so we can convert strings to and from UTF-8 - - - - - The default DateTime format for this instance. - - - - - The default DateTimeKind for this instance. - - - - - The default DateTime format string for this instance. - - - - - Initializes the conversion class - - The default date/time format to use for this instance - The DateTimeKind to use. - The DateTime format string to use. - - - - Converts a string to a UTF-8 encoded byte array sized to include a null-terminating character. - - The string to convert to UTF-8 - A byte array containing the converted string plus an extra 0 terminating byte at the end of the array. - - - - Convert a DateTime to a UTF-8 encoded, zero-terminated byte array. - - - This function is a convenience function, which first calls ToString() on the DateTime, and then calls ToUTF8() with the - string result. - - The DateTime to convert. - The UTF-8 encoded string, including a 0 terminating byte at the end of the array. - - - - Converts a UTF-8 encoded IntPtr of the specified length into a .NET string - - The pointer to the memory where the UTF-8 string is encoded - The number of bytes to decode - A string containing the translated character(s) - - - - Converts a UTF-8 encoded IntPtr of the specified length into a .NET string - - The pointer to the memory where the UTF-8 string is encoded - The number of bytes to decode - A string containing the translated character(s) - - - - Converts a string into a DateTime, using the DateTimeFormat, DateTimeKind, - and DateTimeFormatString specified for the connection when it was opened. - - - Acceptable ISO8601 DateTime formats are: - - THHmmssK - THHmmK - HH:mm:ss.FFFFFFFK - HH:mm:ssK - HH:mmK - yyyy-MM-dd HH:mm:ss.FFFFFFFK - yyyy-MM-dd HH:mm:ssK - yyyy-MM-dd HH:mmK - yyyy-MM-ddTHH:mm:ss.FFFFFFFK - yyyy-MM-ddTHH:mmK - yyyy-MM-ddTHH:mm:ssK - yyyyMMddHHmmssK - yyyyMMddHHmmK - yyyyMMddTHHmmssFFFFFFFK - THHmmss - THHmm - HH:mm:ss.FFFFFFF - HH:mm:ss - HH:mm - yyyy-MM-dd HH:mm:ss.FFFFFFF - yyyy-MM-dd HH:mm:ss - yyyy-MM-dd HH:mm - yyyy-MM-ddTHH:mm:ss.FFFFFFF - yyyy-MM-ddTHH:mm - yyyy-MM-ddTHH:mm:ss - yyyyMMddHHmmss - yyyyMMddHHmm - yyyyMMddTHHmmssFFFFFFF - yyyy-MM-dd - yyyyMMdd - yy-MM-dd - - If the string cannot be matched to one of the above formats -OR- - the DateTimeFormatString if one was provided, an exception will - be thrown. - - The string containing either a long integer number of 100-nanosecond units since - System.DateTime.MinValue, a Julian day double, an integer number of seconds since the Unix epoch, a - culture-independent formatted date and time string, a formatted date and time string in the current - culture, or an ISO8601-format string. - A DateTime value - - - - Converts a string into a DateTime, using the specified DateTimeFormat, - DateTimeKind and DateTimeFormatString. - - - Acceptable ISO8601 DateTime formats are: - - THHmmssK - THHmmK - HH:mm:ss.FFFFFFFK - HH:mm:ssK - HH:mmK - yyyy-MM-dd HH:mm:ss.FFFFFFFK - yyyy-MM-dd HH:mm:ssK - yyyy-MM-dd HH:mmK - yyyy-MM-ddTHH:mm:ss.FFFFFFFK - yyyy-MM-ddTHH:mmK - yyyy-MM-ddTHH:mm:ssK - yyyyMMddHHmmssK - yyyyMMddHHmmK - yyyyMMddTHHmmssFFFFFFFK - THHmmss - THHmm - HH:mm:ss.FFFFFFF - HH:mm:ss - HH:mm - yyyy-MM-dd HH:mm:ss.FFFFFFF - yyyy-MM-dd HH:mm:ss - yyyy-MM-dd HH:mm - yyyy-MM-ddTHH:mm:ss.FFFFFFF - yyyy-MM-ddTHH:mm - yyyy-MM-ddTHH:mm:ss - yyyyMMddHHmmss - yyyyMMddHHmm - yyyyMMddTHHmmssFFFFFFF - yyyy-MM-dd - yyyyMMdd - yy-MM-dd - - If the string cannot be matched to one of the above formats -OR- - the DateTimeFormatString if one was provided, an exception will - be thrown. - - The string containing either a long integer number of 100-nanosecond units since - System.DateTime.MinValue, a Julian day double, an integer number of seconds since the Unix epoch, a - culture-independent formatted date and time string, a formatted date and time string in the current - culture, or an ISO8601-format string. - The SQLiteDateFormats to use. - The DateTimeKind to use. - The DateTime format string to use. - A DateTime value - - - - Converts a julianday value into a DateTime - - The value to convert - A .NET DateTime - - - - Converts a julianday value into a DateTime - - The value to convert - The DateTimeKind to use. - A .NET DateTime - - - - Converts the specified number of seconds from the Unix epoch into a - value. - - - The number of whole seconds since the Unix epoch. - - - Either Utc or Local time. - - - The new value. - - - - - Converts the specified number of ticks since the epoch into a - value. - - - The number of whole ticks since the epoch. - - - Either Utc or Local time. - - - The new value. - - - - - Converts a DateTime struct to a JulianDay double - - The DateTime to convert - The JulianDay value the Datetime represents - - - - Converts a DateTime struct to the whole number of seconds since the - Unix epoch. - - The DateTime to convert - The whole number of seconds since the Unix epoch - - - - Returns the DateTime format string to use for the specified DateTimeKind. - If is not null, it will be returned verbatim. - - The DateTimeKind to use. - The DateTime format string to use. - - The DateTime format string to use for the specified DateTimeKind. - - - - - Converts a string into a DateTime, using the DateTimeFormat, DateTimeKind, - and DateTimeFormatString specified for the connection when it was opened. - - The DateTime value to convert - Either a string containing the long integer number of 100-nanosecond units since System.DateTime.MinValue, a - Julian day double, an integer number of seconds since the Unix epoch, a culture-independent formatted date and time - string, a formatted date and time string in the current culture, or an ISO8601-format date/time string. - - - - Internal function to convert a UTF-8 encoded IntPtr of the specified length to a DateTime. - - - This is a convenience function, which first calls ToString() on the IntPtr to convert it to a string, then calls - ToDateTime() on the string to return a DateTime. - - A pointer to the UTF-8 encoded string - The length in bytes of the string - The parsed DateTime value - - - - Smart method of splitting a string. Skips quoted elements, removes the quotes. - - - This split function works somewhat like the String.Split() function in that it breaks apart a string into - pieces and returns the pieces as an array. The primary differences are: - - Only one character can be provided as a separator character - Quoted text inside the string is skipped over when searching for the separator, and the quotes are removed. - - Thus, if splitting the following string looking for a comma:
- One,Two, "Three, Four", Five
-
- The resulting array would contain
- [0] One
- [1] Two
- [2] Three, Four
- [3] Five
-
- Note that the leading and trailing spaces were removed from each item during the split. -
- Source string to split apart - Separator character - A string array of the split up elements -
- - - Splits the specified string into multiple strings based on a separator - and returns the result as an array of strings. - - - The string to split into pieces based on the separator character. If - this string is null, null will always be returned. If this string is - empty, an array of zero strings will always be returned. - - - The character used to divide the original string into sub-strings. - This character cannot be a backslash or a double-quote; otherwise, no - work will be performed and null will be returned. - - - If this parameter is non-zero, all double-quote characters will be - retained in the returned list of strings; otherwise, they will be - dropped. - - - Upon failure, this parameter will be modified to contain an appropriate - error message. - - - The new array of strings or null if the input string is null -OR- the - separator character is a backslash or a double-quote -OR- the string - contains an unbalanced backslash or double-quote character. - - - - - Queries and returns the string representation for an object, using the - specified (or current) format provider. - - - The object instance to return the string representation for. - - - The format provider to use -OR- null if the current format provider for - the thread should be used instead. - - - The string representation for the object instance -OR- null if the - object instance is also null. - - - - - Convert a value to true or false. - - A string or number representing true or false - - - - - Convert a string to true or false. - - A string representing true or false - - - "yes", "no", "y", "n", "0", "1", "on", "off" as well as Boolean.FalseString and Boolean.TrueString will all be - converted to a proper boolean value. - - - - - Converts a SQLiteType to a .NET Type object - - The SQLiteType to convert - Returns a .NET Type object - - - - For a given intrinsic type, return a DbType - - The native type to convert - The corresponding (closest match) DbType - - - - Returns the ColumnSize for the given DbType - - The DbType to get the size of - - - - - Determines the type name for the given database value type. - - The connection context for custom type mappings, if any. - The database value type. - The flags associated with the parent connection object. - The type name or an empty string if it cannot be determined. - - - - Convert a DbType to a Type - - The DbType to convert from - The closest-match .NET type - - - - For a given type, return the closest-match SQLite TypeAffinity, which only understands a very limited subset of types. - - The type to evaluate - The SQLite type affinity for that type. - - - - Builds and returns a map containing the database column types - recognized by this provider. - - - A map containing the database column types recognized by this - provider. - - - - - For a given type name, return a closest-match .NET type - - The connection context for custom type mappings, if any. - The name of the type to match - The flags associated with the parent connection object. - The .NET DBType the text evaluates to. - - - - The error code used for logging exceptions caught in user-provided - code. - - - - - Sets the status of the memory usage tracking subsystem in the SQLite core library. By default, this is enabled. - If this is disabled, memory usage tracking will not be performed. This is not really a per-connection value, it is - global to the process. - - Non-zero to enable memory usage tracking, zero otherwise. - A standard SQLite return code (i.e. zero for success and non-zero for failure). - - - - Attempts to free as much heap memory as possible for the database connection. - - A standard SQLite return code (i.e. zero for success and non-zero for failure). - - - - Shutdown the SQLite engine so that it can be restarted with different config options. - We depend on auto initialization to recover. - - - - - Determines if the associated native connection handle is open. - - - Non-zero if a database connection is open. - - - - - Opens a database. - - - Implementers should call SQLiteFunction.BindFunctions() and save the array after opening a connection - to bind all attributed user-defined functions and collating sequences to the new connection. - - The filename of the database to open. SQLite automatically creates it if it doesn't exist. - The flags associated with the parent connection object - The open flags to use when creating the connection - The maximum size of the pool for the given filename - If true, the connection can be pulled from the connection pool - - - - Closes the currently-open database. - - - After the database has been closed implemeters should call SQLiteFunction.UnbindFunctions() to deallocate all interop allocated - memory associated with the user-defined functions and collating sequences tied to the closed connection. - - Non-zero if the operation is allowed to throw exceptions, zero otherwise. - - - - Sets the busy timeout on the connection. SQLiteCommand will call this before executing any command. - - The number of milliseconds to wait before returning SQLITE_BUSY - - - - Returns the text of the last error issued by SQLite - - - - - - Returns the text of the last error issued by SQLite -OR- the specified default error text if - none is available from the SQLite core library. - - - The error text to return in the event that one is not available from the SQLite core library. - - - The error text. - - - - - When pooling is enabled, force this connection to be disposed rather than returned to the pool - - - - - When pooling is enabled, returns the number of pool entries matching the current file name. - - The number of pool entries matching the current file name. - - - - Prepares a SQL statement for execution. - - The source connection preparing the command. Can be null for any caller except LINQ - The SQL command text to prepare - The previous statement in a multi-statement command, or null if no previous statement exists - The timeout to wait before aborting the prepare - The remainder of the statement that was not processed. Each call to prepare parses the - SQL up to to either the end of the text or to the first semi-colon delimiter. The remaining text is returned - here for a subsequent call to Prepare() until all the text has been processed. - Returns an initialized SQLiteStatement. - - - - Steps through a prepared statement. - - The SQLiteStatement to step through - True if a row was returned, False if not. - - - - Resets a prepared statement so it can be executed again. If the error returned is SQLITE_SCHEMA, - transparently attempt to rebuild the SQL statement and throw an error if that was not possible. - - The statement to reset - Returns -1 if the schema changed while resetting, 0 if the reset was sucessful or 6 (SQLITE_LOCKED) if the reset failed due to a lock - - - - Attempts to interrupt the query currently executing on the associated - native database connection. - - - - - This function binds a user-defined functions to the connection. - - - The object instance containing - the metadata for the function to be bound. - - - The object instance that implements the - function to be bound. - - - The flags associated with the parent connection object. - - - - - Calls the native SQLite core library in order to create a disposable - module containing the implementation of a virtual table. - - - The module object to be used when creating the native disposable module. - - - The flags for the associated object instance. - - - - - Calls the native SQLite core library in order to cleanup the resources - associated with a module containing the implementation of a virtual table. - - - The module object previously passed to the - method. - - - The flags for the associated object instance. - - - - - Calls the native SQLite core library in order to declare a virtual table - in response to a call into the - or virtual table methods. - - - The virtual table module that is to be responsible for the virtual table - being declared. - - - The string containing the SQL statement describing the virtual table to - be declared. - - - Upon success, the contents of this parameter are undefined. Upon failure, - it should contain an appropriate error message. - - - A standard SQLite return code. - - - - - Calls the native SQLite core library in order to declare a virtual table - function in response to a call into the - or virtual table methods. - - - The virtual table module that is to be responsible for the virtual table - function being declared. - - - The number of arguments to the function being declared. - - - The name of the function being declared. - - - Upon success, the contents of this parameter are undefined. Upon failure, - it should contain an appropriate error message. - - - A standard SQLite return code. - - - - - Enables or disabled extension loading by SQLite. - - - True to enable loading of extensions, false to disable. - - - - - Loads a SQLite extension library from the named file. - - - The name of the dynamic link library file containing the extension. - - - The name of the exported function used to initialize the extension. - If null, the default "sqlite3_extension_init" will be used. - - - - - Enables or disabled extened result codes returned by SQLite - - true to enable extended result codes, false to disable. - - - - - Returns the numeric result code for the most recent failed SQLite API call - associated with the database connection. - - Result code - - - - Returns the extended numeric result code for the most recent failed SQLite API call - associated with the database connection. - - Extended result code - - - - Add a log message via the SQLite sqlite3_log interface. - - Error code to be logged with the message. - String to be logged. Unlike the SQLite sqlite3_log() - interface, this should be pre-formatted. Consider using the - String.Format() function. - - - - - Checks if the SQLite core library has been initialized in the current process. - - - Non-zero if the SQLite core library has been initialized in the current process, - zero otherwise. - - - - - Creates a new SQLite backup object based on the provided destination - database connection. The source database connection is the one - associated with this object. The source and destination database - connections cannot be the same. - - The destination database connection. - The destination database name. - The source database name. - The newly created backup object. - - - - Copies up to N pages from the source database to the destination - database associated with the specified backup object. - - The backup object to use. - - The number of pages to copy or negative to copy all remaining pages. - - - Set to true if the operation needs to be retried due to database - locking issues. - - - True if there are more pages to be copied, false otherwise. - - - - - Returns the number of pages remaining to be copied from the source - database to the destination database associated with the specified - backup object. - - The backup object to check. - The number of pages remaining to be copied. - - - - Returns the total number of pages in the source database associated - with the specified backup object. - - The backup object to check. - The total number of pages in the source database. - - - - Destroys the backup object, rolling back any backup that may be in - progess. - - The backup object to destroy. - - - - Returns the error message for the specified SQLite return code using - the internal static lookup table. - - The SQLite return code. - The error message or null if it cannot be found. - - - - Returns the error message for the specified SQLite return code using - the sqlite3_errstr() function, falling back to the internal lookup - table if necessary. - - The SQLite return code. - The error message or null if it cannot be found. - - - - Returns a string representing the active version of SQLite - - - - - Returns an integer representing the active version of SQLite - - - - - Returns the rowid of the most recent successful INSERT into the database from this connection. - - - - - Returns the number of changes the last executing insert/update caused. - - - - - Returns the amount of memory (in bytes) currently in use by the SQLite core library. This is not really a per-connection - value, it is global to the process. - - - - - Returns the maximum amount of memory (in bytes) used by the SQLite core library since the high-water mark was last reset. - This is not really a per-connection value, it is global to the process. - - - - - Returns non-zero if the underlying native connection handle is owned by this instance. - - - - - Returns non-zero if the given database connection is in autocommit mode. - Autocommit mode is on by default. Autocommit mode is disabled by a BEGIN - statement. Autocommit mode is re-enabled by a COMMIT or ROLLBACK. - - - - - The opaque pointer returned to us by the sqlite provider - - - - - The user-defined functions registered on this connection - - - - - The modules created using this connection. - - - - - Constructs the object used to interact with the SQLite core library - using the UTF-8 text encoding. - - - The DateTime format to be used when converting string values to a - DateTime and binding DateTime parameters. - - - The to be used when creating DateTime - values. - - - The format string to be used when parsing and formatting DateTime - values. - - - The native handle to be associated with the database connection. - - - The fully qualified file name associated with . - - - Non-zero if the newly created object instance will need to dispose - of when it is no longer needed. - - - - - This method attempts to dispose of all the derived - object instances currently associated with the native database connection. - - - - - Attempts to interrupt the query currently executing on the associated - native database connection. - - - - - This function binds a user-defined function to the connection. - - - The object instance containing - the metadata for the function to be bound. - - - The object instance that implements the - function to be bound. - - - The flags associated with the parent connection object. - - - - - Attempts to free as much heap memory as possible for the database connection. - - A standard SQLite return code (i.e. zero for success and non-zero for failure). - - - - Attempts to free N bytes of heap memory by deallocating non-essential memory - allocations held by the database library. Memory used to cache database pages - to improve performance is an example of non-essential memory. This is a no-op - returning zero if the SQLite core library was not compiled with the compile-time - option SQLITE_ENABLE_MEMORY_MANAGEMENT. Optionally, attempts to reset and/or - compact the Win32 native heap, if applicable. - - - The requested number of bytes to free. - - - Non-zero to attempt a heap reset. - - - Non-zero to attempt heap compaction. - - - The number of bytes actually freed. This value may be zero. - - - This value will be non-zero if the heap reset was successful. - - - The size of the largest committed free block in the heap, in bytes. - This value will be zero unless heap compaction is enabled. - - - A standard SQLite return code (i.e. zero for success and non-zero - for failure). - - - - - Shutdown the SQLite engine so that it can be restarted with different - configuration options. We depend on auto initialization to recover. - - Returns a standard SQLite result code. - - - - Shutdown the SQLite engine so that it can be restarted with different - configuration options. We depend on auto initialization to recover. - - - Non-zero to reset the database and temporary directories to their - default values, which should be null for both. This parameter has no - effect on non-Windows operating systems. - - Returns a standard SQLite result code. - - - - Determines if the associated native connection handle is open. - - - Non-zero if the associated native connection handle is open. - - - - - Calls the native SQLite core library in order to create a disposable - module containing the implementation of a virtual table. - - - The module object to be used when creating the native disposable module. - - - The flags for the associated object instance. - - - - - Calls the native SQLite core library in order to cleanup the resources - associated with a module containing the implementation of a virtual table. - - - The module object previously passed to the - method. - - - The flags for the associated object instance. - - - - - Calls the native SQLite core library in order to declare a virtual table - in response to a call into the - or virtual table methods. - - - The virtual table module that is to be responsible for the virtual table - being declared. - - - The string containing the SQL statement describing the virtual table to - be declared. - - - Upon success, the contents of this parameter are undefined. Upon failure, - it should contain an appropriate error message. - - - A standard SQLite return code. - - - - - Calls the native SQLite core library in order to declare a virtual table - function in response to a call into the - or virtual table methods. - - - The virtual table module that is to be responsible for the virtual table - function being declared. - - - The number of arguments to the function being declared. - - - The name of the function being declared. - - - Upon success, the contents of this parameter are undefined. Upon failure, - it should contain an appropriate error message. - - - A standard SQLite return code. - - - - - Enables or disabled extension loading by SQLite. - - - True to enable loading of extensions, false to disable. - - - - - Loads a SQLite extension library from the named file. - - - The name of the dynamic link library file containing the extension. - - - The name of the exported function used to initialize the extension. - If null, the default "sqlite3_extension_init" will be used. - - - - Enables or disabled extended result codes returned by SQLite - - - Gets the last SQLite error code - - - Gets the last SQLite extended error code - - - Add a log message via the SQLite sqlite3_log interface. - - - Add a log message via the SQLite sqlite3_log interface. - - - - Allows the setting of a logging callback invoked by SQLite when a - log event occurs. Only one callback may be set. If NULL is passed, - the logging callback is unregistered. - - The callback function to invoke. - Returns a result code - - - - Creates a new SQLite backup object based on the provided destination - database connection. The source database connection is the one - associated with this object. The source and destination database - connections cannot be the same. - - The destination database connection. - The destination database name. - The source database name. - The newly created backup object. - - - - Copies up to N pages from the source database to the destination - database associated with the specified backup object. - - The backup object to use. - - The number of pages to copy, negative to copy all remaining pages. - - - Set to true if the operation needs to be retried due to database - locking issues; otherwise, set to false. - - - True if there are more pages to be copied, false otherwise. - - - - - Returns the number of pages remaining to be copied from the source - database to the destination database associated with the specified - backup object. - - The backup object to check. - The number of pages remaining to be copied. - - - - Returns the total number of pages in the source database associated - with the specified backup object. - - The backup object to check. - The total number of pages in the source database. - - - - Destroys the backup object, rolling back any backup that may be in - progess. - - The backup object to destroy. - - - - Determines if the SQLite core library has been initialized for the - current process. - - - A boolean indicating whether or not the SQLite core library has been - initialized for the current process. - - - - - Determines if the SQLite core library has been initialized for the - current process. - - - A boolean indicating whether or not the SQLite core library has been - initialized for the current process. - - - - - Helper function to retrieve a column of data from an active statement. - - The statement being step()'d through - The flags associated with the connection. - The column index to retrieve - The type of data contained in the column. If Uninitialized, this function will retrieve the datatype information. - Returns the data in the column - - - - Returns non-zero if the underlying native connection handle is owned - by this instance. - - - - - Alternate SQLite3 object, overriding many text behaviors to support UTF-16 (Unicode) - - - - - Constructs the object used to interact with the SQLite core library - using the UTF-8 text encoding. - - - The DateTime format to be used when converting string values to a - DateTime and binding DateTime parameters. - - - The to be used when creating DateTime - values. - - - The format string to be used when parsing and formatting DateTime - values. - - - The native handle to be associated with the database connection. - - - The fully qualified file name associated with . - - - Non-zero if the newly created object instance will need to dispose - of when it is no longer needed. - - - - - Overrides SQLiteConvert.ToString() to marshal UTF-16 strings instead of UTF-8 - - A pointer to a UTF-16 string - The length (IN BYTES) of the string - A .NET string - - - - Represents a single SQL backup in SQLite. - - - - - The underlying SQLite object this backup is bound to. - - - - - The actual backup handle. - - - - - The destination database for the backup. - - - - - The destination database name for the backup. - - - - - The source database for the backup. - - - - - The source database name for the backup. - - - - - The last result from the StepBackup method of the SQLite3 class. - This is used to determine if the call to the FinishBackup method of - the SQLite3 class should throw an exception when it receives a non-Ok - return code from the core SQLite library. - - - - - Initializes the backup. - - The base SQLite object. - The backup handle. - The destination database for the backup. - The destination database name for the backup. - The source database for the backup. - The source database name for the backup. - - - - Disposes and finalizes the backup. - - - - - The extra behavioral flags that can be applied to a connection. - - - - - No extra flags. - - - - - Enable logging of all SQL statements to be prepared. - - - - - Enable logging of all bound parameter types and raw values. - - - - - Enable logging of all bound parameter strongly typed values. - - - - - Enable logging of all exceptions caught from user-provided - managed code called from native code via delegates. - - - - - Enable logging of backup API errors. - - - - - Skip adding the extension functions provided by the native - interop assembly. - - - - - When binding parameter values with the - type, use the interop method that accepts an - value. - - - - - When binding parameter values, always bind them as though they were - plain text (i.e. no numeric, date/time, or other conversions should - be attempted). - - - - - When returning column values, always return them as though they were - plain text (i.e. no numeric, date/time, or other conversions should - be attempted). - - - - - Prevent this object instance from - loading extensions. - - - - - Prevent this object instance from - creating virtual table modules. - - - - - Skip binding any functions provided by other managed assemblies when - opening the connection. - - - - - Skip setting the logging related properties of the - object instance that was passed to - the method. - - - - - Enable logging of all virtual table module errors seen by the - method. - - - - - Enable logging of certain virtual table module exceptions that cannot - be easily discovered via other means. - - - - - Enable tracing of potentially important [non-fatal] error conditions - that cannot be easily reported through other means. - - - - - When binding parameter values, always use the invariant culture when - converting their values from strings. - - - - - When binding parameter values, always use the invariant culture when - converting their values to strings. - - - - - Disable using the connection pool by default. If the "Pooling" - connection string property is specified, its value will override - this flag. The precise outcome of combining this flag with the - flag is unspecified; however, - one of the flags will be in effect. - - - - - Enable using the connection pool by default. If the "Pooling" - connection string property is specified, its value will override - this flag. The precise outcome of combining this flag with the - flag is unspecified; however, - one of the flags will be in effect. - - - - - Enable using per-connection mappings between type names and - values. Also see the - , - , and - methods. These - per-connection mappings, when present, override the corresponding - global mappings. - - - - - Disable using global mappings between type names and - values. This may be useful in some very narrow - cases; however, if there are no per-connection type mappings, the - fallback defaults will be used for both type names and their - associated values. Therefore, use of this flag - is not recommended. - - - - - When binding parameter values or returning column values, always - treat them as though they were plain text (i.e. no numeric, - date/time, or other conversions should be attempted). - - - - - When binding parameter values, always use the invariant culture when - converting their values to strings or from strings. - - - - - When binding parameter values or returning column values, always - treat them as though they were plain text (i.e. no numeric, - date/time, or other conversions should be attempted) and always - use the invariant culture when converting their values to strings. - - - - - When binding parameter values or returning column values, always - treat them as though they were plain text (i.e. no numeric, - date/time, or other conversions should be attempted) and always - use the invariant culture when converting their values to strings - or from strings. - - - - - Enable all logging. - - - - - The default extra flags for new connections. - - - - - SQLite implementation of DbCommand. - - - - - The default connection string to be used when creating a temporary - connection to execute a command via the static - or - - methods. - - - - - The command text this command is based on - - - - - The connection the command is associated with - - - - - The version of the connection the command is associated with - - - - - Indicates whether or not a DataReader is active on the command. - - - - - The timeout for the command, kludged because SQLite doesn't support per-command timeout values - - - - - Designer support - - - - - Used by DbDataAdapter to determine updating behavior - - - - - The collection of parameters for the command - - - - - The SQL command text, broken into individual SQL statements as they are executed - - - - - Unprocessed SQL text that has not been executed - - - - - Transaction associated with this command - - - - - Constructs a new SQLiteCommand - - - Default constructor - - - - - Initializes the command with the given command text - - The SQL command text - - - - Initializes the command with the given SQL command text and attach the command to the specified - connection. - - The SQL command text - The connection to associate with the command - - - - Initializes the command and associates it with the specified connection. - - The connection to associate with the command - - - - Initializes a command with the given SQL, connection and transaction - - The SQL command text - The connection to associate with the command - The transaction the command should be associated with - - - - Disposes of the command and clears all member variables - - Whether or not the class is being explicitly or implicitly disposed - - - - This method attempts to query the flags associated with the database - connection in use. If the database connection is disposed, the default - flags will be returned. - - - The command containing the databse connection to query the flags from. - - - The connection flags value. - - - - - Clears and destroys all statements currently prepared - - - - - Builds an array of prepared statements for each complete SQL statement in the command text - - - - - Not implemented - - - - - Forwards to the local CreateParameter() function - - - - - - Create a new parameter - - - - - - This function ensures there are no active readers, that we have a valid connection, - that the connection is open, that all statements are prepared and all parameters are assigned - in preparation for allocating a data reader. - - - - - Creates a new SQLiteDataReader to execute/iterate the array of SQLite prepared statements - - The behavior the data reader should adopt - Returns a SQLiteDataReader object - - - - This method creates a new connection, executes the query using the given - execution type, closes the connection, and returns the results. If the - connection string is null, a temporary in-memory database connection will - be used. - - - The text of the command to be executed. - - - The execution type for the command. This is used to determine which method - of the command object to call, which then determines the type of results - returned, if any. - - - The connection string to the database to be opened, used, and closed. If - this parameter is null, a temporary in-memory databse will be used. - - - The SQL parameter values to be used when building the command object to be - executed, if any. - - - The results of the query -OR- null if no results were produced from the - given execution type. - - - - - This method creates a new connection, executes the query using the given - execution type and command behavior, closes the connection, and returns - the results. If the connection string is null, a temporary in-memory - database connection will be used. - - - The text of the command to be executed. - - - The execution type for the command. This is used to determine which method - of the command object to call, which then determines the type of results - returned, if any. - - - The command behavior flags for the command. - - - The connection string to the database to be opened, used, and closed. If - this parameter is null, a temporary in-memory databse will be used. - - - The SQL parameter values to be used when building the command object to be - executed, if any. - - - The results of the query -OR- null if no results were produced from the - given execution type. - - - - - Overrides the default behavior to return a SQLiteDataReader specialization class - - The flags to be associated with the reader. - A SQLiteDataReader - - - - Overrides the default behavior of DbDataReader to return a specialized SQLiteDataReader class - - A SQLiteDataReader - - - - Called by the SQLiteDataReader when the data reader is closed. - - - - - Execute the command and return the number of rows inserted/updated affected by it. - - The number of rows inserted/updated affected by it. - - - - Execute the command and return the number of rows inserted/updated affected by it. - - The flags to be associated with the reader. - The number of rows inserted/updated affected by it. - - - - Execute the command and return the first column of the first row of the resultset - (if present), or null if no resultset was returned. - - The first column of the first row of the first resultset from the query. - - - - Execute the command and return the first column of the first row of the resultset - (if present), or null if no resultset was returned. - - The flags to be associated with the reader. - The first column of the first row of the first resultset from the query. - - - - Does nothing. Commands are prepared as they are executed the first time, and kept in prepared state afterwards. - - - - - Clones a command, including all its parameters - - A new SQLiteCommand with the same commandtext, connection and parameters - - - - The SQL command text associated with the command - - - - - The amount of time to wait for the connection to become available before erroring out - - - - - The type of the command. SQLite only supports CommandType.Text - - - - - The connection associated with this command - - - - - Forwards to the local Connection property - - - - - Returns the SQLiteParameterCollection for the given command - - - - - Forwards to the local Parameters property - - - - - The transaction associated with this command. SQLite only supports one transaction per connection, so this property forwards to the - command's underlying connection. - - - - - Forwards to the local Transaction property - - - - - Sets the method the SQLiteCommandBuilder uses to determine how to update inserted or updated rows in a DataTable. - - - - - Determines if the command is visible at design time. Defaults to True. - - - - - SQLite implementation of DbCommandBuilder. - - - - - Default constructor - - - - - Initializes the command builder and associates it with the specified data adapter. - - - - - - Minimal amount of parameter processing. Primarily sets the DbType for the parameter equal to the provider type in the schema - - The parameter to use in applying custom behaviors to a row - The row to apply the parameter to - The type of statement - Whether the application of the parameter is part of a WHERE clause - - - - Returns a valid named parameter - - The name of the parameter - Error - - - - Returns a named parameter for the given ordinal - - The i of the parameter - Error - - - - Returns a placeholder character for the specified parameter i. - - The index of the parameter to provide a placeholder for - Returns a named parameter - - - - Sets the handler for receiving row updating events. Used by the DbCommandBuilder to autogenerate SQL - statements that may not have previously been generated. - - A data adapter to receive events on. - - - - Returns the automatically-generated SQLite command to delete rows from the database - - - - - - Returns the automatically-generated SQLite command to delete rows from the database - - - - - - - Returns the automatically-generated SQLite command to update rows in the database - - - - - - Returns the automatically-generated SQLite command to update rows in the database - - - - - - - Returns the automatically-generated SQLite command to insert rows into the database - - - - - - Returns the automatically-generated SQLite command to insert rows into the database - - - - - - - Places brackets around an identifier - - The identifier to quote - The bracketed identifier - - - - Removes brackets around an identifier - - The quoted (bracketed) identifier - The undecorated identifier - - - - Override helper, which can help the base command builder choose the right keys for the given query - - - - - - - Gets/sets the DataAdapter for this CommandBuilder - - - - - Overridden to hide its property from the designer - - - - - Overridden to hide its property from the designer - - - - - Overridden to hide its property from the designer - - - - - Overridden to hide its property from the designer - - - - - Overridden to hide its property from the designer - - - - - Event data for connection event handlers. - - - - - The type of event being raised. - - - - - The associated with this event, if any. - - - - - The transaction associated with this event, if any. - - - - - The command associated with this event, if any. - - - - - The data reader associated with this event, if any. - - - - - The critical handle associated with this event, if any. - - - - - Command or message text associated with this event, if any. - - - - - Extra data associated with this event, if any. - - - - - Constructs the object. - - The type of event being raised. - The base associated - with this event, if any. - The transaction associated with this event, if any. - The command associated with this event, if any. - The data reader associated with this event, if any. - The critical handle associated with this event, if any. - The command or message text, if any. - The extra data, if any. - - - - Raised when an event pertaining to a connection occurs. - - The connection involved. - Extra information about the event. - - - - SQLite implentation of DbConnection. - - - The property can contain the following parameter(s), delimited with a semi-colon: - - - Parameter - Values - Required - Default - - - Data Source - - This may be a file name, the string ":memory:", or any supported URI (starting with SQLite 3.7.7). - Starting with release 1.0.86.0, in order to use more than one consecutive backslash (e.g. for a - UNC path), each of the adjoining backslash characters must be doubled (e.g. "\\Network\Share\test.db" - would become "\\\\Network\Share\test.db"). - - Y - - - - Version - 3 - N - 3 - - - UseUTF16Encoding - True
False
- N - False -
- - DateTimeFormat - - Ticks - Use the value of DateTime.Ticks.
- ISO8601 - Use the ISO-8601 format. Uses the "yyyy-MM-dd HH:mm:ss.FFFFFFFK" format for UTC - DateTime values and "yyyy-MM-dd HH:mm:ss.FFFFFFF" format for local DateTime values).
- JulianDay - The interval of time in days and fractions of a day since January 1, 4713 BC.
- UnixEpoch - The whole number of seconds since the Unix epoch (January 1, 1970).
- InvariantCulture - Any culture-independent string value that the .NET Framework can interpret as a valid DateTime.
- CurrentCulture - Any string value that the .NET Framework can interpret as a valid DateTime using the current culture.
- N - ISO8601 -
- - DateTimeKind - Unspecified - Not specified as either UTC or local time.
Utc - The time represented is UTC.
Local - The time represented is local time.
- N - Unspecified -
- - DateTimeFormatString - The exact DateTime format string to use for all formatting and parsing of all DateTime - values for this connection. - N - null - - - BaseSchemaName - Some base data classes in the framework (e.g. those that build SQL queries dynamically) - assume that an ADO.NET provider cannot support an alternate catalog (i.e. database) without supporting - alternate schemas as well; however, SQLite does not fit into this model. Therefore, this value is used - as a placeholder and removed prior to preparing any SQL statements that may contain it. - N - sqlite_default_schema - - - BinaryGUID - True - Store GUID columns in binary form
False - Store GUID columns as text
- N - True -
- - Cache Size - {size in bytes} - N - 2000 - - - Synchronous - Normal - Normal file flushing behavior
Full - Full flushing after all writes
Off - Underlying OS flushes I/O's
- N - Full -
- - Page Size - {size in bytes} - N - 1024 - - - Password - {password} - Using this parameter requires that the CryptoAPI based codec be enabled at compile-time for both the native interop assembly and the core managed assemblies; otherwise, using this parameter may result in an exception being thrown when attempting to open the connection. - N - - - - HexPassword - {hexPassword} - Must contain a sequence of zero or more hexadecimal encoded byte values without a leading "0x" prefix. Using this parameter requires that the CryptoAPI based codec be enabled at compile-time for both the native interop assembly and the core managed assemblies; otherwise, using this parameter may result in an exception being thrown when attempting to open the connection. - N - - - - Enlist - Y - Automatically enlist in distributed transactions
N - No automatic enlistment
- N - Y -
- - Pooling - - True - Use connection pooling.
- False - Do not use connection pooling.

- WARNING: When using the default connection pool implementation, - setting this property to True should be avoided by applications that make - use of COM (either directly or indirectly) due to possible deadlocks that - can occur during the finalization of some COM objects. -
- N - False -
- - FailIfMissing - True - Don't create the database if it does not exist, throw an error instead
False - Automatically create the database if it does not exist
- N - False -
- - Max Page Count - {size in pages} - Limits the maximum number of pages (limits the size) of the database - N - 0 - - - Legacy Format - True - Use the more compatible legacy 3.x database format
False - Use the newer 3.3x database format which compresses numbers more effectively
- N - False -
- - Default Timeout - {time in seconds}
The default command timeout
- N - 30 -
- - Journal Mode - Delete - Delete the journal file after a commit
Persist - Zero out and leave the journal file on disk after a commit
Off - Disable the rollback journal entirely
- N - Delete -
- - Read Only - True - Open the database for read only access
False - Open the database for normal read/write access
- N - False -
- - Max Pool Size - The maximum number of connections for the given connection string that can be in the connection pool - N - 100 - - - Default IsolationLevel - The default transaciton isolation level - N - Serializable - - - Foreign Keys - Enable foreign key constraints - N - False - - - Flags - Extra behavioral flags for the connection. See the enumeration for possible values. - N - Default - - - SetDefaults - - True - Apply the default connection settings to the opened database.
- False - Skip applying the default connection settings to the opened database. -
- N - True -
- - ToFullPath - - True - Attempt to expand the data source file name to a fully qualified path before opening.
- False - Skip attempting to expand the data source file name to a fully qualified path before opening. -
- N - True -
-
-
-
- - - The default "stub" (i.e. placeholder) base schema name to use when - returning column schema information. Used as the initial value of - the BaseSchemaName property. This should start with "sqlite_*" - because those names are reserved for use by SQLite (i.e. they cannot - be confused with the names of user objects). - - - - - The managed assembly containing this type. - - - - - Object used to synchronize access to the static instance data - for this class. - - - - - State of the current connection - - - - - The connection string - - - - - Nesting level of the transactions open on the connection - - - - - If set, then the connection is currently being disposed. - - - - - The default isolation level for new transactions - - - - - Whether or not the connection is enlisted in a distrubuted transaction - - - - - The per-connection mappings between type names and - values. These mappings override the corresponding global mappings. - - - - - The base SQLite object to interop with - - - - - The database filename minus path and extension - - - - - Temporary password storage, emptied after the database has been opened - - - - - The "stub" (i.e. placeholder) base schema name to use when returning - column schema information. - - - - - The extra behavioral flags for this connection, if any. See the - enumeration for a list of - possible values. - - - - - Default command timeout - - - - - Non-zero if the built-in (i.e. framework provided) connection string - parser should be used when opening the connection. - - - - - Constructs a new SQLiteConnection object - - - Default constructor - - - - - Initializes the connection with the specified connection string. - - The connection string to use. - - - - Initializes the connection with a pre-existing native connection handle. - This constructor overload is intended to be used only by the private - method. - - - The native connection handle to use. - - - The file name corresponding to the native connection handle. - - - Non-zero if this instance owns the native connection handle and - should dispose of it when it is no longer needed. - - - - - Initializes the connection with the specified connection string. - - - The connection string to use. - - - Non-zero to parse the connection string using the built-in (i.e. - framework provided) parser when opening the connection. - - - - - Clones the settings and connection string from an existing connection. If the existing connection is already open, this - function will open its own connection, enumerate any attached databases of the original connection, and automatically - attach to them. - - The connection to copy the settings from. - - - - Raises the event. - - - The connection associated with this event. If this parameter is not - null and the specified connection cannot raise events, then the - registered event handlers will not be invoked. - - - A that contains the event data. - - - - - Creates and returns a new managed database connection handle. This - method is intended to be used by implementations of the - interface only. In theory, it - could be used by other classes; however, that usage is not supported. - - - This must be a native database connection handle returned by the - SQLite core library and it must remain valid and open during the - entire duration of the calling method. - - - The new managed database connection handle or null if it cannot be - created. - - - - - Backs up the database, using the specified database connection as the - destination. - - The destination database connection. - The destination database name. - The source database name. - - The number of pages to copy or negative to copy all remaining pages. - - - The method to invoke between each step of the backup process. This - parameter may be null (i.e. no callbacks will be performed). - - - The number of milliseconds to sleep after encountering a locking error - during the backup process. A value less than zero means that no sleep - should be performed. - - - - - Clears the per-connection type mappings. - - - The total number of per-connection type mappings cleared. - - - - - Returns the per-connection type mappings. - - - The per-connection type mappings -OR- null if they are unavailable. - - - - - Adds a per-connection type mapping, possibly replacing one or more - that already exist. - - - The case-insensitive database type name (e.g. "MYDATE"). The value - of this parameter cannot be null. Using an empty string value (or - a string value consisting entirely of whitespace) for this parameter - is not recommended. - - - The value that should be associated with the - specified type name. - - - Non-zero if this mapping should be considered to be the primary one - for the specified . - - - A negative value if nothing was done. Zero if no per-connection type - mappings were replaced (i.e. it was a pure add operation). More than - zero if some per-connection type mappings were replaced. - - - - - Attempts to bind the specified object - instance to this connection. - - - The object instance containing - the metadata for the function to be bound. - - - The object instance that implements the - function to be bound. - - - - - Creates a clone of the connection. All attached databases and user-defined functions are cloned. If the existing connection is open, the cloned connection - will also be opened. - - - - - - Creates a database file. This just creates a zero-byte file which SQLite - will turn into a database when the file is opened properly. - - The file to create - - - - Raises the state change event when the state of the connection changes - - The new connection state. If this is different - from the previous state, the event is - raised. - The event data created for the raised event, if - it was actually raised. - - - - Determines and returns the fallback default isolation level when one cannot be - obtained from an existing connection instance. - - - The fallback default isolation level for this connection instance -OR- - if it cannot be determined. - - - - - Determines and returns the default isolation level for this connection instance. - - - The default isolation level for this connection instance -OR- - if it cannot be determined. - - - - - OBSOLETE. Creates a new SQLiteTransaction if one isn't already active on the connection. - - This parameter is ignored. - When TRUE, SQLite defers obtaining a write lock until a write operation is requested. - When FALSE, a writelock is obtained immediately. The default is TRUE, but in a multi-threaded multi-writer - environment, one may instead choose to lock the database immediately to avoid any possible writer deadlock. - Returns a SQLiteTransaction object. - - - - OBSOLETE. Creates a new SQLiteTransaction if one isn't already active on the connection. - - When TRUE, SQLite defers obtaining a write lock until a write operation is requested. - When FALSE, a writelock is obtained immediately. The default is false, but in a multi-threaded multi-writer - environment, one may instead choose to lock the database immediately to avoid any possible writer deadlock. - Returns a SQLiteTransaction object. - - - - Creates a new if one isn't already active on the connection. - - Supported isolation levels are Serializable, ReadCommitted and Unspecified. - - Unspecified will use the default isolation level specified in the connection string. If no isolation level is specified in the - connection string, Serializable is used. - Serializable transactions are the default. In this mode, the engine gets an immediate lock on the database, and no other threads - may begin a transaction. Other threads may read from the database, but not write. - With a ReadCommitted isolation level, locks are deferred and elevated as needed. It is possible for multiple threads to start - a transaction in ReadCommitted mode, but if a thread attempts to commit a transaction while another thread - has a ReadCommitted lock, it may timeout or cause a deadlock on both threads until both threads' CommandTimeout's are reached. - - Returns a SQLiteTransaction object. - - - - Creates a new if one isn't already - active on the connection. - - Returns the new transaction object. - - - - Forwards to the local function - - Supported isolation levels are Unspecified, Serializable, and ReadCommitted - - - - - This method is not implemented; however, the - event will still be raised. - - - - - - When the database connection is closed, all commands linked to this connection are automatically reset. - - - - - Clears the connection pool associated with the connection. Any other active connections using the same database file - will be discarded instead of returned to the pool when they are closed. - - - - - - Clears all connection pools. Any active connections will be discarded instead of sent to the pool when they are closed. - - - - - Create a new and associate it with this connection. - - Returns a new command object already assigned to this connection. - - - - Forwards to the local function. - - - - - - Parses the connection string into component parts using the custom - connection string parser. - - The connection string to parse - An array of key-value pairs representing each parameter of the connection string - - - - Parses a connection string using the built-in (i.e. framework provided) - connection string parser class and returns the key/value pairs. An - exception may be thrown if the connection string is invalid or cannot be - parsed. When compiled for the .NET Compact Framework, the custom - connection string parser is always used instead because the framework - provided one is unavailable there. - - - The connection string to parse. - - - Non-zero to throw an exception if any connection string values are not of - the type. - - The list of key/value pairs. - - - - Manual distributed transaction enlistment support - - The distributed transaction to enlist in - - - - Looks for a key in the array of key/values of the parameter string. If not found, return the specified default value - - The list to look in - The key to find - The default value to return if the key is not found - The value corresponding to the specified key, or the default value if not found. - - - - Attempts to convert the string value to an enumerated value of the specified type. - - The enumerated type to convert the string value to. - The string value to be converted. - Non-zero to make the conversion case-insensitive. - The enumerated value upon success or null upon error. - - - - Attempts to convert an input string into a byte value. - - - The string value to be converted. - - - The number styles to use for the conversion. - - - Upon sucess, this will contain the parsed byte value. - Upon failure, the value of this parameter is undefined. - - - Non-zero upon success; zero on failure. - - - - - Enables or disabled extension loading. - - - True to enable loading of extensions, false to disable. - - - - - Loads a SQLite extension library from the named dynamic link library file. - - - The name of the dynamic link library file containing the extension. - - - - - Loads a SQLite extension library from the named dynamic link library file. - - - The name of the dynamic link library file containing the extension. - - - The name of the exported function used to initialize the extension. - If null, the default "sqlite3_extension_init" will be used. - - - - - Creates a disposable module containing the implementation of a virtual - table. - - - The module object to be used when creating the disposable module. - - - - - Parses a string containing a sequence of zero or more hexadecimal - encoded byte values and returns the resulting byte array. The - "0x" prefix is not allowed on the input string. - - - The input string containing zero or more hexadecimal encoded byte - values. - - - A byte array containing the parsed byte values or null if an error - was encountered. - - - - - Creates and returns a string containing the hexadecimal encoded byte - values from the input array. - - - The input array of bytes. - - - The resulting string or null upon failure. - - - - - Parses a string containing a sequence of zero or more hexadecimal - encoded byte values and returns the resulting byte array. The - "0x" prefix is not allowed on the input string. - - - The input string containing zero or more hexadecimal encoded byte - values. - - - Upon failure, this will contain an appropriate error message. - - - A byte array containing the parsed byte values or null if an error - was encountered. - - - - - This method figures out what the default connection pool setting should - be based on the connection flags. When present, the "Pooling" connection - string property value always overrides the value returned by this method. - - - Non-zero if the connection pool should be enabled by default; otherwise, - zero. - - - - - Opens the connection using the parameters found in the . - - - - - Opens the connection using the parameters found in the and then returns it. - - The current connection object. - - - - This method causes any pending database operation to abort and return at - its earliest opportunity. This routine is typically called in response - to a user action such as pressing "Cancel" or Ctrl-C where the user wants - a long query operation to halt immediately. It is safe to call this - routine from any thread. However, it is not safe to call this routine - with a database connection that is closed or might close before this method - returns. - - - - - Returns various global memory statistics for the SQLite core library via - a dictionary of key/value pairs. Currently, only the "MemoryUsed" and - "MemoryHighwater" keys are returned and they have values that correspond - to the values that could be obtained via the - and connection properties. - - - This dictionary will be populated with the global memory statistics. It - will be created if necessary. - - - - - Attempts to free as much heap memory as possible for this database connection. - - - - - Attempts to free N bytes of heap memory by deallocating non-essential memory - allocations held by the database library. Memory used to cache database pages - to improve performance is an example of non-essential memory. This is a no-op - returning zero if the SQLite core library was not compiled with the compile-time - option SQLITE_ENABLE_MEMORY_MANAGEMENT. Optionally, attempts to reset and/or - compact the Win32 native heap, if applicable. - - - The requested number of bytes to free. - - - Non-zero to attempt a heap reset. - - - Non-zero to attempt heap compaction. - - - The number of bytes actually freed. This value may be zero. - - - This value will be non-zero if the heap reset was successful. - - - The size of the largest committed free block in the heap, in bytes. - This value will be zero unless heap compaction is enabled. - - - A standard SQLite return code (i.e. zero for success and non-zero - for failure). - - - - - Sets the status of the memory usage tracking subsystem in the SQLite core library. By default, this is enabled. - If this is disabled, memory usage tracking will not be performed. This is not really a per-connection value, it is - global to the process. - - Non-zero to enable memory usage tracking, zero otherwise. - A standard SQLite return code (i.e. zero for success and non-zero for failure). - - - - Passes a shutdown request to the SQLite core library. Does not throw - an exception if the shutdown request fails. - - - A standard SQLite return code (i.e. zero for success and non-zero for - failure). - - - - - Passes a shutdown request to the SQLite core library. Throws an - exception if the shutdown request fails and the no-throw parameter - is non-zero. - - - Non-zero to reset the database and temporary directories to their - default values, which should be null for both. - - - When non-zero, throw an exception if the shutdown request fails. - - - - Enables or disabled extended result codes returned by SQLite - - - Enables or disabled extended result codes returned by SQLite - - - Enables or disabled extended result codes returned by SQLite - - - Add a log message via the SQLite sqlite3_log interface. - - - Add a log message via the SQLite sqlite3_log interface. - - - - Change the password (or assign a password) to an open database. - - - No readers or writers may be active for this process. The database must already be open - and if it already was password protected, the existing password must already have been supplied. - - The new password to assign to the database - - - - Change the password (or assign a password) to an open database. - - - No readers or writers may be active for this process. The database must already be open - and if it already was password protected, the existing password must already have been supplied. - - The new password to assign to the database - - - - Sets the password for a password-protected database. A password-protected database is - unusable for any operation until the password has been set. - - The password for the database - - - - Sets the password for a password-protected database. A password-protected database is - unusable for any operation until the password has been set. - - The password for the database - - - - Queries or modifies the number of retries or the retry interval (in milliseconds) for - certain I/O operations that may fail due to anti-virus software. - - The number of times to retry the I/O operation. A negative value - will cause the current count to be queried and replace that negative value. - The number of milliseconds to wait before retrying the I/O - operation. This number is multiplied by the number of retry attempts so far to come - up with the final number of milliseconds to wait. A negative value will cause the - current interval to be queried and replace that negative value. - Zero for success, non-zero for error. - - - - Removes one set of surrounding single -OR- double quotes from the string - value and returns the resulting string value. If the string is null, empty, - or contains quotes that are not balanced, nothing is done and the original - string value will be returned. - - The string value to process. - - The string value, modified to remove one set of surrounding single -OR- - double quotes, if applicable. - - - - - Expand the filename of the data source, resolving the |DataDirectory| - macro as appropriate. - - The database filename to expand - - Non-zero if the returned file name should be converted to a full path - (except when using the .NET Compact Framework). - - The expanded path and filename of the filename - - - - The following commands are used to extract schema information out of the database. Valid schema types are: - - - MetaDataCollections - - - DataSourceInformation - - - Catalogs - - - Columns - - - ForeignKeys - - - Indexes - - - IndexColumns - - - Tables - - - Views - - - ViewColumns - - - - - Returns the MetaDataCollections schema - - A DataTable of the MetaDataCollections schema - - - - Returns schema information of the specified collection - - The schema collection to retrieve - A DataTable of the specified collection - - - - Retrieves schema information using the specified constraint(s) for the specified collection - - The collection to retrieve - The restrictions to impose - A DataTable of the specified collection - - - - Builds a MetaDataCollections schema datatable - - DataTable - - - - Builds a DataSourceInformation datatable - - DataTable - - - - Build a Columns schema - - The catalog (attached database) to query, can be null - The table to retrieve schema information for, must not be null - The column to retrieve schema information for, can be null - DataTable - - - - Returns index information for the given database and catalog - - The catalog (attached database) to query, can be null - The name of the index to retrieve information for, can be null - The table to retrieve index information for, can be null - DataTable - - - - Retrieves table schema information for the database and catalog - - The catalog (attached database) to retrieve tables on - The table to retrieve, can be null - The table type, can be null - DataTable - - - - Retrieves view schema information for the database - - The catalog (attached database) to retrieve views on - The view name, can be null - DataTable - - - - Retrieves catalog (attached databases) schema information for the database - - The catalog to retrieve, can be null - DataTable - - - - Returns the base column information for indexes in a database - - The catalog to retrieve indexes for (can be null) - The table to restrict index information by (can be null) - The index to restrict index information by (can be null) - The source column to restrict index information by (can be null) - A DataTable containing the results - - - - Returns detailed column information for a specified view - - The catalog to retrieve columns for (can be null) - The view to restrict column information by (can be null) - The source column to restrict column information by (can be null) - A DataTable containing the results - - - - Retrieves foreign key information from the specified set of filters - - An optional catalog to restrict results on - An optional table to restrict results on - An optional foreign key name to restrict results on - A DataTable with the results of the query - - - - Static variable to store the connection event handlers to call. - - - - - This event is raised whenever the database is opened or closed. - - - - - This event is raised when events related to the lifecycle of a - SQLiteConnection object occur. - - - - - This property is used to obtain or set the custom connection pool - implementation to use, if any. Setting this property to null will - cause the default connection pool implementation to be used. - - - - - Returns the number of pool entries for the file name associated with this connection. - - - - - The connection string containing the parameters for the connection - - - - - Parameter - Values - Required - Default - - - Data Source - - This may be a file name, the string ":memory:", or any supported URI (starting with SQLite 3.7.7). - Starting with release 1.0.86.0, in order to use more than one consecutive backslash (e.g. for a - UNC path), each of the adjoining backslash characters must be doubled (e.g. "\\Network\Share\test.db" - would become "\\\\Network\Share\test.db"). - - Y - - - - Version - 3 - N - 3 - - - UseUTF16Encoding - True
False
- N - False -
- - DateTimeFormat - - Ticks - Use the value of DateTime.Ticks.
- ISO8601 - Use the ISO-8601 format. Uses the "yyyy-MM-dd HH:mm:ss.FFFFFFFK" format for UTC - DateTime values and "yyyy-MM-dd HH:mm:ss.FFFFFFF" format for local DateTime values).
- JulianDay - The interval of time in days and fractions of a day since January 1, 4713 BC.
- UnixEpoch - The whole number of seconds since the Unix epoch (January 1, 1970).
- InvariantCulture - Any culture-independent string value that the .NET Framework can interpret as a valid DateTime.
- CurrentCulture - Any string value that the .NET Framework can interpret as a valid DateTime using the current culture.
- N - ISO8601 -
- - DateTimeKind - Unspecified - Not specified as either UTC or local time.
Utc - The time represented is UTC.
Local - The time represented is local time.
- N - Unspecified -
- - DateTimeFormatString - The exact DateTime format string to use for all formatting and parsing of all DateTime - values for this connection. - N - null - - - BaseSchemaName - Some base data classes in the framework (e.g. those that build SQL queries dynamically) - assume that an ADO.NET provider cannot support an alternate catalog (i.e. database) without supporting - alternate schemas as well; however, SQLite does not fit into this model. Therefore, this value is used - as a placeholder and removed prior to preparing any SQL statements that may contain it. - N - sqlite_default_schema - - - BinaryGUID - True - Store GUID columns in binary form
False - Store GUID columns as text
- N - True -
- - Cache Size - {size in bytes} - N - 2000 - - - Synchronous - Normal - Normal file flushing behavior
Full - Full flushing after all writes
Off - Underlying OS flushes I/O's
- N - Full -
- - Page Size - {size in bytes} - N - 1024 - - - Password - {password} - Using this parameter requires that the CryptoAPI based codec be enabled at compile-time for both the native interop assembly and the core managed assemblies; otherwise, using this parameter may result in an exception being thrown when attempting to open the connection. - N - - - - HexPassword - {hexPassword} - Must contain a sequence of zero or more hexadecimal encoded byte values without a leading "0x" prefix. Using this parameter requires that the CryptoAPI based codec be enabled at compile-time for both the native interop assembly and the core managed assemblies; otherwise, using this parameter may result in an exception being thrown when attempting to open the connection. - N - - - - Enlist - Y - Automatically enlist in distributed transactions
N - No automatic enlistment
- N - Y -
- - Pooling - - True - Use connection pooling.
- False - Do not use connection pooling.

- WARNING: When using the default connection pool implementation, - setting this property to True should be avoided by applications that - make use of COM (either directly or indirectly) due to possible - deadlocks that can occur during the finalization of some COM objects. -
- N - False -
- - FailIfMissing - True - Don't create the database if it does not exist, throw an error instead
False - Automatically create the database if it does not exist
- N - False -
- - Max Page Count - {size in pages} - Limits the maximum number of pages (limits the size) of the database - N - 0 - - - Legacy Format - True - Use the more compatible legacy 3.x database format
False - Use the newer 3.3x database format which compresses numbers more effectively
- N - False -
- - Default Timeout - {time in seconds}
The default command timeout
- N - 30 -
- - Journal Mode - Delete - Delete the journal file after a commit
Persist - Zero out and leave the journal file on disk after a commit
Off - Disable the rollback journal entirely
- N - Delete -
- - Read Only - True - Open the database for read only access
False - Open the database for normal read/write access
- N - False -
- - Max Pool Size - The maximum number of connections for the given connection string that can be in the connection pool - N - 100 - - - Default IsolationLevel - The default transaciton isolation level - N - Serializable - - - Foreign Keys - Enable foreign key constraints - N - False - - - Flags - Extra behavioral flags for the connection. See the enumeration for possible values. - N - Default - - - SetDefaults - - True - Apply the default connection settings to the opened database.
- False - Skip applying the default connection settings to the opened database. -
- N - True -
- - ToFullPath - - True - Attempt to expand the data source file name to a fully qualified path before opening.
- False - Skip attempting to expand the data source file name to a fully qualified path before opening. -
- N - True -
-
-
-
- - - Returns the data source file name without extension or path. - - - - - Returns the string "main". - - - - - Gets/sets the default command timeout for newly-created commands. This is especially useful for - commands used internally such as inside a SQLiteTransaction, where setting the timeout is not possible. - This can also be set in the ConnectionString with "Default Timeout" - - - - - Non-zero if the built-in (i.e. framework provided) connection string - parser should be used when opening the connection. - - - - - Gets/sets the extra behavioral flags for this connection. See the - enumeration for a list of - possible values. - - - - - Returns non-zero if the underlying native connection handle is - owned by this instance. - - - - - Returns the version of the underlying SQLite database engine - - - - - Returns the rowid of the most recent successful INSERT into the database from this connection. - - - - - Returns the number of rows changed by the last INSERT, UPDATE, or DELETE statement executed on - this connection. - - - - - Returns non-zero if the given database connection is in autocommit mode. - Autocommit mode is on by default. Autocommit mode is disabled by a BEGIN - statement. Autocommit mode is re-enabled by a COMMIT or ROLLBACK. - - - - - Returns the amount of memory (in bytes) currently in use by the SQLite core library. - - - - - Returns the maximum amount of memory (in bytes) used by the SQLite core library since the high-water mark was last reset. - - - - - Returns a string containing the define constants (i.e. compile-time - options) used to compile the core managed assembly, delimited with - spaces. - - - - - Returns the version of the underlying SQLite core library. - - - - - This method returns the string whose value is the same as the - SQLITE_SOURCE_ID C preprocessor macro used when compiling the - SQLite core library. - - - - - Returns a string containing the compile-time options used to - compile the SQLite core native library, delimited with spaces. - - - - - This method returns the version of the interop SQLite assembly - used. If the SQLite interop assembly is not in use or the - necessary information cannot be obtained for any reason, a null - value may be returned. - - - - - This method returns the string whose value contains the unique - identifier for the source checkout used to build the interop - assembly. If the SQLite interop assembly is not in use or the - necessary information cannot be obtained for any reason, a null - value may be returned. - - - - - Returns a string containing the compile-time options used to - compile the SQLite interop assembly, delimited with spaces. - - - - - This method returns the version of the managed components used - to interact with the SQLite core library. If the necessary - information cannot be obtained for any reason, a null value may - be returned. - - - - - This method returns the string whose value contains the unique - identifier for the source checkout used to build the managed - components currently executing. If the necessary information - cannot be obtained for any reason, a null value may be returned. - - - - - Returns the state of the connection. - - - - - This event is raised whenever SQLite encounters an action covered by the - authorizer during query preparation. Changing the value of the - property will determine if - the specific action will be allowed, ignored, or denied. For the entire - duration of the event, the associated connection and statement objects - must not be modified, either directly or indirectly, by the called code. - - - - - This event is raised whenever SQLite makes an update/delete/insert into the database on - this connection. It only applies to the given connection. - - - - - This event is raised whenever SQLite is committing a transaction. - Return non-zero to trigger a rollback. - - - - - This event is raised whenever SQLite statement first begins executing on - this connection. It only applies to the given connection. - - - - - This event is raised whenever SQLite is rolling back a transaction. - - - - - Returns the instance. - - - - - The I/O file cache flushing behavior for the connection - - - - - Normal file flushing at critical sections of the code - - - - - Full file flushing after every write operation - - - - - Use the default operating system's file flushing, SQLite does not explicitly flush the file buffers after writing - - - - - Raised when authorization is required to perform an action contained - within a SQL query. - - The connection performing the action. - A that contains the - event data. - - - - Raised when a transaction is about to be committed. To roll back a transaction, set the - rollbackTrans boolean value to true. - - The connection committing the transaction - Event arguments on the transaction - - - - Raised when data is inserted, updated and deleted on a given connection - - The connection committing the transaction - The event parameters which triggered the event - - - - Raised when a statement first begins executing on a given connection - - The connection executing the statement - Event arguments of the trace - - - - Raised between each backup step. - - - The source database connection. - - - The source database name. - - - The destination database connection. - - - The destination database name. - - - The number of pages copied with each step. - - - The number of pages remaining to be copied. - - - The total number of pages in the source database. - - - Set to true if the operation needs to be retried due to database - locking issues; otherwise, set to false. - - - True to continue with the backup process or false to halt the backup - process, rolling back any changes that have been made so far. - - - - - The data associated with a call into the authorizer. - - - - - The user-defined native data associated with this event. Currently, - this will always contain the value of . - - - - - The action code responsible for the current call into the authorizer. - - - - - The first string argument for the current call into the authorizer. - The exact value will vary based on the action code, see the - enumeration for possible - values. - - - - - The second string argument for the current call into the authorizer. - The exact value will vary based on the action code, see the - enumeration for possible - values. - - - - - The database name for the current call into the authorizer, if - applicable. - - - - - The name of the inner-most trigger or view that is responsible for - the access attempt or a null value if this access attempt is directly - from top-level SQL code. - - - - - The return code for the current call into the authorizer. - - - - - Constructs an instance of this class with default property values. - - - - - Constructs an instance of this class with specific property values. - - - The user-defined native data associated with this event. - - - The authorizer action code. - - - The first authorizer argument. - - - The second authorizer argument. - - - The database name, if applicable. - - - The name of the inner-most trigger or view that is responsible for - the access attempt or a null value if this access attempt is directly - from top-level SQL code. - - - The authorizer return code. - - - - - Whenever an update event is triggered on a connection, this enum will indicate - exactly what type of operation is being performed. - - - - - A row is being deleted from the given database and table - - - - - A row is being inserted into the table. - - - - - A row is being updated in the table. - - - - - Passed during an Update callback, these event arguments detail the type of update operation being performed - on the given connection. - - - - - The name of the database being updated (usually "main" but can be any attached or temporary database) - - - - - The name of the table being updated - - - - - The type of update being performed (insert/update/delete) - - - - - The RowId affected by this update. - - - - - Event arguments raised when a transaction is being committed - - - - - Set to true to abort the transaction and trigger a rollback - - - - - Passed during an Trace callback, these event arguments contain the UTF-8 rendering of the SQL statement text - - - - - SQL statement text as the statement first begins executing - - - - - This interface represents a custom connection pool implementation - usable by System.Data.SQLite. - - - - - Counts the number of pool entries matching the specified file name. - - - The file name to match or null to match all files. - - - The pool entry counts for each matching file. - - - The total number of connections successfully opened from any pool. - - - The total number of connections successfully closed from any pool. - - - The total number of pool entries for all matching files. - - - - - Disposes of all pooled connections associated with the specified - database file name. - - - The database file name. - - - - - Disposes of all pooled connections. - - - - - Adds a connection to the pool of those associated with the - specified database file name. - - - The database file name. - - - The database connection handle. - - - The connection pool version at the point the database connection - handle was received from the connection pool. This is also the - connection pool version that the database connection handle was - created under. - - - - - Removes a connection from the pool of those associated with the - specified database file name with the intent of using it to - interact with the database. - - - The database file name. - - - The new maximum size of the connection pool for the specified - database file name. - - - The connection pool version associated with the returned database - connection handle, if any. - - - The database connection handle associated with the specified - database file name or null if it cannot be obtained. - - - - - This default method implementations in this class should not be used by - applications that make use of COM (either directly or indirectly) due - to possible deadlocks that can occur during finalization of some COM - objects. - - - - - This field is used to synchronize access to the private static data - in this class. - - - - - When this field is non-null, it will be used to provide the - implementation of all the connection pool methods; otherwise, - the default method implementations will be used. - - - - - The dictionary of connection pools, based on the normalized file - name of the SQLite database. - - - - - The default version number new pools will get. - - - - - The number of connections successfully opened from any pool. - This value is incremented by the Remove method. - - - - - The number of connections successfully closed from any pool. - This value is incremented by the Add method. - - - - - Counts the number of pool entries matching the specified file name. - - - The file name to match or null to match all files. - - - The pool entry counts for each matching file. - - - The total number of connections successfully opened from any pool. - - - The total number of connections successfully closed from any pool. - - - The total number of pool entries for all matching files. - - - - - Disposes of all pooled connections associated with the specified - database file name. - - - The database file name. - - - - - Disposes of all pooled connections. - - - - - Adds a connection to the pool of those associated with the - specified database file name. - - - The database file name. - - - The database connection handle. - - - The connection pool version at the point the database connection - handle was received from the connection pool. This is also the - connection pool version that the database connection handle was - created under. - - - - - Removes a connection from the pool of those associated with the - specified database file name with the intent of using it to - interact with the database. - - - The database file name. - - - The new maximum size of the connection pool for the specified - database file name. - - - The connection pool version associated with the returned database - connection handle, if any. - - - The database connection handle associated with the specified - database file name or null if it cannot be obtained. - - - - - This method is used to obtain a reference to the custom connection - pool implementation currently in use, if any. - - - The custom connection pool implementation or null if the default - connection pool implementation should be used. - - - - - This method is used to set the reference to the custom connection - pool implementation to use, if any. - - - The custom connection pool implementation to use or null if the - default connection pool implementation should be used. - - - - - We do not have to thread-lock anything in this function, because it - is only called by other functions above which already take the lock. - - - The pool queue to resize. - - - If a function intends to add to the pool, this is true, which - forces the resize to take one more than it needs from the pool. - - - - - Keeps track of connections made on a specified file. The PoolVersion - dictates whether old objects get returned to the pool or discarded - when no longer in use. - - - - - The queue of weak references to the actual database connection - handles. - - - - - This pool version associated with the database connection - handles in this pool queue. - - - - - The maximum size of this pool queue. - - - - - Constructs a connection pool queue using the specified version - and maximum size. Normally, all the database connection - handles in this pool are associated with a single database file - name. - - - The initial pool version for this connection pool queue. - - - The initial maximum size for this connection pool queue. - - - - - SQLite implementation of DbConnectionStringBuilder. - - - - - Properties of this class - - - - - Constructs a new instance of the class - - - Default constructor - - - - - Constructs a new instance of the class using the specified connection string. - - The connection string to parse - - - - Private initializer, which assigns the connection string and resets the builder - - The connection string to assign - - - - Helper function for retrieving values from the connectionstring - - The keyword to retrieve settings for - The resulting parameter value - Returns true if the value was found and returned - - - - Fallback method for MONO, which doesn't implement DbConnectionStringBuilder.GetProperties() - - The hashtable to fill with property descriptors - - - - Gets/Sets the default version of the SQLite engine to instantiate. Currently the only valid value is 3, indicating version 3 of the sqlite library. - - - - - Gets/Sets the synchronization mode (file flushing) of the connection string. Default is "Normal". - - - - - Gets/Sets the encoding for the connection string. The default is "False" which indicates UTF-8 encoding. - - - - - Gets/Sets whether or not to use connection pooling. The default is "False" - - - - - Gets/Sets whethor not to store GUID's in binary format. The default is True - which saves space in the database. - - - - - Gets/Sets the filename to open on the connection string. - - - - - An alternate to the data source property - - - - - An alternate to the data source property that uses the SQLite URI syntax. - - - - - Gets/sets the default command timeout for newly-created commands. This is especially useful for - commands used internally such as inside a SQLiteTransaction, where setting the timeout is not possible. - - - - - Determines whether or not the connection will automatically participate - in the current distributed transaction (if one exists) - - - - - If set to true, will throw an exception if the database specified in the connection - string does not exist. If false, the database will be created automatically. - - - - - If enabled, uses the legacy 3.xx format for maximum compatibility, but results in larger - database sizes. - - - - - When enabled, the database will be opened for read-only access and writing will be disabled. - - - - - Gets/sets the database encryption password - - - - - Gets/sets the database encryption hexadecimal password - - - - - Gets/Sets the page size for the connection. - - - - - Gets/Sets the maximum number of pages the database may hold - - - - - Gets/Sets the cache size for the connection. - - - - - Gets/Sets the DateTime format for the connection. - - - - - Gets/Sets the DateTime kind for the connection. - - - - - Gets/sets the DateTime format string used for formatting - and parsing purposes. - - - - - Gets/Sets the placeholder base schema name used for - .NET Framework compatibility purposes. - - - - - Determines how SQLite handles the transaction journal file. - - - - - Sets the default isolation level for transactions on the connection. - - - - - If enabled, use foreign key constraints - - - - - Gets/Sets the extra behavioral flags. - - - - - If enabled, apply the default connection settings to opened databases. - - - - - If enabled, attempt to resolve the provided data source file name to a - full path before opening. - - - - - SQLite has very limited types, and is inherently text-based. The first 5 types below represent the sum of all types SQLite - understands. The DateTime extension to the spec is for internal use only. - - - - - Not used - - - - - All integers in SQLite default to Int64 - - - - - All floating point numbers in SQLite default to double - - - - - The default data type of SQLite is text - - - - - Typically blob types are only seen when returned from a function - - - - - Null types can be returned from functions - - - - - Used internally by this provider - - - - - Used internally by this provider - - - - - These are the event types associated with the - - delegate (and its corresponding event) and the - class. - - - - - Not used. - - - - - Not used. - - - - - The connection is being opened. - - - - - The connection string has been parsed. - - - - - The connection was opened. - - - - - The method was called on the - connection. - - - - - A transaction was created using the connection. - - - - - The connection was enlisted into a transaction. - - - - - A command was created using the connection. - - - - - A data reader was created using the connection. - - - - - An instance of a derived class has - been created to wrap a native resource. - - - - - The connection is being closed. - - - - - The connection was closed. - - - - - This implementation of SQLite for ADO.NET can process date/time fields in - databases in one of six formats. - - - ISO8601 format is more compatible, readable, fully-processable, but less - accurate as it does not provide time down to fractions of a second. - JulianDay is the numeric format the SQLite uses internally and is arguably - the most compatible with 3rd party tools. It is not readable as text - without post-processing. Ticks less compatible with 3rd party tools that - query the database, and renders the DateTime field unreadable as text - without post-processing. UnixEpoch is more compatible with Unix systems. - InvariantCulture allows the configured format for the invariant culture - format to be used and is human readable. CurrentCulture allows the - configured format for the current culture to be used and is also human - readable. - - The preferred order of choosing a DateTime format is JulianDay, ISO8601, - and then Ticks. Ticks is mainly present for legacy code support. - - - - - Use the value of DateTime.Ticks. This value is not recommended and is not well supported with LINQ. - - - - - Use the ISO-8601 format. Uses the "yyyy-MM-dd HH:mm:ss.FFFFFFFK" format for UTC DateTime values and - "yyyy-MM-dd HH:mm:ss.FFFFFFF" format for local DateTime values). - - - - - The interval of time in days and fractions of a day since January 1, 4713 BC. - - - - - The whole number of seconds since the Unix epoch (January 1, 1970). - - - - - Any culture-independent string value that the .NET Framework can interpret as a valid DateTime. - - - - - Any string value that the .NET Framework can interpret as a valid DateTime using the current culture. - - - - - The default format for this provider. - - - - - This enum determines how SQLite treats its journal file. - - - By default SQLite will create and delete the journal file when needed during a transaction. - However, for some computers running certain filesystem monitoring tools, the rapid - creation and deletion of the journal file can cause those programs to fail, or to interfere with SQLite. - - If a program or virus scanner is interfering with SQLite's journal file, you may receive errors like "unable to open database file" - when starting a transaction. If this is happening, you may want to change the default journal mode to Persist. - - - - - The default mode, this causes SQLite to use the existing journaling mode for the database. - - - - - SQLite will create and destroy the journal file as-needed. - - - - - When this is set, SQLite will keep the journal file even after a transaction has completed. It's contents will be erased, - and the journal re-used as often as needed. If it is deleted, it will be recreated the next time it is needed. - - - - - This option disables the rollback journal entirely. Interrupted transactions or a program crash can cause database - corruption in this mode! - - - - - SQLite will truncate the journal file to zero-length instead of deleting it. - - - - - SQLite will store the journal in volatile RAM. This saves disk I/O but at the expense of database safety and integrity. - If the application using SQLite crashes in the middle of a transaction when the MEMORY journaling mode is set, then the - database file will very likely go corrupt. - - - - - SQLite uses a write-ahead log instead of a rollback journal to implement transactions. The WAL journaling mode is persistent; - after being set it stays in effect across multiple database connections and after closing and reopening the database. A database - in WAL journaling mode can only be accessed by SQLite version 3.7.0 or later. - - - - - Possible values for the "synchronous" database setting. This setting determines - how often the database engine calls the xSync method of the VFS. - - - - - Use the default "synchronous" database setting. Currently, this should be - the same as using the FULL mode. - - - - - The database engine continues without syncing as soon as it has handed - data off to the operating system. If the application running SQLite - crashes, the data will be safe, but the database might become corrupted - if the operating system crashes or the computer loses power before that - data has been written to the disk surface. - - - - - The database engine will still sync at the most critical moments, but - less often than in FULL mode. There is a very small (though non-zero) - chance that a power failure at just the wrong time could corrupt the - database in NORMAL mode. - - - - - The database engine will use the xSync method of the VFS to ensure that - all content is safely written to the disk surface prior to continuing. - This ensures that an operating system crash or power failure will not - corrupt the database. FULL synchronous is very safe, but it is also - slower. - - - - - The requested command execution type. This controls which method of the - object will be called. - - - - - Do nothing. No method will be called. - - - - - The command is not expected to return a result -OR- the result is not - needed. The or - method - will be called. - - - - - The command is expected to return a scalar result -OR- the result should - be limited to a scalar result. The - or method will - be called. - - - - - The command is expected to return result. - The or - method will - be called. - - - - - Use the default command execution type. Using this value is the same - as using the value. - - - - - The action code responsible for the current call into the authorizer. - - - - - No action is being performed. This value should not be used from - external code. - - - - - No longer used. - - - - - An index will be created. The action-specific arguments are the - index name and the table name. - - - - - - A table will be created. The action-specific arguments are the - table name and a null value. - - - - - A temporary index will be created. The action-specific arguments - are the index name and the table name. - - - - - A temporary table will be created. The action-specific arguments - are the table name and a null value. - - - - - A temporary trigger will be created. The action-specific arguments - are the trigger name and the table name. - - - - - A temporary view will be created. The action-specific arguments are - the view name and a null value. - - - - - A trigger will be created. The action-specific arguments are the - trigger name and the table name. - - - - - A view will be created. The action-specific arguments are the view - name and a null value. - - - - - A DELETE statement will be executed. The action-specific arguments - are the table name and a null value. - - - - - An index will be dropped. The action-specific arguments are the - index name and the table name. - - - - - A table will be dropped. The action-specific arguments are the tables - name and a null value. - - - - - A temporary index will be dropped. The action-specific arguments are - the index name and the table name. - - - - - A temporary table will be dropped. The action-specific arguments are - the table name and a null value. - - - - - A temporary trigger will be dropped. The action-specific arguments - are the trigger name and the table name. - - - - - A temporary view will be dropped. The action-specific arguments are - the view name and a null value. - - - - - A trigger will be dropped. The action-specific arguments are the - trigger name and the table name. - - - - - A view will be dropped. The action-specific arguments are the view - name and a null value. - - - - - An INSERT statement will be executed. The action-specific arguments - are the table name and a null value. - - - - - A PRAGMA statement will be executed. The action-specific arguments - are the name of the PRAGMA and the new value or a null value. - - - - - A table column will be read. The action-specific arguments are the - table name and the column name. - - - - - A SELECT statement will be executed. The action-specific arguments - are both null values. - - - - - A transaction will be started, committed, or rolled back. The - action-specific arguments are the name of the operation (BEGIN, - COMMIT, or ROLLBACK) and a null value. - - - - - An UPDATE statement will be executed. The action-specific arguments - are the table name and the column name. - - - - - A database will be attached to the connection. The action-specific - arguments are the database file name and a null value. - - - - - A database will be detached from the connection. The action-specific - arguments are the database name and a null value. - - - - - The schema of a table will be altered. The action-specific arguments - are the database name and the table name. - - - - - An index will be deleted and then recreated. The action-specific - arguments are the index name and a null value. - - - - - A table will be analyzed to gathers statistics about it. The - action-specific arguments are the table name and a null value. - - - - - A virtual table will be created. The action-specific arguments are - the table name and the module name. - - - - - A virtual table will be dropped. The action-specific arguments are - the table name and the module name. - - - - - A SQL function will be called. The action-specific arguments are a - null value and the function name. - - - - - A savepoint will be created, released, or rolled back. The - action-specific arguments are the name of the operation (BEGIN, - RELEASE, or ROLLBACK) and the savepoint name. - - - - - A recursive query will be executed. The action-specific arguments - are two null values. - - - - - The return code for the current call into the authorizer. - - - - - The action will be allowed. - - - - - The overall action will be disallowed and an error message will be - returned from the query preparation method. - - - - - The specific action will be disallowed; however, the overall action - will continue. The exact effects of this return code vary depending - on the specific action, please refer to the SQLite core library - documentation for futher details. - - - - - Class used internally to determine the datatype of a column in a resultset - - - - - The DbType of the column, or DbType.Object if it cannot be determined - - - - - The affinity of a column, used for expressions or when Type is DbType.Object - - - - - SQLite implementation of DbDataAdapter. - - - - - This class is just a shell around the DbDataAdapter. Nothing from - DbDataAdapter is overridden here, just a few constructors are defined. - - - Default constructor. - - - - - Constructs a data adapter using the specified select command. - - - The select command to associate with the adapter. - - - - - Constructs a data adapter with the supplied select command text and - associated with the specified connection. - - - The select command text to associate with the data adapter. - - - The connection to associate with the select command. - - - - - Constructs a data adapter with the specified select command text, - and using the specified database connection string. - - - The select command text to use to construct a select command. - - - A connection string suitable for passing to a new SQLiteConnection, - which is associated with the select command. - - - - - Constructs a data adapter with the specified select command text, - and using the specified database connection string. - - - The select command text to use to construct a select command. - - - A connection string suitable for passing to a new SQLiteConnection, - which is associated with the select command. - - - Non-zero to parse the connection string using the built-in (i.e. - framework provided) parser when opening the connection. - - - - - Raised by the underlying DbDataAdapter when a row is being updated - - The event's specifics - - - - Raised by DbDataAdapter after a row is updated - - The event's specifics - - - - Row updating event handler - - - - - Row updated event handler - - - - - Gets/sets the select command for this DataAdapter - - - - - Gets/sets the insert command for this DataAdapter - - - - - Gets/sets the update command for this DataAdapter - - - - - Gets/sets the delete command for this DataAdapter - - - - - SQLite implementation of DbDataReader. - - - - - Underlying command this reader is attached to - - - - - Index of the current statement in the command being processed - - - - - Current statement being Read() - - - - - State of the current statement being processed. - -1 = First Step() executed, so the first Read() will be ignored - 0 = Actively reading - 1 = Finished reading - 2 = Non-row-returning statement, no records - - - - - Number of records affected by the insert/update statements executed on the command - - - - - Count of fields (columns) in the row-returning statement currently being processed - - - - - Maps the field (column) names to their corresponding indexes within the results. - - - - - Datatypes of active fields (columns) in the current statement, used for type-restricting data - - - - - The behavior of the datareader - - - - - If set, then dispose of the command object when the reader is finished - - - - - If set, then raise an exception when the object is accessed after being disposed. - - - - - An array of rowid's for the active statement if CommandBehavior.KeyInfo is specified - - - - - Matches the version of the connection. - - - - - The "stub" (i.e. placeholder) base schema name to use when returning - column schema information. Matches the base schema name used by the - associated connection. - - - - - Internal constructor, initializes the datareader and sets up to begin executing statements - - The SQLiteCommand this data reader is for - The expected behavior of the data reader - - - - Dispose of all resources used by this datareader. - - - - - - Closes the datareader, potentially closing the connection as well if CommandBehavior.CloseConnection was specified. - - - - - Throw an error if the datareader is closed - - - - - Throw an error if a row is not loaded - - - - - Enumerator support - - Returns a DbEnumerator object. - - - - SQLite is inherently un-typed. All datatypes in SQLite are natively strings. The definition of the columns of a table - and the affinity of returned types are all we have to go on to type-restrict data in the reader. - - This function attempts to verify that the type of data being requested of a column matches the datatype of the column. In - the case of columns that are not backed into a table definition, we attempt to match up the affinity of a column (int, double, string or blob) - to a set of known types that closely match that affinity. It's not an exact science, but its the best we can do. - - - This function throws an InvalidTypeCast() exception if the requested type doesn't match the column's definition or affinity. - - The index of the column to type-check - The type we want to get out of the column - - - - Retrieves the column as a boolean value - - The index of the column to retrieve - bool - - - - Retrieves the column as a single byte value - - The index of the column to retrieve - byte - - - - Retrieves a column as an array of bytes (blob) - - The index of the column to retrieve - The zero-based index of where to begin reading the data - The buffer to write the bytes into - The zero-based index of where to begin writing into the array - The number of bytes to retrieve - The actual number of bytes written into the array - - To determine the number of bytes in the column, pass a null value for the buffer. The total length will be returned. - - - - - Returns the column as a single character - - The index of the column to retrieve - char - - - - Retrieves a column as an array of chars (blob) - - The index of the column to retrieve - The zero-based index of where to begin reading the data - The buffer to write the characters into - The zero-based index of where to begin writing into the array - The number of bytes to retrieve - The actual number of characters written into the array - - To determine the number of characters in the column, pass a null value for the buffer. The total length will be returned. - - - - - Retrieves the name of the back-end datatype of the column - - The index of the column to retrieve - string - - - - Retrieve the column as a date/time value - - The index of the column to retrieve - DateTime - - - - Retrieve the column as a decimal value - - The index of the column to retrieve - decimal - - - - Returns the column as a double - - The index of the column to retrieve - double - - - - Returns the .NET type of a given column - - The index of the column to retrieve - Type - - - - Returns a column as a float value - - The index of the column to retrieve - float - - - - Returns the column as a Guid - - The index of the column to retrieve - Guid - - - - Returns the column as a short - - The index of the column to retrieve - Int16 - - - - Retrieves the column as an int - - The index of the column to retrieve - Int32 - - - - Retrieves the column as a long - - The index of the column to retrieve - Int64 - - - - Retrieves the name of the column - - The index of the column to retrieve - string - - - - Retrieves the i of a column, given its name - - The name of the column to retrieve - The int i of the column - - - - Schema information in SQLite is difficult to map into .NET conventions, so a lot of work must be done - to gather the necessary information so it can be represented in an ADO.NET manner. - - Returns a DataTable containing the schema information for the active SELECT statement being processed. - - - - Retrieves the column as a string - - The index of the column to retrieve - string - - - - Retrieves the column as an object corresponding to the underlying datatype of the column - - The index of the column to retrieve - object - - - - Retreives the values of multiple columns, up to the size of the supplied array - - The array to fill with values from the columns in the current resultset - The number of columns retrieved - - - - Returns a collection containing all the column names and values for the - current row of data in the current resultset, if any. If there is no - current row or no current resultset, an exception may be thrown. - - - The collection containing the column name and value information for the - current row of data in the current resultset or null if this information - cannot be obtained. - - - - - Returns True if the specified column is null - - The index of the column to retrieve - True or False - - - - Moves to the next resultset in multiple row-returning SQL command. - - True if the command was successful and a new resultset is available, False otherwise. - - - - This method attempts to query the database connection associated with - the data reader in use. If the underlying command or connection is - unavailable, a null value will be returned. - - - The connection object -OR- null if it is unavailable. - - - - - This method attempts to query the flags associated with the database - connection in use. If the database connection is disposed, the default - flags will be returned. - - - The data reader containing the databse connection to query the flags from. - - - The connection flags value. - - - - - Retrieves the SQLiteType for a given column, and caches it to avoid repetetive interop calls. - - The index of the column to retrieve - A SQLiteType structure - - - - Reads the next row from the resultset - - True if a new row was successfully loaded and is ready for processing - - - - Not implemented. Returns 0 - - - - - Returns the number of columns in the current resultset - - - - - Returns the number of visible fields in the current resultset - - - - - Returns True if the resultset has rows that can be fetched - - - - - Returns True if the data reader is closed - - - - - Retrieve the count of records affected by an update/insert command. Only valid once the data reader is closed! - - - - - Indexer to retrieve data from a column given its name - - The name of the column to retrieve data for - The value contained in the column - - - - Indexer to retrieve data from a column given its i - - The index of the column to retrieve - The value contained in the column - - - - SQLite exception class. - - - - - Private constructor for use with serialization. - - - Holds the serialized object data about the exception being thrown. - - - Contains contextual information about the source or destination. - - - - - Public constructor for generating a SQLite exception given the error - code and message. - - - The SQLite return code to report. - - - Message text to go along with the return code message text. - - - - - Public constructor that uses the base class constructor for the error - message. - - Error message text. - - - - Public constructor that uses the default base class constructor. - - - - - Public constructor that uses the base class constructor for the error - message and inner exception. - - Error message text. - The original (inner) exception. - - - - Adds extra information to the serialized object data specific to this - class type. This is only used for serialization. - - - Holds the serialized object data about the exception being thrown. - - - Contains contextual information about the source or destination. - - - - - Returns the error message for the specified SQLite return code. - - The SQLite return code. - The error message or null if it cannot be found. - - - - Returns the composite error message based on the SQLite return code - and the optional detailed error message. - - The SQLite return code. - Optional detailed error message. - Error message text for the return code. - - - - Gets the associated SQLite result code for this exception as a - . This property returns the same - underlying value as the property. - - - - - Gets the associated SQLite return code for this exception as an - . For desktop versions of the .NET Framework, - this property overrides the property of the same name within the - - class. This property returns the same underlying value as the - property. - - - - - SQLite error codes. Actually, this enumeration represents a return code, - which may also indicate success in one of several ways (e.g. SQLITE_OK, - SQLITE_ROW, and SQLITE_DONE). Therefore, the name of this enumeration is - something of a misnomer. - - - - - The error code is unknown. This error code - is only used by the managed wrapper itself. - - - - - Successful result - - - - - SQL error or missing database - - - - - Internal logic error in SQLite - - - - - Access permission denied - - - - - Callback routine requested an abort - - - - - The database file is locked - - - - - A table in the database is locked - - - - - A malloc() failed - - - - - Attempt to write a readonly database - - - - - Operation terminated by sqlite3_interrupt() - - - - - Some kind of disk I/O error occurred - - - - - The database disk image is malformed - - - - - Unknown opcode in sqlite3_file_control() - - - - - Insertion failed because database is full - - - - - Unable to open the database file - - - - - Database lock protocol error - - - - - Database is empty - - - - - The database schema changed - - - - - String or BLOB exceeds size limit - - - - - Abort due to constraint violation - - - - - Data type mismatch - - - - - Library used incorrectly - - - - - Uses OS features not supported on host - - - - - Authorization denied - - - - - Auxiliary database format error - - - - - 2nd parameter to sqlite3_bind out of range - - - - - File opened that is not a database file - - - - - Notifications from sqlite3_log() - - - - - Warnings from sqlite3_log() - - - - - sqlite3_step() has another row ready - - - - - sqlite3_step() has finished executing - - - - - Used to mask off extended result codes - - - - - SQLite implementation of . - - - SQLite implementation of . - - - - - Constructs a new instance. - - - - - Static instance member which returns an instanced class. - - - - - Creates and returns a new object. - - The new object. - - - - Creates and returns a new object. - - The new object. - - - - Creates and returns a new object. - - The new object. - - - - Creates and returns a new object. - - The new object. - - - - Creates and returns a new object. - - The new object. - - - - Creates and returns a new object. - - The new object. - - - - Will provide a object in .NET 3.5. - - The class or interface type to query for. - - - - - This event is raised whenever SQLite raises a logging event. - Note that this should be set as one of the first things in the - application. This event is provided for backward compatibility only. - New code should use the class instead. - - - - - This abstract class is designed to handle user-defined functions easily. An instance of the derived class is made for each - connection to the database. - - - Although there is one instance of a class derived from SQLiteFunction per database connection, the derived class has no access - to the underlying connection. This is necessary to deter implementers from thinking it would be a good idea to make database - calls during processing. - - It is important to distinguish between a per-connection instance, and a per-SQL statement context. One instance of this class - services all SQL statements being stepped through on that connection, and there can be many. One should never store per-statement - information in member variables of user-defined function classes. - - For aggregate functions, always create and store your per-statement data in the contextData object on the 1st step. This data will - be automatically freed for you (and Dispose() called if the item supports IDisposable) when the statement completes. - - - - - The base connection this function is attached to - - - - - Internal array used to keep track of aggregate function context data - - - - - The connection flags associated with this object (this should be the - same value as the flags associated with the parent connection object). - - - - - Holds a reference to the callback function for user functions - - - - - Holds a reference to the callbakc function for stepping in an aggregate function - - - - - Holds a reference to the callback function for finalizing an aggregate function - - - - - Holds a reference to the callback function for collation sequences - - - - - Current context of the current callback. Only valid during a callback - - - - - This static list contains all the user-defined functions declared using the proper attributes. - - - - - Internal constructor, initializes the function's internal variables. - - - - - Constructs an instance of this class using the specified data-type - conversion parameters. - - - The DateTime format to be used when converting string values to a - DateTime and binding DateTime parameters. - - - The to be used when creating DateTime - values. - - - The format string to be used when parsing and formatting DateTime - values. - - - Non-zero to create a UTF-16 data-type conversion context; otherwise, - a UTF-8 data-type conversion context will be created. - - - - - Disposes of any active contextData variables that were not automatically cleaned up. Sometimes this can happen if - someone closes the connection while a DataReader is open. - - - - - Placeholder for a user-defined disposal routine - - True if the object is being disposed explicitly - - - - Scalar functions override this method to do their magic. - - - Parameters passed to functions have only an affinity for a certain data type, there is no underlying schema available - to force them into a certain type. Therefore the only types you will ever see as parameters are - DBNull.Value, Int64, Double, String or byte[] array. - - The arguments for the command to process - You may return most simple types as a return value, null or DBNull.Value to return null, DateTime, or - you may return an Exception-derived class if you wish to return an error to SQLite. Do not actually throw the error, - just return it! - - - - Aggregate functions override this method to do their magic. - - - Typically you'll be updating whatever you've placed in the contextData field and returning as quickly as possible. - - The arguments for the command to process - The 1-based step number. This is incrememted each time the step method is called. - A placeholder for implementers to store contextual data pertaining to the current context. - - - - Aggregate functions override this method to finish their aggregate processing. - - - If you implemented your aggregate function properly, - you've been recording and keeping track of your data in the contextData object provided, and now at this stage you should have - all the information you need in there to figure out what to return. - NOTE: It is possible to arrive here without receiving a previous call to Step(), in which case the contextData will - be null. This can happen when no rows were returned. You can either return null, or 0 or some other custom return value - if that is the case. - - Your own assigned contextData, provided for you so you can return your final results. - You may return most simple types as a return value, null or DBNull.Value to return null, DateTime, or - you may return an Exception-derived class if you wish to return an error to SQLite. Do not actually throw the error, - just return it! - - - - - User-defined collation sequences override this method to provide a custom string sorting algorithm. - - The first string to compare - The second strnig to compare - 1 if param1 is greater than param2, 0 if they are equal, or -1 if param1 is less than param2 - - - - Converts an IntPtr array of context arguments to an object array containing the resolved parameters the pointers point to. - - - Parameters passed to functions have only an affinity for a certain data type, there is no underlying schema available - to force them into a certain type. Therefore the only types you will ever see as parameters are - DBNull.Value, Int64, Double, String or byte[] array. - - The number of arguments - A pointer to the array of arguments - An object array of the arguments once they've been converted to .NET values - - - - Takes the return value from Invoke() and Final() and figures out how to return it to SQLite's context. - - The context the return value applies to - The parameter to return to SQLite - - - - Internal scalar callback function, which wraps the raw context pointer and calls the virtual Invoke() method. - WARNING: Must not throw exceptions. - - A raw context pointer - Number of arguments passed in - A pointer to the array of arguments - - - - Internal collation sequence function, which wraps up the raw string pointers and executes the Compare() virtual function. - WARNING: Must not throw exceptions. - - Not used - Length of the string pv1 - Pointer to the first string to compare - Length of the string pv2 - Pointer to the second string to compare - Returns -1 if the first string is less than the second. 0 if they are equal, or 1 if the first string is greater - than the second. Returns 0 if an exception is caught. - - - - Internal collation sequence function, which wraps up the raw string pointers and executes the Compare() virtual function. - WARNING: Must not throw exceptions. - - Not used - Length of the string pv1 - Pointer to the first string to compare - Length of the string pv2 - Pointer to the second string to compare - Returns -1 if the first string is less than the second. 0 if they are equal, or 1 if the first string is greater - than the second. Returns 0 if an exception is caught. - - - - The internal aggregate Step function callback, which wraps the raw context pointer and calls the virtual Step() method. - WARNING: Must not throw exceptions. - - - This function takes care of doing the lookups and getting the important information put together to call the Step() function. - That includes pulling out the user's contextData and updating it after the call is made. We use a sorted list for this so - binary searches can be done to find the data. - - A raw context pointer - Number of arguments passed in - A pointer to the array of arguments - - - - An internal aggregate Final function callback, which wraps the context pointer and calls the virtual Final() method. - WARNING: Must not throw exceptions. - - A raw context pointer - - - - Using reflection, enumerate all assemblies in the current appdomain looking for classes that - have a SQLiteFunctionAttribute attribute, and registering them accordingly. - - - - - Manual method of registering a function. The type must still have the SQLiteFunctionAttributes in order to work - properly, but this is a workaround for the Compact Framework where enumerating assemblies is not currently supported. - - The type of the function to register - - - - Called by SQLiteBase derived classes, this function binds all user-defined functions to a connection. - It is done this way so that all user-defined functions will access the database using the same encoding scheme - as the connection (UTF-8 or UTF-16). - - - The wrapper functions that interop with SQLite will create a unique cookie value, which internally is a pointer to - all the wrapped callback functions. The interop function uses it to map CDecl callbacks to StdCall callbacks. - - The base object on which the functions are to bind - The flags associated with the parent connection object - Returns a logical list of functions which the connection should retain until it is closed. - - - - This function binds a user-defined functions to a connection. - - - The object instance associated with the - that the function should be bound to. - - - The object instance containing - the metadata for the function to be bound. - - - The object instance that implements the - function to be bound. - - - The flags associated with the parent connection object. - - - - - Returns a reference to the underlying connection's SQLiteConvert class, which can be used to convert - strings and DateTime's into the current connection's encoding schema. - - - - - Extends SQLiteFunction and allows an inherited class to obtain the collating sequence associated with a function call. - - - User-defined functions can call the GetCollationSequence() method in this class and use it to compare strings and char arrays. - - - - - Obtains the collating sequence in effect for the given function. - - - - - - The type of user-defined function to declare - - - - - Scalar functions are designed to be called and return a result immediately. Examples include ABS(), Upper(), Lower(), etc. - - - - - Aggregate functions are designed to accumulate data until the end of a call and then return a result gleaned from the accumulated data. - Examples include SUM(), COUNT(), AVG(), etc. - - - - - Collation sequences are used to sort textual data in a custom manner, and appear in an ORDER BY clause. Typically text in an ORDER BY is - sorted using a straight case-insensitive comparison function. Custom collating sequences can be used to alter the behavior of text sorting - in a user-defined manner. - - - - - An internal callback delegate declaration. - - Raw native context pointer for the user function. - Total number of arguments to the user function. - Raw native pointer to the array of raw native argument pointers. - - - - An internal final callback delegate declaration. - - Raw context pointer for the user function - - - - Internal callback delegate for implementing collation sequences - - Not used - Length of the string pv1 - Pointer to the first string to compare - Length of the string pv2 - Pointer to the second string to compare - Returns -1 if the first string is less than the second. 0 if they are equal, or 1 if the first string is greater - than the second. - - - - The type of collating sequence - - - - - The built-in BINARY collating sequence - - - - - The built-in NOCASE collating sequence - - - - - The built-in REVERSE collating sequence - - - - - A custom user-defined collating sequence - - - - - The encoding type the collation sequence uses - - - - - The collation sequence is UTF8 - - - - - The collation sequence is UTF16 little-endian - - - - - The collation sequence is UTF16 big-endian - - - - - A struct describing the collating sequence a function is executing in - - - - - The name of the collating sequence - - - - - The type of collating sequence - - - - - The text encoding of the collation sequence - - - - - Context of the function that requested the collating sequence - - - - - Calls the base collating sequence to compare two strings - - The first string to compare - The second string to compare - -1 if s1 is less than s2, 0 if s1 is equal to s2, and 1 if s1 is greater than s2 - - - - Calls the base collating sequence to compare two character arrays - - The first array to compare - The second array to compare - -1 if c1 is less than c2, 0 if c1 is equal to c2, and 1 if c1 is greater than c2 - - - - A simple custom attribute to enable us to easily find user-defined functions in - the loaded assemblies and initialize them in SQLite as connections are made. - - - - - Default constructor, initializes the internal variables for the function. - - - - - Constructs an instance of this class. - - - The name of the function, as seen by the SQLite core library. - - - The number of arguments that the function will accept. - - - The type of function being declared. This will either be Scalar, - Aggregate, or Collation. - - - - - The function's name as it will be used in SQLite command text. - - - - - The number of arguments this function expects. -1 if the number of arguments is variable. - - - - - The type of function this implementation will be. - - - - - The object instance that describes the class - containing the implementation for the associated function. - - - - - This class provides key info for a given SQLite statement. - - Providing key information for a given statement is non-trivial :( - - - - - - This function does all the nasty work at determining what keys need to be returned for - a given statement. - - - - - - - - Make sure all the subqueries are open and ready and sync'd with the current rowid - of the table they're supporting - - - - - Release any readers on any subqueries - - - - - Append all the columns we've added to the original query to the schema - - - - - - How many additional columns of keyinfo we're holding - - - - - Used to support CommandBehavior.KeyInfo - - - - - A single sub-query for a given table/database. - - - - - Event data for logging event handlers. - - - - - The error code. The type of this object value should be - or . - - - - - SQL statement text as the statement first begins executing - - - - - Extra data associated with this event, if any. - - - - - Constructs the object. - - Should be null. - - The error code. The type of this object value should be - or . - - The error message, if any. - The extra data, if any. - - - - Raised when a log event occurs. - - The current connection - Event arguments of the trace - - - - Manages the SQLite custom logging functionality and the associated - callback for the whole process. - - - - - Object used to synchronize access to the static instance data - for this class. - - - - - Member variable to store the AppDomain.DomainUnload event handler. - - - - - The default log event handler. - - - - - The log callback passed to native SQLite engine. This must live - as long as the SQLite library has a pointer to it. - - - - - The base SQLite object to interop with. - - - - - This will be non-zero if logging is currently enabled. - - - - - Initializes the SQLite logging facilities. - - - - - Handles the AppDomain being unloaded. - - Should be null. - The data associated with this event. - - - - Log a message to all the registered log event handlers without going - through the SQLite library. - - The message to be logged. - - - - Log a message to all the registered log event handlers without going - through the SQLite library. - - The SQLite error code. - The message to be logged. - - - - Log a message to all the registered log event handlers without going - through the SQLite library. - - The integer error code. - The message to be logged. - - - - Log a message to all the registered log event handlers without going - through the SQLite library. - - - The error code. The type of this object value should be - System.Int32 or SQLiteErrorCode. - - The message to be logged. - - - - Creates and initializes the default log event handler. - - - - - Adds the default log event handler to the list of handlers. - - - - - Removes the default log event handler from the list of handlers. - - - - - Internal proxy function that calls any registered application log - event handlers. - - WARNING: This method is used more-or-less directly by native code, - do not modify its type signature. - - - The extra data associated with this message, if any. - - - The error code associated with this message. - - - The message string to be logged. - - - - - Default logger. Currently, uses the Trace class (i.e. sends events - to the current trace listeners, if any). - - Should be null. - The data associated with this event. - - - - Member variable to store the application log handler to call. - - - - - This event is raised whenever SQLite raises a logging event. - Note that this should be set as one of the first things in the - application. - - - - - If this property is true, logging is enabled; otherwise, logging is - disabled. When logging is disabled, no logging events will fire. - - - - - MetaDataCollections specific to SQLite - - - - - Returns a list of databases attached to the connection - - - - - Returns column information for the specified table - - - - - Returns index information for the optionally-specified table - - - - - Returns base columns for the given index - - - - - Returns the tables in the given catalog - - - - - Returns user-defined views in the given catalog - - - - - Returns underlying column information on the given view - - - - - Returns foreign key information for the given catalog - - - - - Returns the triggers on the database - - - - - SQLite implementation of DbParameter. - - - - - The data type of the parameter - - - - - The version information for mapping the parameter - - - - - The value of the data in the parameter - - - - - The source column for the parameter - - - - - The column name - - - - - The data size, unused by SQLite - - - - - Default constructor - - - - - Constructs a named parameter given the specified parameter name - - The parameter name - - - - Constructs a named parameter given the specified parameter name and initial value - - The parameter name - The initial value of the parameter - - - - Constructs a named parameter of the specified type - - The parameter name - The datatype of the parameter - - - - Constructs a named parameter of the specified type and source column reference - - The parameter name - The data type - The source column - - - - Constructs a named parameter of the specified type, source column and row version - - The parameter name - The data type - The source column - The row version information - - - - Constructs an unnamed parameter of the specified data type - - The datatype of the parameter - - - - Constructs an unnamed parameter of the specified data type and sets the initial value - - The datatype of the parameter - The initial value of the parameter - - - - Constructs an unnamed parameter of the specified data type and source column - - The datatype of the parameter - The source column - - - - Constructs an unnamed parameter of the specified data type, source column and row version - - The data type - The source column - The row version information - - - - Constructs a named parameter of the specified type and size - - The parameter name - The data type - The size of the parameter - - - - Constructs a named parameter of the specified type, size and source column - - The name of the parameter - The data type - The size of the parameter - The source column - - - - Constructs a named parameter of the specified type, size, source column and row version - - The name of the parameter - The data type - The size of the parameter - The source column - The row version information - - - - Constructs a named parameter of the specified type, size, source column and row version - - The name of the parameter - The data type - The size of the parameter - Only input parameters are supported in SQLite - Ignored - Ignored - Ignored - The source column - The row version information - The initial value to assign the parameter - - - - Constructs a named parameter, yet another flavor - - The name of the parameter - The data type - The size of the parameter - Only input parameters are supported in SQLite - Ignored - Ignored - The source column - The row version information - Whether or not this parameter is for comparing NULL's - The intial value to assign the parameter - - - - Constructs an unnamed parameter of the specified type and size - - The data type - The size of the parameter - - - - Constructs an unnamed parameter of the specified type, size, and source column - - The data type - The size of the parameter - The source column - - - - Constructs an unnamed parameter of the specified type, size, source column and row version - - The data type - The size of the parameter - The source column - The row version information - - - - Resets the DbType of the parameter so it can be inferred from the value - - - - - Clones a parameter - - A new, unassociated SQLiteParameter - - - - Whether or not the parameter can contain a null value - - - - - Returns the datatype of the parameter - - - - - Supports only input parameters - - - - - Returns the parameter name - - - - - Returns the size of the parameter - - - - - Gets/sets the source column - - - - - Used by DbCommandBuilder to determine the mapping for nullable fields - - - - - Gets and sets the row version - - - - - Gets and sets the parameter value. If no datatype was specified, the datatype will assume the type from the value given. - - - - - SQLite implementation of DbParameterCollection. - - - - - The underlying command to which this collection belongs - - - - - The internal array of parameters in this collection - - - - - Determines whether or not all parameters have been bound to their statement(s) - - - - - Initializes the collection - - The command to which the collection belongs - - - - Retrieves an enumerator for the collection - - An enumerator for the underlying array - - - - Adds a parameter to the collection - - The parameter name - The data type - The size of the value - The source column - A SQLiteParameter object - - - - Adds a parameter to the collection - - The parameter name - The data type - The size of the value - A SQLiteParameter object - - - - Adds a parameter to the collection - - The parameter name - The data type - A SQLiteParameter object - - - - Adds a parameter to the collection - - The parameter to add - A zero-based index of where the parameter is located in the array - - - - Adds a parameter to the collection - - The parameter to add - A zero-based index of where the parameter is located in the array - - - - Adds a named/unnamed parameter and its value to the parameter collection. - - Name of the parameter, or null to indicate an unnamed parameter - The initial value of the parameter - Returns the SQLiteParameter object created during the call. - - - - Adds an array of parameters to the collection - - The array of parameters to add - - - - Adds an array of parameters to the collection - - The array of parameters to add - - - - Clears the array and resets the collection - - - - - Determines if the named parameter exists in the collection - - The name of the parameter to check - True if the parameter is in the collection - - - - Determines if the parameter exists in the collection - - The SQLiteParameter to check - True if the parameter is in the collection - - - - Not implemented - - - - - - - Retrieve a parameter by name from the collection - - The name of the parameter to fetch - A DbParameter object - - - - Retrieves a parameter by its index in the collection - - The index of the parameter to retrieve - A DbParameter object - - - - Returns the index of a parameter given its name - - The name of the parameter to find - -1 if not found, otherwise a zero-based index of the parameter - - - - Returns the index of a parameter - - The parameter to find - -1 if not found, otherwise a zero-based index of the parameter - - - - Inserts a parameter into the array at the specified location - - The zero-based index to insert the parameter at - The parameter to insert - - - - Removes a parameter from the collection - - The parameter to remove - - - - Removes a parameter from the collection given its name - - The name of the parameter to remove - - - - Removes a parameter from the collection given its index - - The zero-based parameter index to remove - - - - Re-assign the named parameter to a new parameter object - - The name of the parameter to replace - The new parameter - - - - Re-assign a parameter at the specified index - - The zero-based index of the parameter to replace - The new parameter - - - - Un-binds all parameters from their statements - - - - - This function attempts to map all parameters in the collection to all statements in a Command. - Since named parameters may span multiple statements, this function makes sure all statements are bound - to the same named parameter. Unnamed parameters are bound in sequence. - - - - - Returns false - - - - - Returns false - - - - - Returns false - - - - - Returns null - - - - - Returns a count of parameters in the collection - - - - - Overloaded to specialize the return value of the default indexer - - Name of the parameter to get/set - The specified named SQLite parameter - - - - Overloaded to specialize the return value of the default indexer - - The index of the parameter to get/set - The specified SQLite parameter - - - - Represents a single SQL statement in SQLite. - - - - - The underlying SQLite object this statement is bound to - - - - - The command text of this SQL statement - - - - - The actual statement pointer - - - - - An index from which unnamed parameters begin - - - - - Names of the parameters as SQLite understands them to be - - - - - Parameters for this statement - - - - - Command this statement belongs to (if any) - - - - - The flags associated with the parent connection object. - - - - - Initializes the statement and attempts to get all information about parameters in the statement - - The base SQLite object - The flags associated with the parent connection object - The statement - The command text for this statement - The previous command in a multi-statement command - - - - Disposes and finalizes the statement - - - - - If the underlying database connection is open, fetches the number of changed rows - resulting from the most recent query; otherwise, does nothing. - - - The number of changes when true is returned. - Undefined if false is returned. - - Non-zero if the number of changed rows was fetched. - - - - Called by SQLiteParameterCollection, this function determines if the specified parameter name belongs to - this statement, and if so, keeps a reference to the parameter so it can be bound later. - - The parameter name to map - The parameter to assign it - - - - Bind all parameters, making sure the caller didn't miss any - - - - - Attempts to convert an arbitrary object to the Boolean data type. - Null object values are converted to false. Throws a SQLiteException - upon failure. - - The object value to convert. - The format provider to use. - The converted boolean value. - - - - Perform the bind operation for an individual parameter - - The index of the parameter to bind - The parameter we're binding - - - - SQLite implementation of DbTransaction. - - - - - The connection to which this transaction is bound - - - - - Constructs the transaction object, binding it to the supplied connection - - The connection to open a transaction on - TRUE to defer the writelock, or FALSE to lock immediately - - - - Disposes the transaction. If it is currently active, any changes are rolled back. - - - - - Commits the current transaction. - - - - - Rolls back the active transaction. - - - - - Returns the underlying connection to which this transaction applies. - - - - - Forwards to the local Connection property - - - - - Gets the isolation level of the transaction. SQLite only supports Serializable transactions. - - - - - A strongly-typed resource class, for looking up localized strings, etc. - - - - - Returns the cached ResourceManager instance used by this class. - - - - - Overrides the current thread's CurrentUICulture property for all - resource lookups using this strongly typed resource class. - - - - - Looks up a localized string similar to <?xml version="1.0" standalone="yes"?> - <DocumentElement> - <DataTypes> - <TypeName>smallint</TypeName> - <ProviderDbType>10</ProviderDbType> - <ColumnSize>5</ColumnSize> - <DataType>System.Int16</DataType> - <CreateFormat>smallint</CreateFormat> - <IsAutoIncrementable>false</IsAutoIncrementable> - <IsCaseSensitive>false</IsCaseSensitive> - <IsFixedLength>true</IsFixedLength> - <IsFixedPrecisionScale>true</IsFixedPrecisionScale> - <IsLong>false</IsLong> - <IsNullable>true</ [rest of string was truncated]";. - - - - - Looks up a localized string similar to ALL,ALTER,AND,AS,AUTOINCREMENT,BETWEEN,BY,CASE,CHECK,COLLATE,COMMIT,CONSTRAINT,CREATE,CROSS,DEFAULT,DEFERRABLE,DELETE,DISTINCT,DROP,ELSE,ESCAPE,EXCEPT,FOREIGN,FROM,FULL,GROUP,HAVING,IN,INDEX,INNER,INSERT,INTERSECT,INTO,IS,ISNULL,JOIN,LEFT,LIMIT,NATURAL,NOT,NOTNULL,NULL,ON,OR,ORDER,OUTER,PRIMARY,REFERENCES,RIGHT,ROLLBACK,SELECT,SET,TABLE,THEN,TO,TRANSACTION,UNION,UNIQUE,UPDATE,USING,VALUES,WHEN,WHERE. - - - - - Looks up a localized string similar to <?xml version="1.0" encoding="utf-8" ?> - <DocumentElement> - <MetaDataCollections> - <CollectionName>MetaDataCollections</CollectionName> - <NumberOfRestrictions>0</NumberOfRestrictions> - <NumberOfIdentifierParts>0</NumberOfIdentifierParts> - </MetaDataCollections> - <MetaDataCollections> - <CollectionName>DataSourceInformation</CollectionName> - <NumberOfRestrictions>0</NumberOfRestrictions> - <NumberOfIdentifierParts>0</NumberOfIdentifierParts> - </MetaDataCollections> - <MetaDataC [rest of string was truncated]";. - - - - - The file extension used for dynamic link libraries. - - - - - The file extension used for the XML configuration file. - - - - - This is the name of the XML configuration file specific to the - System.Data.SQLite assembly. - - - - - This lock is used to protect the static _SQLiteNativeModuleFileName, - _SQLiteNativeModuleHandle, and processorArchitecturePlatforms fields. - - - - - This dictionary stores the mappings between processor architecture - names and platform names. These mappings are now used for two - purposes. First, they are used to determine if the assembly code - base should be used instead of the location, based upon whether one - or more of the named sub-directories exist within the assembly code - base. Second, they are used to assist in loading the appropriate - SQLite interop assembly into the current process. - - - - - For now, this method simply calls the Initialize method. - - - - - Attempts to initialize this class by pre-loading the native SQLite - library for the processor architecture of the current process. - - - - - Queries and returns the XML configuration file name for the assembly - containing the managed System.Data.SQLite components. - - - The XML configuration file name -OR- null if it cannot be determined - or does not exist. - - - - - Queries and returns the value of the specified setting, using the XML - configuration file and/or the environment variables for the current - process and/or the current system, when available. - - - The name of the setting. - - - The value to be returned if the setting has not been set explicitly - or cannot be determined. - - - The value of the setting -OR- the default value specified by - if it has not been set explicitly or - cannot be determined. By default, all references to existing - environment variables will be expanded to their corresponding values - within the value to be returned unless either the "No_Expand" or - "No_Expand_" environment variable is set [to - anything]. - - - - - Queries and returns the directory for the assembly currently being - executed. - - - The directory for the assembly currently being executed -OR- null if - it cannot be determined. - - - - - The name of the environment variable containing the processor - architecture of the current process. - - - - - This is the P/Invoke method that wraps the native Win32 LoadLibrary - function. See the MSDN documentation for full details on what it - does. - - - The name of the executable library. - - - The native module handle upon success -OR- IntPtr.Zero on failure. - - - - - The native module file name for the native SQLite library or null. - - - - - The native module handle for the native SQLite library or the value - IntPtr.Zero. - - - - - Searches for the native SQLite library in the directory containing - the assembly currently being executed as well as the base directory - for the current application domain. - - - Upon success, this parameter will be modified to refer to the base - directory containing the native SQLite library. - - - Upon success, this parameter will be modified to refer to the name - of the immediate directory (i.e. the offset from the base directory) - containing the native SQLite library. - - - Non-zero (success) if the native SQLite library was found; otherwise, - zero (failure). - - - - - Queries and returns the base directory of the current application - domain. - - - The base directory for the current application domain -OR- null if it - cannot be determined. - - - - - Determines if the dynamic link library file name requires a suffix - and adds it if necessary. - - - The original dynamic link library file name to inspect. - - - The dynamic link library file name, possibly modified to include an - extension. - - - - - Queries and returns the processor architecture of the current - process. - - - The processor architecture of the current process -OR- null if it - cannot be determined. - - - - - Given the processor architecture, returns the name of the platform. - - - The processor architecture to be translated to a platform name. - - - The platform name for the specified processor architecture -OR- null - if it cannot be determined. - - - - - Attempts to load the native SQLite library based on the specified - directory and processor architecture. - - - The base directory to use, null for default (the base directory of - the current application domain). This directory should contain the - processor architecture specific sub-directories. - - - The requested processor architecture, null for default (the - processor architecture of the current process). This caller should - almost always specify null for this parameter. - - - The candidate native module file name to load will be stored here, - if necessary. - - - The native module handle as returned by LoadLibrary will be stored - here, if necessary. This value will be IntPtr.Zero if the call to - LoadLibrary fails. - - - Non-zero if the native module was loaded successfully; otherwise, - zero. - - - - - This class represents a context from the SQLite core library that can - be passed to the sqlite3_result_*() and associated functions. - - - - - This interface represents a native handle provided by the SQLite core - library. - - - - - The native handle value. - - - - - The native context handle. - - - - - Constructs an instance of this class using the specified native - context handle. - - - The native context handle to use. - - - - - Sets the context result to NULL. - - - - - Sets the context result to the specified - value. - - - The value to use. - - - - - Sets the context result to the specified - value. - - - The value to use. - - - - - Sets the context result to the specified - value. - - - The value to use. - - - - - Sets the context result to the specified - value. - - - The value to use. This value will be - converted to the UTF-8 encoding prior to being used. - - - - - Sets the context result to the specified - value containing an error message. - - - The value containing the error message text. - This value will be converted to the UTF-8 encoding prior to being - used. - - - - - Sets the context result to the specified - value. - - - The value to use. - - - - - Sets the context result to contain the error code SQLITE_TOOBIG. - - - - - Sets the context result to contain the error code SQLITE_NOMEM. - - - - - Sets the context result to the specified array - value. - - - The array value to use. - - - - - Sets the context result to a BLOB of zeros of the specified size. - - - The number of zero bytes to use for the BLOB context result. - - - - - Sets the context result to the specified . - - - The to use. - - - - - Returns the underlying SQLite native handle associated with this - object instance. - - - - - This class represents a value from the SQLite core library that can be - passed to the sqlite3_value_*() and associated functions. - - - - - The native value handle. - - - - - Constructs an instance of this class using the specified native - value handle. - - - The native value handle to use. - - - - - Invalidates the native value handle, thereby preventing further - access to it from this object instance. - - - - - Converts a logical array of native pointers to native sqlite3_value - structures into a managed array of - object instances. - - - The number of elements in the logical array of native sqlite3_value - structures. - - - The native pointer to the logical array of native sqlite3_value - structures to convert. - - - The managed array of object instances or - null upon failure. - - - - - Gets and returns the type affinity associated with this value. - - - The type affinity associated with this value. - - - - - Gets and returns the number of bytes associated with this value, if - it refers to a UTF-8 encoded string. - - - The number of bytes associated with this value. The returned value - may be zero. - - - - - Gets and returns the associated with this - value. - - - The associated with this value. - - - - - Gets and returns the associated with - this value. - - - The associated with this value. - - - - - Gets and returns the associated with this - value. - - - The associated with this value. - - - - - Gets and returns the associated with this - value. - - - The associated with this value. The value is - converted from the UTF-8 encoding prior to being returned. - - - - - Gets and returns the array associated with this - value. - - - The array associated with this value. - - - - - Uses the native value handle to obtain and store the managed value - for this object instance, thus saving it for later use. The type - of the managed value is determined by the type affinity of the - native value. If the type affinity is not recognized by this - method, no work is done and false is returned. - - - Non-zero if the native value was persisted successfully. - - - - - Returns the underlying SQLite native handle associated with this - object instance. - - - - - Returns non-zero if the native SQLite value has been successfully - persisted as a managed value within this object instance (i.e. the - property may then be read successfully). - - - - - If the managed value for this object instance is available (i.e. it - has been previously persisted via the ) method, - that value is returned; otherwise, an exception is thrown. The - returned value may be null. - - - - - These are the allowed values for the operators that are part of a - constraint term in the WHERE clause of a query that uses a virtual - table. - - - - - This value represents the equality operator. - - - - - This value represents the greater than operator. - - - - - This value represents the less than or equal to operator. - - - - - This value represents the less than operator. - - - - - This value represents the greater than or equal to operator. - - - - - This value represents the MATCH operator. - - - - - This class represents the native sqlite3_index_constraint structure - from the SQLite core library. - - - - - Constructs an instance of this class using the specified native - sqlite3_index_constraint structure. - - - The native sqlite3_index_constraint structure to use. - - - - - Constructs an instance of this class using the specified field - values. - - - Column on left-hand side of constraint. - - - Constraint operator (). - - - True if this constraint is usable. - - - Used internally - - should ignore. - - - - - Column on left-hand side of constraint. - - - - - Constraint operator (). - - - - - True if this constraint is usable. - - - - - Used internally - - should ignore. - - - - - This class represents the native sqlite3_index_orderby structure from - the SQLite core library. - - - - - Constructs an instance of this class using the specified native - sqlite3_index_orderby structure. - - - The native sqlite3_index_orderby structure to use. - - - - - Constructs an instance of this class using the specified field - values. - - - Column number. - - - True for DESC. False for ASC. - - - - - Column number. - - - - - True for DESC. False for ASC. - - - - - This class represents the native sqlite3_index_constraint_usage - structure from the SQLite core library. - - - - - Constructs an instance of this class using the specified native - sqlite3_index_constraint_usage structure. - - - The native sqlite3_index_constraint_usage structure to use. - - - - - Constructs an instance of this class using the specified field - values. - - - If greater than 0, constraint is part of argv to xFilter. - - - Do not code a test for this constraint. - - - - - If greater than 0, constraint is part of argv to xFilter. - - - - - Do not code a test for this constraint. - - - - - This class represents the various inputs provided by the SQLite core - library to the method. - - - - - Constructs an instance of this class. - - - The number of instances to - pre-allocate space for. - - - The number of instances to - pre-allocate space for. - - - - - An array of object instances, - each containing information supplied by the SQLite core library. - - - - - An array of object instances, - each containing information supplied by the SQLite core library. - - - - - This class represents the various outputs provided to the SQLite core - library by the method. - - - - - Constructs an instance of this class. - - - The number of instances - to pre-allocate space for. - - - - - Determines if the native estimatedRows field can be used, based on - the available version of the SQLite core library. - - - Non-zero if the property is supported - by the SQLite core library. - - - - - An array of object - instances, each containing information to be supplied to the SQLite - core library. - - - - - Number used to help identify the selected index. This value will - later be provided to the - method. - - - - - String used to help identify the selected index. This value will - later be provided to the - method. - - - - - Non-zero if the index string must be freed by the SQLite core - library. - - - - - True if output is already ordered. - - - - - Estimated cost of using this index. Using a null value here - indicates that a default estimated cost value should be used. - - - - - Estimated number of rows returned. Using a null value here - indicates that a default estimated rows value should be used. - - - - - This class represents the various inputs and outputs used with the - method. - - - - - Constructs an instance of this class. - - - The number of (and - ) instances to - pre-allocate space for. - - - The number of instances to - pre-allocate space for. - - - - - Converts a native pointer to a native sqlite3_index_info structure - into a new object instance. - - - The native pointer to the native sqlite3_index_info structure to - convert. - - - Upon success, this parameter will be modified to contain the newly - created object instance. - - - - - Populates the outputs of a pre-allocated native sqlite3_index_info - structure using an existing object - instance. - - - The existing object instance containing - the output data to use. - - - The native pointer to the pre-allocated native sqlite3_index_info - structure. - - - - - The object instance containing - the inputs to the - method. - - - - - The object instance containing - the outputs from the - method. - - - - - This class represents a managed virtual table implementation. It is - not sealed and should be used as the base class for any user-defined - virtual table classes implemented in managed code. - - - - - The index within the array of strings provided to the - and - methods containing the - name of the module implementing this virtual table. - - - - - The index within the array of strings provided to the - and - methods containing the - name of the database containing this virtual table. - - - - - The index within the array of strings provided to the - and - methods containing the - name of the virtual table. - - - - - Constructs an instance of this class. - - - The original array of strings provided to the - and - methods. - - - - - This method should normally be used by the - method in order to - perform index selection based on the constraints provided by the - SQLite core library. - - - The object instance containing all the - data for the inputs and outputs relating to index selection. - - - Non-zero upon success. - - - - - Attempts to record the renaming of the virtual table associated - with this object instance. - - - The new name for the virtual table. - - - Non-zero upon success. - - - - - Disposes of this object instance. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is being called - from the finalizer. - - - - - Finalizes this object instance. - - - - - The original array of strings provided to the - and - methods. - - - - - The name of the module implementing this virtual table. - - - - - The name of the database containing this virtual table. - - - - - The name of the virtual table. - - - - - The object instance containing all the - data for the inputs and outputs relating to the most recent index - selection. - - - - - Returns the underlying SQLite native handle associated with this - object instance. - - - - - This class represents a managed virtual table cursor implementation. - It is not sealed and should be used as the base class for any - user-defined virtual table cursor classes implemented in managed code. - - - - - This value represents an invalid integer row sequence number. - - - - - The field holds the integer row sequence number for the current row - pointed to by this cursor object instance. - - - - - Constructs an instance of this class. - - - The object instance associated - with this object instance. - - - - - Constructs an instance of this class. - - - - - Attempts to persist the specified object - instances in order to make them available after the - method returns. - - - The array of object instances to be - persisted. - - - The number of object instances that were - successfully persisted. - - - - - This method should normally be used by the - method in order to - perform filtering of the result rows and/or to record the filtering - criteria provided by the SQLite core library. - - - Number used to help identify the selected index. - - - String used to help identify the selected index. - - - The values corresponding to each column in the selected index. - - - - - Determines the integer row sequence number for the current row. - - - The integer row sequence number for the current row -OR- zero if - it cannot be determined. - - - - - Adjusts the integer row sequence number so that it refers to the - next row. - - - - - Disposes of this object instance. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is being called - from the finalizer. - - - - - Finalizes this object instance. - - - - - The object instance associated - with this object instance. - - - - - Number used to help identify the selected index. This value will - be set via the method. - - - - - String used to help identify the selected index. This value will - be set via the method. - - - - - The values used to filter the rows returned via this cursor object - instance. This value will be set via the - method. - - - - - Returns the underlying SQLite native handle associated with this - object instance. - - - - - This interface represents a virtual table implementation written in - native code. - - - - - - This method is called to create a new instance of a virtual table - in response to a CREATE VIRTUAL TABLE statement. The db parameter - is a pointer to the SQLite database connection that is executing - the CREATE VIRTUAL TABLE statement. The pAux argument is the copy - of the client data pointer that was the fourth argument to the - sqlite3_create_module() or sqlite3_create_module_v2() call that - registered the virtual table module. The argv parameter is an - array of argc pointers to null terminated strings. The first - string, argv[0], is the name of the module being invoked. The - module name is the name provided as the second argument to - sqlite3_create_module() and as the argument to the USING clause of - the CREATE VIRTUAL TABLE statement that is running. The second, - argv[1], is the name of the database in which the new virtual table - is being created. The database name is "main" for the primary - database, or "temp" for TEMP database, or the name given at the - end of the ATTACH statement for attached databases. The third - element of the array, argv[2], is the name of the new virtual - table, as specified following the TABLE keyword in the CREATE - VIRTUAL TABLE statement. If present, the fourth and subsequent - strings in the argv[] array report the arguments to the module name - in the CREATE VIRTUAL TABLE statement. - - - The job of this method is to construct the new virtual table object - (an sqlite3_vtab object) and return a pointer to it in *ppVTab. - - - As part of the task of creating a new sqlite3_vtab structure, this - method must invoke sqlite3_declare_vtab() to tell the SQLite core - about the columns and datatypes in the virtual table. The - sqlite3_declare_vtab() API has the following prototype: - - - - int sqlite3_declare_vtab(sqlite3 *db, const char *zCreateTable) - - - - The first argument to sqlite3_declare_vtab() must be the same - database connection pointer as the first parameter to this method. - The second argument to sqlite3_declare_vtab() must a - zero-terminated UTF-8 string that contains a well-formed CREATE - TABLE statement that defines the columns in the virtual table and - their data types. The name of the table in this CREATE TABLE - statement is ignored, as are all constraints. Only the column names - and datatypes matter. The CREATE TABLE statement string need not to - be held in persistent memory. The string can be deallocated and/or - reused as soon as the sqlite3_declare_vtab() routine returns. - - - - The native database connection handle. - - - The original native pointer value that was provided to the - sqlite3_create_module(), sqlite3_create_module_v2() or - sqlite3_create_disposable_module() functions. - - - The number of arguments from the CREATE VIRTUAL TABLE statement. - - - The array of string arguments from the CREATE VIRTUAL TABLE - statement. - - - Upon success, this parameter must be modified to point to the newly - created native sqlite3_vtab derived structure. - - - Upon failure, this parameter must be modified to point to the error - message, with the underlying memory having been obtained from the - sqlite3_malloc() function. - - - A standard SQLite return code. - - - - - - The xConnect method is very similar to xCreate. It has the same - parameters and constructs a new sqlite3_vtab structure just like - xCreate. And it must also call sqlite3_declare_vtab() like xCreate. - - - The difference is that xConnect is called to establish a new - connection to an existing virtual table whereas xCreate is called - to create a new virtual table from scratch. - - - The xCreate and xConnect methods are only different when the - virtual table has some kind of backing store that must be - initialized the first time the virtual table is created. The - xCreate method creates and initializes the backing store. The - xConnect method just connects to an existing backing store. - - - As an example, consider a virtual table implementation that - provides read-only access to existing comma-separated-value (CSV) - files on disk. There is no backing store that needs to be created - or initialized for such a virtual table (since the CSV files - already exist on disk) so the xCreate and xConnect methods will be - identical for that module. - - - Another example is a virtual table that implements a full-text - index. The xCreate method must create and initialize data - structures to hold the dictionary and posting lists for that index. - The xConnect method, on the other hand, only has to locate and use - an existing dictionary and posting lists that were created by a - prior xCreate call. - - - The xConnect method must return SQLITE_OK if it is successful in - creating the new virtual table, or SQLITE_ERROR if it is not - successful. If not successful, the sqlite3_vtab structure must not - be allocated. An error message may optionally be returned in *pzErr - if unsuccessful. Space to hold the error message string must be - allocated using an SQLite memory allocation function like - sqlite3_malloc() or sqlite3_mprintf() as the SQLite core will - attempt to free the space using sqlite3_free() after the error has - been reported up to the application. - - - The xConnect method is required for every virtual table - implementation, though the xCreate and xConnect pointers of the - sqlite3_module object may point to the same function the virtual - table does not need to initialize backing store. - - - - The native database connection handle. - - - The original native pointer value that was provided to the - sqlite3_create_module(), sqlite3_create_module_v2() or - sqlite3_create_disposable_module() functions. - - - The number of arguments from the CREATE VIRTUAL TABLE statement. - - - The array of string arguments from the CREATE VIRTUAL TABLE - statement. - - - Upon success, this parameter must be modified to point to the newly - created native sqlite3_vtab derived structure. - - - Upon failure, this parameter must be modified to point to the error - message, with the underlying memory having been obtained from the - sqlite3_malloc() function. - - - A standard SQLite return code. - - - - - - SQLite uses the xBestIndex method of a virtual table module to - determine the best way to access the virtual table. The xBestIndex - method has a prototype like this: - - - int (*xBestIndex)(sqlite3_vtab *pVTab, sqlite3_index_info*); - - - The SQLite core communicates with the xBestIndex method by filling - in certain fields of the sqlite3_index_info structure and passing a - pointer to that structure into xBestIndex as the second parameter. - The xBestIndex method fills out other fields of this structure - which forms the reply. The sqlite3_index_info structure looks like - this: - - - struct sqlite3_index_info { - /* Inputs */ - const int nConstraint; /* Number of entries in aConstraint */ - const struct sqlite3_index_constraint { - int iColumn; /* Column on left-hand side of - * constraint */ - unsigned char op; /* Constraint operator */ - unsigned char usable; /* True if this constraint is usable */ - int iTermOffset; /* Used internally - xBestIndex should - * ignore */ - } *const aConstraint; /* Table of WHERE clause constraints */ - const int nOrderBy; /* Number of terms in the ORDER BY - * clause */ - const struct sqlite3_index_orderby { - int iColumn; /* Column number */ - unsigned char desc; /* True for DESC. False for ASC. */ - } *const aOrderBy; /* The ORDER BY clause */ - /* Outputs */ - struct sqlite3_index_constraint_usage { - int argvIndex; /* if greater than zero, constraint is - * part of argv to xFilter */ - unsigned char omit; /* Do not code a test for this - * constraint */ - } *const aConstraintUsage; - int idxNum; /* Number used to identify the index */ - char *idxStr; /* String, possibly obtained from - * sqlite3_malloc() */ - int needToFreeIdxStr; /* Free idxStr using sqlite3_free() if - * true */ - int orderByConsumed; /* True if output is already ordered */ - double estimatedCost; /* Estimated cost of using this index */ - }; - - - In addition, there are some defined constants: - - - #define SQLITE_INDEX_CONSTRAINT_EQ 2 - #define SQLITE_INDEX_CONSTRAINT_GT 4 - #define SQLITE_INDEX_CONSTRAINT_LE 8 - #define SQLITE_INDEX_CONSTRAINT_LT 16 - #define SQLITE_INDEX_CONSTRAINT_GE 32 - #define SQLITE_INDEX_CONSTRAINT_MATCH 64 - - - The SQLite core calls the xBestIndex method when it is compiling a - query that involves a virtual table. In other words, SQLite calls - this method when it is running sqlite3_prepare() or the equivalent. - By calling this method, the SQLite core is saying to the virtual - table that it needs to access some subset of the rows in the - virtual table and it wants to know the most efficient way to do - that access. The xBestIndex method replies with information that - the SQLite core can then use to conduct an efficient search of the - virtual table. - - - While compiling a single SQL query, the SQLite core might call - xBestIndex multiple times with different settings in - sqlite3_index_info. The SQLite core will then select the - combination that appears to give the best performance. - - - Before calling this method, the SQLite core initializes an instance - of the sqlite3_index_info structure with information about the - query that it is currently trying to process. This information - derives mainly from the WHERE clause and ORDER BY or GROUP BY - clauses of the query, but also from any ON or USING clauses if the - query is a join. The information that the SQLite core provides to - the xBestIndex method is held in the part of the structure that is - marked as "Inputs". The "Outputs" section is initialized to zero. - - - The information in the sqlite3_index_info structure is ephemeral - and may be overwritten or deallocated as soon as the xBestIndex - method returns. If the xBestIndex method needs to remember any part - of the sqlite3_index_info structure, it should make a copy. Care - must be take to store the copy in a place where it will be - deallocated, such as in the idxStr field with needToFreeIdxStr set - to 1. - - - Note that xBestIndex will always be called before xFilter, since - the idxNum and idxStr outputs from xBestIndex are required inputs - to xFilter. However, there is no guarantee that xFilter will be - called following a successful xBestIndex. - - - The xBestIndex method is required for every virtual table - implementation. - - - 2.3.1 Inputs - - - The main thing that the SQLite core is trying to communicate to the - virtual table is the constraints that are available to limit the - number of rows that need to be searched. The aConstraint[] array - contains one entry for each constraint. There will be exactly - nConstraint entries in that array. - - - Each constraint will correspond to a term in the WHERE clause or in - a USING or ON clause that is of the form - - - column OP EXPR - - - Where "column" is a column in the virtual table, OP is an operator - like "=" or "<", and EXPR is an arbitrary expression. So, for - example, if the WHERE clause contained a term like this: - - - a = 5 - - - Then one of the constraints would be on the "a" column with - operator "=" and an expression of "5". Constraints need not have a - literal representation of the WHERE clause. The query optimizer - might make transformations to the WHERE clause in order to extract - as many constraints as it can. So, for example, if the WHERE clause - contained something like this: - - - x BETWEEN 10 AND 100 AND 999>y - - - The query optimizer might translate this into three separate - constraints: - - - x >= 10 - x <= 100 - y < 999 - - - For each constraint, the aConstraint[].iColumn field indicates - which column appears on the left-hand side of the constraint. The - first column of the virtual table is column 0. The rowid of the - virtual table is column -1. The aConstraint[].op field indicates - which operator is used. The SQLITE_INDEX_CONSTRAINT_* constants map - integer constants into operator values. Columns occur in the order - they were defined by the call to sqlite3_declare_vtab() in the - xCreate or xConnect method. Hidden columns are counted when - determining the column index. - - - The aConstraint[] array contains information about all constraints - that apply to the virtual table. But some of the constraints might - not be usable because of the way tables are ordered in a join. The - xBestIndex method must therefore only consider constraints that - have an aConstraint[].usable flag which is true. - - - In addition to WHERE clause constraints, the SQLite core also tells - the xBestIndex method about the ORDER BY clause. (In an aggregate - query, the SQLite core might put in GROUP BY clause information in - place of the ORDER BY clause information, but this fact should not - make any difference to the xBestIndex method.) If all terms of the - ORDER BY clause are columns in the virtual table, then nOrderBy - will be the number of terms in the ORDER BY clause and the - aOrderBy[] array will identify the column for each term in the - order by clause and whether or not that column is ASC or DESC. - - - 2.3.2 Outputs - - - Given all of the information above, the job of the xBestIndex - method it to figure out the best way to search the virtual table. - - - The xBestIndex method fills the idxNum and idxStr fields with - information that communicates an indexing strategy to the xFilter - method. The information in idxNum and idxStr is arbitrary as far as - the SQLite core is concerned. The SQLite core just copies the - information through to the xFilter method. Any desired meaning can - be assigned to idxNum and idxStr as long as xBestIndex and xFilter - agree on what that meaning is. - - - The idxStr value may be a string obtained from an SQLite memory - allocation function such as sqlite3_mprintf(). If this is the case, - then the needToFreeIdxStr flag must be set to true so that the - SQLite core will know to call sqlite3_free() on that string when it - has finished with it, and thus avoid a memory leak. - - - If the virtual table will output rows in the order specified by the - ORDER BY clause, then the orderByConsumed flag may be set to true. - If the output is not automatically in the correct order then - orderByConsumed must be left in its default false setting. This - will indicate to the SQLite core that it will need to do a separate - sorting pass over the data after it comes out of the virtual table. - - - The estimatedCost field should be set to the estimated number of - disk access operations required to execute this query against the - virtual table. The SQLite core will often call xBestIndex multiple - times with different constraints, obtain multiple cost estimates, - then choose the query plan that gives the lowest estimate. - - - The aConstraintUsage[] array contains one element for each of the - nConstraint constraints in the inputs section of the - sqlite3_index_info structure. The aConstraintUsage[] array is used - by xBestIndex to tell the core how it is using the constraints. - - - The xBestIndex method may set aConstraintUsage[].argvIndex entries - to values greater than one. Exactly one entry should be set to 1, - another to 2, another to 3, and so forth up to as many or as few as - the xBestIndex method wants. The EXPR of the corresponding - constraints will then be passed in as the argv[] parameters to - xFilter. - - - For example, if the aConstraint[3].argvIndex is set to 1, then when - xFilter is called, the argv[0] passed to xFilter will have the EXPR - value of the aConstraint[3] constraint. - - - By default, the SQLite core double checks all constraints on each - row of the virtual table that it receives. If such a check is - redundant, the xBestFilter method can suppress that double-check by - setting aConstraintUsage[].omit. - - - - The native pointer to the sqlite3_vtab derived structure. - - - The native pointer to the sqlite3_index_info structure. - - - A standard SQLite return code. - - - - - - This method releases a connection to a virtual table. Only the - sqlite3_vtab object is destroyed. The virtual table is not - destroyed and any backing store associated with the virtual table - persists. This method undoes the work of xConnect. - - - This method is a destructor for a connection to the virtual table. - Contrast this method with xDestroy. The xDestroy is a destructor - for the entire virtual table. - - - The xDisconnect method is required for every virtual table - implementation, though it is acceptable for the xDisconnect and - xDestroy methods to be the same function if that makes sense for - the particular virtual table. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - This method releases a connection to a virtual table, just like the - xDisconnect method, and it also destroys the underlying table - implementation. This method undoes the work of xCreate. - - - The xDisconnect method is called whenever a database connection - that uses a virtual table is closed. The xDestroy method is only - called when a DROP TABLE statement is executed against the virtual - table. - - - The xDestroy method is required for every virtual table - implementation, though it is acceptable for the xDisconnect and - xDestroy methods to be the same function if that makes sense for - the particular virtual table. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - The xOpen method creates a new cursor used for accessing (read - and/or writing) a virtual table. A successful invocation of this - method will allocate the memory for the sqlite3_vtab_cursor (or a - subclass), initialize the new object, and make *ppCursor point to - the new object. The successful call then returns SQLITE_OK. - - - For every successful call to this method, the SQLite core will - later invoke the xClose method to destroy the allocated cursor. - - - The xOpen method need not initialize the pVtab field of the - sqlite3_vtab_cursor structure. The SQLite core will take care of - that chore automatically. - - - A virtual table implementation must be able to support an arbitrary - number of simultaneously open cursors. - - - When initially opened, the cursor is in an undefined state. The - SQLite core will invoke the xFilter method on the cursor prior to - any attempt to position or read from the cursor. - - - The xOpen method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab derived structure. - - - Upon success, this parameter must be modified to point to the newly - created native sqlite3_vtab_cursor derived structure. - - - A standard SQLite return code. - - - - - - The xClose method closes a cursor previously opened by xOpen. The - SQLite core will always call xClose once for each cursor opened - using xOpen. - - - This method must release all resources allocated by the - corresponding xOpen call. The routine will not be called again even - if it returns an error. The SQLite core will not use the - sqlite3_vtab_cursor again after it has been closed. - - - The xClose method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - A standard SQLite return code. - - - - - - This method begins a search of a virtual table. The first argument - is a cursor opened by xOpen. The next two argument define a - particular search index previously chosen by xBestIndex. The - specific meanings of idxNum and idxStr are unimportant as long as - xFilter and xBestIndex agree on what that meaning is. - - - The xBestIndex function may have requested the values of certain - expressions using the aConstraintUsage[].argvIndex values of the - sqlite3_index_info structure. Those values are passed to xFilter - using the argc and argv parameters. - - - If the virtual table contains one or more rows that match the - search criteria, then the cursor must be left point at the first - row. Subsequent calls to xEof must return false (zero). If there - are no rows match, then the cursor must be left in a state that - will cause the xEof to return true (non-zero). The SQLite engine - will use the xColumn and xRowid methods to access that row content. - The xNext method will be used to advance to the next row. - - - This method must return SQLITE_OK if successful, or an sqlite error - code if an error occurs. - - - The xFilter method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - Number used to help identify the selected index. - - - The native pointer to the UTF-8 encoded string containing the - string used to help identify the selected index. - - - The number of native pointers to sqlite3_value structures specified - in . - - - An array of native pointers to sqlite3_value structures containing - filtering criteria for the selected index. - - - A standard SQLite return code. - - - - - - The xNext method advances a virtual table cursor to the next row of - a result set initiated by xFilter. If the cursor is already - pointing at the last row when this routine is called, then the - cursor no longer points to valid data and a subsequent call to the - xEof method must return true (non-zero). If the cursor is - successfully advanced to another row of content, then subsequent - calls to xEof must return false (zero). - - - This method must return SQLITE_OK if successful, or an sqlite error - code if an error occurs. - - - The xNext method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - A standard SQLite return code. - - - - - - The xEof method must return false (zero) if the specified cursor - currently points to a valid row of data, or true (non-zero) - otherwise. This method is called by the SQL engine immediately - after each xFilter and xNext invocation. - - - The xEof method is required for every virtual table implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - Non-zero if no more rows are available; zero otherwise. - - - - - - The SQLite core invokes this method in order to find the value for - the N-th column of the current row. N is zero-based so the first - column is numbered 0. The xColumn method may return its result back - to SQLite using one of the following interface: - - - sqlite3_result_blob() - sqlite3_result_double() - sqlite3_result_int() - sqlite3_result_int64() - sqlite3_result_null() - sqlite3_result_text() - sqlite3_result_text16() - sqlite3_result_text16le() - sqlite3_result_text16be() - sqlite3_result_zeroblob() - - - If the xColumn method implementation calls none of the functions - above, then the value of the column defaults to an SQL NULL. - - - To raise an error, the xColumn method should use one of the - result_text() methods to set the error message text, then return an - appropriate error code. The xColumn method must return SQLITE_OK on - success. - - - The xColumn method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - The native pointer to the sqlite3_context structure to be used - for returning the specified column value to the SQLite core - library. - - - The zero-based index corresponding to the column containing the - value to be returned. - - - A standard SQLite return code. - - - - - - A successful invocation of this method will cause *pRowid to be - filled with the rowid of row that the virtual table cursor pCur is - currently pointing at. This method returns SQLITE_OK on success. It - returns an appropriate error code on failure. - - - The xRowid method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the current row for the specified cursor. - - - A standard SQLite return code. - - - - - - All changes to a virtual table are made using the xUpdate method. - This one method can be used to insert, delete, or update. - - - The argc parameter specifies the number of entries in the argv - array. The value of argc will be 1 for a pure delete operation or - N+2 for an insert or replace or update where N is the number of - columns in the table. In the previous sentence, N includes any - hidden columns. - - - Every argv entry will have a non-NULL value in C but may contain - the SQL value NULL. In other words, it is always true that - argv[i]!=0 for i between 0 and argc-1. However, it might be the - case that sqlite3_value_type(argv[i])==SQLITE_NULL. - - - The argv[0] parameter is the rowid of a row in the virtual table - to be deleted. If argv[0] is an SQL NULL, then no deletion occurs. - - - The argv[1] parameter is the rowid of a new row to be inserted into - the virtual table. If argv[1] is an SQL NULL, then the - implementation must choose a rowid for the newly inserted row. - Subsequent argv[] entries contain values of the columns of the - virtual table, in the order that the columns were declared. The - number of columns will match the table declaration that the - xConnect or xCreate method made using the sqlite3_declare_vtab() - call. All hidden columns are included. - - - When doing an insert without a rowid (argc>1, argv[1] is an SQL - NULL), the implementation must set *pRowid to the rowid of the - newly inserted row; this will become the value returned by the - sqlite3_last_insert_rowid() function. Setting this value in all the - other cases is a harmless no-op; the SQLite engine ignores the - *pRowid return value if argc==1 or argv[1] is not an SQL NULL. - - - Each call to xUpdate will fall into one of cases shown below. Note - that references to argv[i] mean the SQL value held within the - argv[i] object, not the argv[i] object itself. - - - argc = 1 - - - The single row with rowid equal to argv[0] is deleted. No - insert occurs. - - - argc > 1 - argv[0] = NULL - - - A new row is inserted with a rowid argv[1] and column - values in argv[2] and following. If argv[1] is an SQL NULL, - the a new unique rowid is generated automatically. - - - argc > 1 - argv[0] ? NULL - argv[0] = argv[1] - - - The row with rowid argv[0] is updated with new values in - argv[2] and following parameters. - - - argc > 1 - argv[0] ? NULL - argv[0] ? argv[1] - - - The row with rowid argv[0] is updated with rowid argv[1] - and new values in argv[2] and following parameters. This - will occur when an SQL statement updates a rowid, as in - the statement: - - - UPDATE table SET rowid=rowid+1 WHERE ...; - - - The xUpdate method must return SQLITE_OK if and only if it is - successful. If a failure occurs, the xUpdate must return an - appropriate error code. On a failure, the pVTab->zErrMsg element - may optionally be replaced with error message text stored in memory - allocated from SQLite using functions such as sqlite3_mprintf() or - sqlite3_malloc(). - - - If the xUpdate method violates some constraint of the virtual table - (including, but not limited to, attempting to store a value of the - wrong datatype, attempting to store a value that is too large or - too small, or attempting to change a read-only value) then the - xUpdate must fail with an appropriate error code. - - - There might be one or more sqlite3_vtab_cursor objects open and in - use on the virtual table instance and perhaps even on the row of - the virtual table when the xUpdate method is invoked. The - implementation of xUpdate must be prepared for attempts to delete - or modify rows of the table out from other existing cursors. If the - virtual table cannot accommodate such changes, the xUpdate method - must return an error code. - - - The xUpdate method is optional. If the xUpdate pointer in the - sqlite3_module for a virtual table is a NULL pointer, then the - virtual table is read-only. - - - - The native pointer to the sqlite3_vtab derived structure. - - - The number of new or modified column values contained in - . - - - The array of native pointers to sqlite3_value structures containing - the new or modified column values, if any. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the row that was inserted, if any. - - - A standard SQLite return code. - - - - - - This method begins a transaction on a virtual table. This is method - is optional. The xBegin pointer of sqlite3_module may be NULL. - - - This method is always followed by one call to either the xCommit or - xRollback method. Virtual table transactions do not nest, so the - xBegin method will not be invoked more than once on a single - virtual table without an intervening call to either xCommit or - xRollback. Multiple calls to other methods can and likely will - occur in between the xBegin and the corresponding xCommit or - xRollback. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - This method signals the start of a two-phase commit on a virtual - table. This is method is optional. The xSync pointer of - sqlite3_module may be NULL. - - - This method is only invoked after call to the xBegin method and - prior to an xCommit or xRollback. In order to implement two-phase - commit, the xSync method on all virtual tables is invoked prior to - invoking the xCommit method on any virtual table. If any of the - xSync methods fail, the entire transaction is rolled back. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - This method causes a virtual table transaction to commit. This is - method is optional. The xCommit pointer of sqlite3_module may be - NULL. - - - A call to this method always follows a prior call to xBegin and - xSync. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - This method causes a virtual table transaction to rollback. This is - method is optional. The xRollback pointer of sqlite3_module may be - NULL. - - - A call to this method always follows a prior call to xBegin. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - This method provides notification that the virtual table - implementation that the virtual table will be given a new name. If - this method returns SQLITE_OK then SQLite renames the table. If - this method returns an error code then the renaming is prevented. - - - The xRename method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab derived structure. - - - The number of arguments to the function being sought. - - - The name of the function being sought. - - - Upon success, this parameter must be modified to contain the - delegate responsible for implementing the specified function. - - - Upon success, this parameter must be modified to contain the - native user-data pointer associated with - . - - - Non-zero if the specified function was found; zero otherwise. - - - - - - This method provides notification that the virtual table - implementation that the virtual table will be given a new name. If - this method returns SQLITE_OK then SQLite renames the table. If - this method returns an error code then the renaming is prevented. - - - The xRename method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab derived structure. - - - The native pointer to the UTF-8 encoded string containing the new - name for the virtual table. - - - A standard SQLite return code. - - - - - - These methods provide the virtual table implementation an - opportunity to implement nested transactions. They are always - optional and will only be called in SQLite version 3.7.7 and later. - - - When xSavepoint(X,N) is invoked, that is a signal to the virtual - table X that it should save its current state as savepoint N. A - subsequent call to xRollbackTo(X,R) means that the state of the - virtual table should return to what it was when xSavepoint(X,R) was - last called. The call to xRollbackTo(X,R) will invalidate all - savepoints with N>R; none of the invalided savepoints will be - rolled back or released without first being reinitialized by a call - to xSavepoint(). A call to xRelease(X,M) invalidates all savepoints - where N>=M. - - - None of the xSavepoint(), xRelease(), or xRollbackTo() methods will - ever be called except in between calls to xBegin() and either - xCommit() or xRollback(). - - - - The native pointer to the sqlite3_vtab derived structure. - - - This is an integer identifier under which the the current state of - the virtual table should be saved. - - - A standard SQLite return code. - - - - - - These methods provide the virtual table implementation an - opportunity to implement nested transactions. They are always - optional and will only be called in SQLite version 3.7.7 and later. - - - When xSavepoint(X,N) is invoked, that is a signal to the virtual - table X that it should save its current state as savepoint N. A - subsequent call to xRollbackTo(X,R) means that the state of the - virtual table should return to what it was when xSavepoint(X,R) was - last called. The call to xRollbackTo(X,R) will invalidate all - savepoints with N>R; none of the invalided savepoints will be - rolled back or released without first being reinitialized by a call - to xSavepoint(). A call to xRelease(X,M) invalidates all savepoints - where N>=M. - - - None of the xSavepoint(), xRelease(), or xRollbackTo() methods will - ever be called except in between calls to xBegin() and either - xCommit() or xRollback(). - - - - The native pointer to the sqlite3_vtab derived structure. - - - This is an integer used to indicate that any saved states with an - identifier greater than or equal to this should be deleted by the - virtual table. - - - A standard SQLite return code. - - - - - - These methods provide the virtual table implementation an - opportunity to implement nested transactions. They are always - optional and will only be called in SQLite version 3.7.7 and later. - - - When xSavepoint(X,N) is invoked, that is a signal to the virtual - table X that it should save its current state as savepoint N. A - subsequent call to xRollbackTo(X,R) means that the state of the - virtual table should return to what it was when xSavepoint(X,R) was - last called. The call to xRollbackTo(X,R) will invalidate all - savepoints with N>R; none of the invalided savepoints will be - rolled back or released without first being reinitialized by a call - to xSavepoint(). A call to xRelease(X,M) invalidates all savepoints - where N>=M. - - - None of the xSavepoint(), xRelease(), or xRollbackTo() methods will - ever be called except in between calls to xBegin() and either - xCommit() or xRollback(). - - - - The native pointer to the sqlite3_vtab derived structure. - - - This is an integer identifier used to specify a specific saved - state for the virtual table for it to restore itself back to, which - should also have the effect of deleting all saved states with an - integer identifier greater than this one. - - - A standard SQLite return code. - - - - - This interface represents a virtual table implementation written in - managed code. - - - - - This method is called in response to the - method. - - - The object instance associated with - the virtual table. - - - The native user-data pointer associated with this module, as it was - provided to the SQLite core library when the native module instance - was created. - - - The module name, database name, virtual table name, and all other - arguments passed to the CREATE VIRTUAL TABLE statement. - - - Upon success, this parameter must be modified to contain the - object instance associated with - the virtual table. - - - Upon failure, this parameter must be modified to contain an error - message. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated with - the virtual table. - - - The native user-data pointer associated with this module, as it was - provided to the SQLite core library when the native module instance - was created. - - - The module name, database name, virtual table name, and all other - arguments passed to the CREATE VIRTUAL TABLE statement. - - - Upon success, this parameter must be modified to contain the - object instance associated with - the virtual table. - - - Upon failure, this parameter must be modified to contain an error - message. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The object instance containing all the - data for the inputs and outputs relating to index selection. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - Upon success, this parameter must be modified to contain the - object instance associated - with the newly opened virtual table cursor. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Number used to help identify the selected index. - - - String used to help identify the selected index. - - - The values corresponding to each column in the selected index. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Non-zero if no more rows are available; zero otherwise. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - The object instance to be used for - returning the specified column value to the SQLite core library. - - - The zero-based index corresponding to the column containing the - value to be returned. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the current row for the specified cursor. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The array of object instances containing - the new or modified column values, if any. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the row that was inserted, if any. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The number of arguments to the function being sought. - - - The name of the function being sought. - - - Upon success, this parameter must be modified to contain the - object instance responsible for - implementing the specified function. - - - Upon success, this parameter must be modified to contain the - native user-data pointer associated with - . - - - Non-zero if the specified function was found; zero otherwise. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The new name for the virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer identifier under which the the current state of - the virtual table should be saved. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer used to indicate that any saved states with an - identifier greater than or equal to this should be deleted by the - virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer identifier used to specify a specific saved - state for the virtual table for it to restore itself back to, which - should also have the effect of deleting all saved states with an - integer identifier greater than this one. - - - A standard SQLite return code. - - - - - Returns non-zero if the schema for the virtual table has been - declared. - - - - - Returns the name of the module as it was registered with the SQLite - core library. - - - - - This class contains static methods that are used to allocate, - manipulate, and free native memory provided by the SQLite core library. - - - - - Allocates at least the specified number of bytes of native memory - via the SQLite core library sqlite3_malloc() function and returns - the resulting native pointer. - - - The number of bytes to allocate. - - - The native pointer that points to a block of memory of at least the - specified size -OR- if the memory could - not be allocated. - - - - - Gets and returns the actual size of the specified memory block that - was previously obtained from the method. - - - The native pointer to the memory block previously obtained from the - method. - - - The actual size, in bytes, of the memory block specified via the - native pointer. - - - - - Frees a memory block previously obtained from the - method. - - - The native pointer to the memory block previously obtained from the - method. - - - - - This class contains static methods that are used to deal with native - UTF-8 string pointers to be used with the SQLite core library. - - - - - This is the maximum possible length for the native UTF-8 encoded - strings used with the SQLite core library. - - - - - This is the object instance used to handle - conversions from/to UTF-8. - - - - - Converts the specified managed string into the UTF-8 encoding and - returns the array of bytes containing its representation in that - encoding. - - - The managed string to convert. - - - The array of bytes containing the representation of the managed - string in the UTF-8 encoding or null upon failure. - - - - - Converts the specified array of bytes representing a string in the - UTF-8 encoding and returns a managed string. - - - The array of bytes to convert. - - - The managed string or null upon failure. - - - - - Probes a native pointer to a string in the UTF-8 encoding for its - terminating NUL character, within the specified length limit. - - - The native NUL-terminated string pointer. - - - The maximum length of the native string, in bytes. - - - The length of the native string, in bytes -OR- zero if the length - could not be determined. - - - - - Converts the specified native NUL-terminated UTF-8 string pointer - into a managed string. - - - The native NUL-terminated UTF-8 string pointer. - - - The managed string or null upon failure. - - - - - Converts the specified native UTF-8 string pointer of the specified - length into a managed string. - - - The native UTF-8 string pointer. - - - The length of the native string, in bytes. - - - The managed string or null upon failure. - - - - - Converts the specified managed string into a native NUL-terminated - UTF-8 string pointer using memory obtained from the SQLite core - library. - - - The managed string to convert. - - - The native NUL-terminated UTF-8 string pointer or - upon failure. - - - - - Converts a logical array of native NUL-terminated UTF-8 string - pointers into an array of managed strings. - - - The number of elements in the logical array of native - NUL-terminated UTF-8 string pointers. - - - The native pointer to the logical array of native NUL-terminated - UTF-8 string pointers to convert. - - - The array of managed strings or null upon failure. - - - - - Converts an array of managed strings into an array of native - NUL-terminated UTF-8 string pointers. - - - The array of managed strings to convert. - - - The array of native NUL-terminated UTF-8 string pointers or null - upon failure. - - - - - This class contains static methods that are used to deal with native - pointers to memory blocks that logically contain arrays of bytes to be - used with the SQLite core library. - - - - - Converts a native pointer to a logical array of bytes of the - specified length into a managed byte array. - - - The native pointer to the logical array of bytes to convert. - - - The length, in bytes, of the logical array of bytes to convert. - - - The managed byte array or null upon failure. - - - - - Converts a managed byte array into a native pointer to a logical - array of bytes. - - - The managed byte array to convert. - - - The native pointer to a logical byte array or null upon failure. - - - - - This class contains static methods that are used to perform several - low-level data marshalling tasks between native and managed code. - - - - - Returns a new object instance based on the - specified object instance and an integer - offset. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location that the new - object instance should point to. - - - The new object instance. - - - - - Rounds up an integer size to the next multiple of the alignment. - - - The size, in bytes, to be rounded up. - - - The required alignment for the return value. - - - The size, in bytes, rounded up to the next multiple of the - alignment. This value may end up being the same as the original - size. - - - - - Determines the offset, in bytes, of the next structure member. - - - The offset, in bytes, of the current structure member. - - - The size, in bytes, of the current structure member. - - - The alignment, in bytes, of the next structure member. - - - The offset, in bytes, of the next structure member. - - - - - Reads a value from the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be read is located. - - - The value at the specified memory location. - - - - - Reads a value from the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - to be read is located. - - - The value at the specified memory location. - - - - - Reads an value from the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be read is located. - - - The value at the specified memory location. - - - - - Writes an value to the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be written is located. - - - The value to write. - - - - - Writes an value to the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be written is located. - - - The value to write. - - - - - Writes a value to the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be written is located. - - - The value to write. - - - - - Writes a value to the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be written is located. - - - The value to write. - - - - - Generates a hash code value for the object. - - - The object instance used to calculate the hash code. - - - Non-zero if different object instances with the same value should - generate different hash codes, where applicable. This parameter - has no effect on the .NET Compact Framework. - - - The hash code value -OR- zero if the object is null. - - - - - This class represents a managed virtual table module implementation. - It is not sealed and must be used as the base class for any - user-defined virtual table module classes implemented in managed code. - - - - - The default version of the native sqlite3_module structure in use. - - - - - This field is used to store the native sqlite3_module structure - associated with this object instance. - - - - - This field is used to store the destructor delegate to be passed to - the SQLite core library via the sqlite3_create_disposable_module() - function. - - - - - This field is used to store a pointer to the native sqlite3_module - structure returned by the sqlite3_create_disposable_module - function. - - - - - This field is used to store the virtual table instances associated - with this module. The native pointer to the sqlite3_vtab derived - structure is used to key into this collection. - - - - - This field is used to store the virtual table cursor instances - associated with this module. The native pointer to the - sqlite3_vtab_cursor derived structure is used to key into this - collection. - - - - - This field is used to store the virtual table function instances - associated with this module. The case-insensitive function name - and the number of arguments (with -1 meaning "any") are used to - construct the string that is used to key into this collection. - - - - - Constructs an instance of this class. - - - The name of the module. This parameter cannot be null. - - - - - Calls the native SQLite core library in order to create a new - disposable module containing the implementation of a virtual table. - - - The native database connection pointer to use. - - - Non-zero upon success. - - - - - This method is called by the SQLite core library when the native - module associated with this object instance is being destroyed due - to its parent connection being closed. It may also be called by - the "vtshim" module if/when the sqlite3_dispose_module() function - is called. - - - The native user-data pointer associated with this module, as it was - provided to the SQLite core library when the native module instance - was created. - - - - - Creates and returns the native sqlite_module structure using the - configured (or default) - interface implementation. - - - The native sqlite_module structure using the configured (or - default) interface - implementation. - - - - - Creates and returns the native sqlite_module structure using the - specified interface - implementation. - - - The interface implementation to - use. - - - The native sqlite_module structure using the specified - interface implementation. - - - - - Creates a copy of the specified - object instance, - using default implementations for the contained delegates when - necessary. - - - The object - instance to copy. - - - The new object - instance. - - - - - Calls one of the virtual table initialization methods. - - - Non-zero to call the - method; otherwise, the - method will be called. - - - The native database connection handle. - - - The original native pointer value that was provided to the - sqlite3_create_module(), sqlite3_create_module_v2() or - sqlite3_create_disposable_module() functions. - - - The number of arguments from the CREATE VIRTUAL TABLE statement. - - - The array of string arguments from the CREATE VIRTUAL TABLE - statement. - - - Upon success, this parameter must be modified to point to the newly - created native sqlite3_vtab derived structure. - - - Upon failure, this parameter must be modified to point to the error - message, with the underlying memory having been obtained from the - sqlite3_malloc() function. - - - A standard SQLite return code. - - - - - Calls one of the virtual table finalization methods. - - - Non-zero to call the - method; otherwise, the - method will be - called. - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance to be used. - - - The native pointer to the sqlite3_vtab derived structure. - - - Non-zero if this error message should also be logged using the - class. - - - Non-zero if caught exceptions should be logged using the - class. - - - The error message. - - - Non-zero upon success. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance to be used. - - - The object instance used to - lookup the native pointer to the sqlite3_vtab derived structure. - - - Non-zero if this error message should also be logged using the - class. - - - Non-zero if caught exceptions should be logged using the - class. - - - The error message. - - - Non-zero upon success. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance to be used. - - - The native pointer to the sqlite3_vtab_cursor derived structure - used to get the native pointer to the sqlite3_vtab derived - structure. - - - Non-zero if this error message should also be logged using the - class. - - - Non-zero if caught exceptions should be logged using the - class. - - - The error message. - - - Non-zero upon success. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance to be used. - - - The object instance used to - lookup the native pointer to the sqlite3_vtab derived structure. - - - Non-zero if this error message should also be logged using the - class. - - - Non-zero if caught exceptions should be logged using the - class. - - - The error message. - - - Non-zero upon success. - - - - - Gets and returns the interface - implementation to be used when creating the native sqlite3_module - structure. Derived classes may override this method to supply an - alternate implementation for the - interface. - - - The interface implementation to - be used when populating the native sqlite3_module structure. If - the returned value is null, the private methods provided by the - class and relating to the - interface will be used to - create the necessary delegates. - - - - - Creates and returns the - interface implementation corresponding to the current - object instance. - - - The interface implementation - corresponding to the current object - instance. - - - - - Allocates a native sqlite3_vtab derived structure and returns a - native pointer to it. - - - A native pointer to a native sqlite3_vtab derived structure. - - - - - Zeros out the fields of a native sqlite3_vtab derived structure. - - - The native pointer to the native sqlite3_vtab derived structure to - zero. - - - - - Frees a native sqlite3_vtab structure using the provided native - pointer to it. - - - A native pointer to a native sqlite3_vtab derived structure. - - - - - Allocates a native sqlite3_vtab_cursor derived structure and - returns a native pointer to it. - - - A native pointer to a native sqlite3_vtab_cursor derived structure. - - - - - Frees a native sqlite3_vtab_cursor structure using the provided - native pointer to it. - - - A native pointer to a native sqlite3_vtab_cursor derived structure. - - - - - Reads and returns the native pointer to the sqlite3_vtab derived - structure based on the native pointer to the sqlite3_vtab_cursor - derived structure. - - - The object instance to be used. - - - The native pointer to the sqlite3_vtab_cursor derived structure - from which to read the native pointer to the sqlite3_vtab derived - structure. - - - The native pointer to the sqlite3_vtab derived structure -OR- - if it cannot be determined. - - - - - Reads and returns the native pointer to the sqlite3_vtab derived - structure based on the native pointer to the sqlite3_vtab_cursor - derived structure. - - - The native pointer to the sqlite3_vtab_cursor derived structure - from which to read the native pointer to the sqlite3_vtab derived - structure. - - - The native pointer to the sqlite3_vtab derived structure -OR- - if it cannot be determined. - - - - - Looks up and returns the object - instance based on the native pointer to the sqlite3_vtab derived - structure. - - - The native pointer to the sqlite3_vtab derived structure. - - - The object instance or null if - the corresponding one cannot be found. - - - - - Allocates and returns a native pointer to a sqlite3_vtab derived - structure and creates an association between it and the specified - object instance. - - - The object instance to be used - when creating the association. - - - The native pointer to a sqlite3_vtab derived structure or - if the method fails for any reason. - - - - - Looks up and returns the - object instance based on the native pointer to the - sqlite3_vtab_cursor derived structure. - - - The native pointer to the sqlite3_vtab derived structure. - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - The object instance or null - if the corresponding one cannot be found. - - - - - Allocates and returns a native pointer to a sqlite3_vtab_cursor - derived structure and creates an association between it and the - specified object instance. - - - The object instance to be - used when creating the association. - - - The native pointer to a sqlite3_vtab_cursor derived structure or - if the method fails for any reason. - - - - - Deterimines the key that should be used to identify and store the - object instance for the virtual table - (i.e. to be returned via the - method). - - - The number of arguments to the virtual table function. - - - The name of the virtual table function. - - - The object instance associated with - this virtual table function. - - - The string that should be used to identify and store the virtual - table function instance. This method cannot return null. If null - is returned from this method, the behavior is undefined. - - - - - Attempts to declare the schema for the virtual table using the - specified database connection. - - - The object instance to use when - declaring the schema of the virtual table. This parameter may not - be null. - - - The string containing the CREATE TABLE statement that completely - describes the schema for the virtual table. This parameter may not - be null. - - - Upon failure, this parameter must be modified to contain an error - message. - - - A standard SQLite return code. - - - - - Calls the native SQLite core library in order to declare a virtual - table function in response to a call into the - - or virtual table - methods. - - - The object instance to use when - declaring the schema of the virtual table. - - - The number of arguments to the function being declared. - - - The name of the function being declared. - - - Upon success, the contents of this parameter are undefined. Upon - failure, it should contain an appropriate error message. - - - A standard SQLite return code. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The native pointer to the sqlite3_vtab derived structure. - - - The error message. - - - Non-zero upon success. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance used to - lookup the native pointer to the sqlite3_vtab derived structure. - - - The error message. - - - Non-zero upon success. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance used to - lookup the native pointer to the sqlite3_vtab derived structure. - - - The error message. - - - Non-zero upon success. - - - - - Modifies the specified object instance - to contain the specified estimated cost. - - - The object instance to modify. - - - The estimated cost value to use. Using a null value means that the - default value provided by the SQLite core library should be used. - - - Non-zero upon success. - - - - - Modifies the specified object instance - to contain the default estimated cost. - - - The object instance to modify. - - - Non-zero upon success. - - - - - Modifies the specified object instance - to contain the specified estimated rows. - - - The object instance to modify. - - - The estimated rows value to use. Using a null value means that the - default value provided by the SQLite core library should be used. - - - Non-zero upon success. - - - - - Modifies the specified object instance - to contain the default estimated rows. - - - The object instance to modify. - - - Non-zero upon success. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - This method is called in response to the - method. - - - The object instance associated with - the virtual table. - - - The native user-data pointer associated with this module, as it was - provided to the SQLite core library when the native module instance - was created. - - - The module name, database name, virtual table name, and all other - arguments passed to the CREATE VIRTUAL TABLE statement. - - - Upon success, this parameter must be modified to contain the - object instance associated with - the virtual table. - - - Upon failure, this parameter must be modified to contain an error - message. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated with - the virtual table. - - - The native user-data pointer associated with this module, as it was - provided to the SQLite core library when the native module instance - was created. - - - The module name, database name, virtual table name, and all other - arguments passed to the CREATE VIRTUAL TABLE statement. - - - Upon success, this parameter must be modified to contain the - object instance associated with - the virtual table. - - - Upon failure, this parameter must be modified to contain an error - message. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The object instance containing all the - data for the inputs and outputs relating to index selection. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - Upon success, this parameter must be modified to contain the - object instance associated - with the newly opened virtual table cursor. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Number used to help identify the selected index. - - - String used to help identify the selected index. - - - The values corresponding to each column in the selected index. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Non-zero if no more rows are available; zero otherwise. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - The object instance to be used for - returning the specified column value to the SQLite core library. - - - The zero-based index corresponding to the column containing the - value to be returned. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the current row for the specified cursor. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The array of object instances containing - the new or modified column values, if any. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the row that was inserted, if any. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The number of arguments to the function being sought. - - - The name of the function being sought. - - - Upon success, this parameter must be modified to contain the - object instance responsible for - implementing the specified function. - - - Upon success, this parameter must be modified to contain the - native user-data pointer associated with - . - - - Non-zero if the specified function was found; zero otherwise. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The new name for the virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer identifier under which the the current state of - the virtual table should be saved. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer used to indicate that any saved states with an - identifier greater than or equal to this should be deleted by the - virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer identifier used to specify a specific saved - state for the virtual table for it to restore itself back to, which - should also have the effect of deleting all saved states with an - integer identifier greater than this one. - - - A standard SQLite return code. - - - - - Disposes of this object instance. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is being - called from the finalizer. - - - - - Finalizes this object instance. - - - - - Returns or sets a boolean value indicating whether virtual table - errors should be logged using the class. - - - - - Returns or sets a boolean value indicating whether exceptions - caught in the - method, - the method, - the method, - the method, - and the method should be logged using the - class. - - - - - Returns or sets a boolean value indicating whether virtual table - errors should be logged using the class. - - - - - Returns or sets a boolean value indicating whether exceptions - caught in the - method, - method, and the - method should be logged using the - class. - - - - - Returns non-zero if the schema for the virtual table has been - declared. - - - - - Returns the name of the module as it was registered with the SQLite - core library. - - - - - This class implements the - interface by forwarding those method calls to the - object instance it contains. If the - contained object instance is null, all - the methods simply generate an - error. - - - - - This is the value that is always used for the "logErrors" - parameter to the various static error handling methods provided - by the class. - - - - - This is the value that is always used for the "logExceptions" - parameter to the various static error handling methods provided - by the class. - - - - - This is the error message text used when the contained - object instance is not available - for any reason. - - - - - The object instance used to provide - an implementation of the - interface. - - - - - Constructs an instance of this class. - - - The object instance used to provide - an implementation of the - interface. - - - - - Sets the table error message to one that indicates the native - module implementation is not available. - - - The native pointer to the sqlite3_vtab derived structure. - - - The value of . - - - - - Sets the table error message to one that indicates the native - module implementation is not available. - - - The native pointer to the sqlite3_vtab_cursor derived - structure. - - - The value of . - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - Disposes of this object instance. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is being - called from the finalizer. - - - - - Finalizes this object instance. - - - - - This class represents a virtual table cursor to be used with the - class. It is not sealed and may - be used as the base class for any user-defined virtual table cursor - class that wraps an object instance. - - - - - The instance provided when this cursor - was created. - - - - - This value will be non-zero if false has been returned from the - method. - - - - - Constructs an instance of this class. - - - The object instance associated - with this object instance. - - - The instance to expose as a virtual - table cursor. - - - - - Advances to the next row of the virtual table cursor using the - method of the - object instance. - - - Non-zero if the current row is valid; zero otherwise. If zero is - returned, no further rows are available. - - - - - Resets the virtual table cursor position, also invalidating the - current row, using the method of - the object instance. - - - - - Closes the virtual table cursor. This method must not throw any - exceptions. - - - - - Throws an if the virtual - table cursor has been closed. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is - being called from the finalizer. - - - - - Returns the value for the current row of the virtual table cursor - using the property of the - object instance. - - - - - Returns non-zero if the end of the virtual table cursor has been - seen (i.e. no more rows are available, including the current one). - - - - - Returns non-zero if the virtual table cursor is open. - - - - - This class implements a virtual table module that exposes an - object instance as a read-only virtual - table. It is not sealed and may be used as the base class for any - user-defined virtual table class that wraps an - object instance. The following short - example shows it being used to treat an array of strings as a table - data source: - - public static class Sample - { - public static void Main() - { - using (SQLiteConnection connection = new SQLiteConnection( - "Data Source=:memory:;")) - { - connection.Open(); - - connection.CreateModule(new SQLiteModuleEnumerable( - "sampleModule", new string[] { "one", "two", "three" })); - - using (SQLiteCommand command = connection.CreateCommand()) - { - command.CommandText = - "CREATE VIRTUAL TABLE t1 USING sampleModule;"; - - command.ExecuteNonQuery(); - } - - using (SQLiteCommand command = connection.CreateCommand()) - { - command.CommandText = "SELECT * FROM t1;"; - - using (SQLiteDataReader dataReader = command.ExecuteReader()) - { - while (dataReader.Read()) - Console.WriteLine(dataReader[0].ToString()); - } - } - - connection.Close(); - } - } - } - - - - - - This class implements a virtual table module that does nothing by - providing "empty" implementations for all of the - interface methods. The result - codes returned by these "empty" method implementations may be - controlled on a per-method basis by using and/or overriding the - , - , - , - , and - methods from within derived classes. - - - - - This field is used to store the - values to return, on a per-method basis, for all methods that are - part of the interface. - - - - - Constructs an instance of this class. - - - The name of the module. This parameter cannot be null. - - - - - Determines the default value to be - returned by methods of the - interface that lack an overridden implementation in all classes - derived from the class. - - - The value that should be returned - by all interface methods unless - a more specific result code has been set for that interface method. - - - - - Converts a value into a boolean - return value for use with the - method. - - - The value to convert. - - - The value. - - - - - Converts a value into a boolean - return value for use with the - method. - - - The value to convert. - - - The value. - - - - - Determines the value that should be - returned by the specified - interface method if it lack an overridden implementation. If no - specific value is available (or set) - for the specified method, the value - returned by the method will be - returned instead. - - - The name of the method. Currently, this method must be part of - the interface. - - - The value that should be returned - by the interface method. - - - - - Sets the value that should be - returned by the specified - interface method if it lack an overridden implementation. - - - The name of the method. Currently, this method must be part of - the interface. - - - The value that should be returned - by the interface method. - - - Non-zero upon success. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is - being called from the finalizer. - - - - - The CREATE TABLE statement used to declare the schema for the - virtual table. - - - - - The instance containing the backing data - for the virtual table. - - - - - Non-zero if different object instances with the same value should - generate different row identifiers, where applicable. This has no - effect on the .NET Compact Framework. - - - - - Constructs an instance of this class. - - - The name of the module. This parameter cannot be null. - - - The instance to expose as a virtual - table. This parameter cannot be null. - - - - - Constructs an instance of this class. - - - The name of the module. This parameter cannot be null. - - - The instance to expose as a virtual - table. This parameter cannot be null. - - - Non-zero if different object instances with the same value should - generate different row identifiers, where applicable. This - parameter has no effect on the .NET Compact Framework. - - - - - Determines the SQL statement used to declare the virtual table. - This method should be overridden in derived classes if they require - a custom virtual table schema. - - - The SQL statement used to declare the virtual table -OR- null if it - cannot be determined. - - - - - Sets the table error message to one that indicates the virtual - table cursor is of the wrong type. - - - The object instance. - - - The value of . - - - - - Sets the table error message to one that indicates the virtual - table cursor has no current row. - - - The object instance. - - - The value of . - - - - - Determines the string to return as the column value for the object - instance value. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - The object instance to return a string representation for. - - - The string representation of the specified object instance or null - upon failure. - - - - - Constructs an unique row identifier from two - values. The first value - must contain the row sequence number for the current row and the - second value must contain the hash code of the enumerator value - for the current row. - - - The integer row sequence number for the current row. - - - The hash code of the enumerator value for the current row. - - - The unique row identifier or zero upon failure. - - - - - Determines the unique row identifier for the current row. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - The object instance to return a unique row identifier for. - - - The unique row identifier or zero upon failure. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is - being called from the finalizer. - - - - - This class represents a virtual table cursor to be used with the - class. It is not sealed and may - be used as the base class for any user-defined virtual table cursor - class that wraps an object instance. - - - - - The instance provided when this - cursor was created. - - - - - Constructs an instance of this class. - - - The object instance associated - with this object instance. - - - The instance to expose as a virtual - table cursor. - - - - - Closes the virtual table cursor. This method must not throw any - exceptions. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is - being called from the finalizer. - - - - - Returns the value for the current row of the virtual table cursor - using the property of the - object instance. - - - - - This class implements a virtual table module that exposes an - object instance as a read-only virtual - table. It is not sealed and may be used as the base class for any - user-defined virtual table class that wraps an - object instance. - - - - - The instance containing the backing - data for the virtual table. - - - - - Constructs an instance of this class. - - - The name of the module. This parameter cannot be null. - - - The instance to expose as a virtual - table. This parameter cannot be null. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is - being called from the finalizer. - - -
-
diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/3.5/x64/SQLite.Interop.dll b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/3.5/x64/SQLite.Interop.dll deleted file mode 100644 index 2ac14083..00000000 Binary files a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/3.5/x64/SQLite.Interop.dll and /dev/null differ diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/3.5/x86/SQLite.Interop.dll b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/3.5/x86/SQLite.Interop.dll deleted file mode 100644 index c04f0e7e..00000000 Binary files a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/3.5/x86/SQLite.Interop.dll and /dev/null differ diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.0/System.Data.SQLite.dll b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.0/System.Data.SQLite.dll deleted file mode 100644 index 0e434fcc..00000000 Binary files a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.0/System.Data.SQLite.dll and /dev/null differ diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.0/System.Data.SQLite.xml b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.0/System.Data.SQLite.xml deleted file mode 100644 index 6df7eb75..00000000 --- a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.0/System.Data.SQLite.xml +++ /dev/null @@ -1,13100 +0,0 @@ - - - - System.Data.SQLite - - - - - Defines a source code identifier custom attribute for an assembly - manifest. - - - - - Constructs an instance of this attribute class using the specified - source code identifier value. - - - The source code identifier value to use. - - - - - Gets the source code identifier value. - - - - - Defines a source code time-stamp custom attribute for an assembly - manifest. - - - - - Constructs an instance of this attribute class using the specified - source code time-stamp value. - - - The source code time-stamp value to use. - - - - - Gets the source code time-stamp value. - - - - - This is the method signature for the SQLite core library logging callback - function for use with sqlite3_log() and the SQLITE_CONFIG_LOG. - - WARNING: This delegate is used more-or-less directly by native code, do - not modify its type signature. - - - The extra data associated with this message, if any. - - - The error code associated with this message. - - - The message string to be logged. - - - - - This class implements SQLiteBase completely, and is the guts of the code that interop's SQLite with .NET - - - - - This internal class provides the foundation of SQLite support. It defines all the abstract members needed to implement - a SQLite data provider, and inherits from SQLiteConvert which allows for simple translations of string to and from SQLite. - - - - - This base class provides datatype conversion services for the SQLite provider. - - - - - The format string for DateTime values when using the InvariantCulture or CurrentCulture formats. - - - - - The value for the Unix epoch (e.g. January 1, 1970 at midnight, in UTC). - - - - - The value of the OLE Automation epoch represented as a Julian day. - - - - - An array of ISO-8601 DateTime formats that we support parsing. - - - - - The internal default format for UTC DateTime values when converting - to a string. - - - - - The internal default format for local DateTime values when converting - to a string. - - - - - An UTF-8 Encoding instance, so we can convert strings to and from UTF-8 - - - - - The default DateTime format for this instance. - - - - - The default DateTimeKind for this instance. - - - - - The default DateTime format string for this instance. - - - - - Initializes the conversion class - - The default date/time format to use for this instance - The DateTimeKind to use. - The DateTime format string to use. - - - - Converts a string to a UTF-8 encoded byte array sized to include a null-terminating character. - - The string to convert to UTF-8 - A byte array containing the converted string plus an extra 0 terminating byte at the end of the array. - - - - Convert a DateTime to a UTF-8 encoded, zero-terminated byte array. - - - This function is a convenience function, which first calls ToString() on the DateTime, and then calls ToUTF8() with the - string result. - - The DateTime to convert. - The UTF-8 encoded string, including a 0 terminating byte at the end of the array. - - - - Converts a UTF-8 encoded IntPtr of the specified length into a .NET string - - The pointer to the memory where the UTF-8 string is encoded - The number of bytes to decode - A string containing the translated character(s) - - - - Converts a UTF-8 encoded IntPtr of the specified length into a .NET string - - The pointer to the memory where the UTF-8 string is encoded - The number of bytes to decode - A string containing the translated character(s) - - - - Converts a string into a DateTime, using the DateTimeFormat, DateTimeKind, - and DateTimeFormatString specified for the connection when it was opened. - - - Acceptable ISO8601 DateTime formats are: - - THHmmssK - THHmmK - HH:mm:ss.FFFFFFFK - HH:mm:ssK - HH:mmK - yyyy-MM-dd HH:mm:ss.FFFFFFFK - yyyy-MM-dd HH:mm:ssK - yyyy-MM-dd HH:mmK - yyyy-MM-ddTHH:mm:ss.FFFFFFFK - yyyy-MM-ddTHH:mmK - yyyy-MM-ddTHH:mm:ssK - yyyyMMddHHmmssK - yyyyMMddHHmmK - yyyyMMddTHHmmssFFFFFFFK - THHmmss - THHmm - HH:mm:ss.FFFFFFF - HH:mm:ss - HH:mm - yyyy-MM-dd HH:mm:ss.FFFFFFF - yyyy-MM-dd HH:mm:ss - yyyy-MM-dd HH:mm - yyyy-MM-ddTHH:mm:ss.FFFFFFF - yyyy-MM-ddTHH:mm - yyyy-MM-ddTHH:mm:ss - yyyyMMddHHmmss - yyyyMMddHHmm - yyyyMMddTHHmmssFFFFFFF - yyyy-MM-dd - yyyyMMdd - yy-MM-dd - - If the string cannot be matched to one of the above formats -OR- - the DateTimeFormatString if one was provided, an exception will - be thrown. - - The string containing either a long integer number of 100-nanosecond units since - System.DateTime.MinValue, a Julian day double, an integer number of seconds since the Unix epoch, a - culture-independent formatted date and time string, a formatted date and time string in the current - culture, or an ISO8601-format string. - A DateTime value - - - - Converts a string into a DateTime, using the specified DateTimeFormat, - DateTimeKind and DateTimeFormatString. - - - Acceptable ISO8601 DateTime formats are: - - THHmmssK - THHmmK - HH:mm:ss.FFFFFFFK - HH:mm:ssK - HH:mmK - yyyy-MM-dd HH:mm:ss.FFFFFFFK - yyyy-MM-dd HH:mm:ssK - yyyy-MM-dd HH:mmK - yyyy-MM-ddTHH:mm:ss.FFFFFFFK - yyyy-MM-ddTHH:mmK - yyyy-MM-ddTHH:mm:ssK - yyyyMMddHHmmssK - yyyyMMddHHmmK - yyyyMMddTHHmmssFFFFFFFK - THHmmss - THHmm - HH:mm:ss.FFFFFFF - HH:mm:ss - HH:mm - yyyy-MM-dd HH:mm:ss.FFFFFFF - yyyy-MM-dd HH:mm:ss - yyyy-MM-dd HH:mm - yyyy-MM-ddTHH:mm:ss.FFFFFFF - yyyy-MM-ddTHH:mm - yyyy-MM-ddTHH:mm:ss - yyyyMMddHHmmss - yyyyMMddHHmm - yyyyMMddTHHmmssFFFFFFF - yyyy-MM-dd - yyyyMMdd - yy-MM-dd - - If the string cannot be matched to one of the above formats -OR- - the DateTimeFormatString if one was provided, an exception will - be thrown. - - The string containing either a long integer number of 100-nanosecond units since - System.DateTime.MinValue, a Julian day double, an integer number of seconds since the Unix epoch, a - culture-independent formatted date and time string, a formatted date and time string in the current - culture, or an ISO8601-format string. - The SQLiteDateFormats to use. - The DateTimeKind to use. - The DateTime format string to use. - A DateTime value - - - - Converts a julianday value into a DateTime - - The value to convert - A .NET DateTime - - - - Converts a julianday value into a DateTime - - The value to convert - The DateTimeKind to use. - A .NET DateTime - - - - Converts the specified number of seconds from the Unix epoch into a - value. - - - The number of whole seconds since the Unix epoch. - - - Either Utc or Local time. - - - The new value. - - - - - Converts the specified number of ticks since the epoch into a - value. - - - The number of whole ticks since the epoch. - - - Either Utc or Local time. - - - The new value. - - - - - Converts a DateTime struct to a JulianDay double - - The DateTime to convert - The JulianDay value the Datetime represents - - - - Converts a DateTime struct to the whole number of seconds since the - Unix epoch. - - The DateTime to convert - The whole number of seconds since the Unix epoch - - - - Returns the DateTime format string to use for the specified DateTimeKind. - If is not null, it will be returned verbatim. - - The DateTimeKind to use. - The DateTime format string to use. - - The DateTime format string to use for the specified DateTimeKind. - - - - - Converts a string into a DateTime, using the DateTimeFormat, DateTimeKind, - and DateTimeFormatString specified for the connection when it was opened. - - The DateTime value to convert - Either a string containing the long integer number of 100-nanosecond units since System.DateTime.MinValue, a - Julian day double, an integer number of seconds since the Unix epoch, a culture-independent formatted date and time - string, a formatted date and time string in the current culture, or an ISO8601-format date/time string. - - - - Internal function to convert a UTF-8 encoded IntPtr of the specified length to a DateTime. - - - This is a convenience function, which first calls ToString() on the IntPtr to convert it to a string, then calls - ToDateTime() on the string to return a DateTime. - - A pointer to the UTF-8 encoded string - The length in bytes of the string - The parsed DateTime value - - - - Smart method of splitting a string. Skips quoted elements, removes the quotes. - - - This split function works somewhat like the String.Split() function in that it breaks apart a string into - pieces and returns the pieces as an array. The primary differences are: - - Only one character can be provided as a separator character - Quoted text inside the string is skipped over when searching for the separator, and the quotes are removed. - - Thus, if splitting the following string looking for a comma:
- One,Two, "Three, Four", Five
-
- The resulting array would contain
- [0] One
- [1] Two
- [2] Three, Four
- [3] Five
-
- Note that the leading and trailing spaces were removed from each item during the split. -
- Source string to split apart - Separator character - A string array of the split up elements -
- - - Splits the specified string into multiple strings based on a separator - and returns the result as an array of strings. - - - The string to split into pieces based on the separator character. If - this string is null, null will always be returned. If this string is - empty, an array of zero strings will always be returned. - - - The character used to divide the original string into sub-strings. - This character cannot be a backslash or a double-quote; otherwise, no - work will be performed and null will be returned. - - - If this parameter is non-zero, all double-quote characters will be - retained in the returned list of strings; otherwise, they will be - dropped. - - - Upon failure, this parameter will be modified to contain an appropriate - error message. - - - The new array of strings or null if the input string is null -OR- the - separator character is a backslash or a double-quote -OR- the string - contains an unbalanced backslash or double-quote character. - - - - - Queries and returns the string representation for an object, using the - specified (or current) format provider. - - - The object instance to return the string representation for. - - - The format provider to use -OR- null if the current format provider for - the thread should be used instead. - - - The string representation for the object instance -OR- null if the - object instance is also null. - - - - - Convert a value to true or false. - - A string or number representing true or false - - - - - Convert a string to true or false. - - A string representing true or false - - - "yes", "no", "y", "n", "0", "1", "on", "off" as well as Boolean.FalseString and Boolean.TrueString will all be - converted to a proper boolean value. - - - - - Converts a SQLiteType to a .NET Type object - - The SQLiteType to convert - Returns a .NET Type object - - - - For a given intrinsic type, return a DbType - - The native type to convert - The corresponding (closest match) DbType - - - - Returns the ColumnSize for the given DbType - - The DbType to get the size of - - - - - Determines the type name for the given database value type. - - The connection context for custom type mappings, if any. - The database value type. - The flags associated with the parent connection object. - The type name or an empty string if it cannot be determined. - - - - Convert a DbType to a Type - - The DbType to convert from - The closest-match .NET type - - - - For a given type, return the closest-match SQLite TypeAffinity, which only understands a very limited subset of types. - - The type to evaluate - The SQLite type affinity for that type. - - - - Builds and returns a map containing the database column types - recognized by this provider. - - - A map containing the database column types recognized by this - provider. - - - - - For a given type name, return a closest-match .NET type - - The connection context for custom type mappings, if any. - The name of the type to match - The flags associated with the parent connection object. - The .NET DBType the text evaluates to. - - - - The error code used for logging exceptions caught in user-provided - code. - - - - - Sets the status of the memory usage tracking subsystem in the SQLite core library. By default, this is enabled. - If this is disabled, memory usage tracking will not be performed. This is not really a per-connection value, it is - global to the process. - - Non-zero to enable memory usage tracking, zero otherwise. - A standard SQLite return code (i.e. zero for success and non-zero for failure). - - - - Attempts to free as much heap memory as possible for the database connection. - - A standard SQLite return code (i.e. zero for success and non-zero for failure). - - - - Shutdown the SQLite engine so that it can be restarted with different config options. - We depend on auto initialization to recover. - - - - - Determines if the associated native connection handle is open. - - - Non-zero if a database connection is open. - - - - - Opens a database. - - - Implementers should call SQLiteFunction.BindFunctions() and save the array after opening a connection - to bind all attributed user-defined functions and collating sequences to the new connection. - - The filename of the database to open. SQLite automatically creates it if it doesn't exist. - The flags associated with the parent connection object - The open flags to use when creating the connection - The maximum size of the pool for the given filename - If true, the connection can be pulled from the connection pool - - - - Closes the currently-open database. - - - After the database has been closed implemeters should call SQLiteFunction.UnbindFunctions() to deallocate all interop allocated - memory associated with the user-defined functions and collating sequences tied to the closed connection. - - Non-zero if the operation is allowed to throw exceptions, zero otherwise. - - - - Sets the busy timeout on the connection. SQLiteCommand will call this before executing any command. - - The number of milliseconds to wait before returning SQLITE_BUSY - - - - Returns the text of the last error issued by SQLite - - - - - - Returns the text of the last error issued by SQLite -OR- the specified default error text if - none is available from the SQLite core library. - - - The error text to return in the event that one is not available from the SQLite core library. - - - The error text. - - - - - When pooling is enabled, force this connection to be disposed rather than returned to the pool - - - - - When pooling is enabled, returns the number of pool entries matching the current file name. - - The number of pool entries matching the current file name. - - - - Prepares a SQL statement for execution. - - The source connection preparing the command. Can be null for any caller except LINQ - The SQL command text to prepare - The previous statement in a multi-statement command, or null if no previous statement exists - The timeout to wait before aborting the prepare - The remainder of the statement that was not processed. Each call to prepare parses the - SQL up to to either the end of the text or to the first semi-colon delimiter. The remaining text is returned - here for a subsequent call to Prepare() until all the text has been processed. - Returns an initialized SQLiteStatement. - - - - Steps through a prepared statement. - - The SQLiteStatement to step through - True if a row was returned, False if not. - - - - Resets a prepared statement so it can be executed again. If the error returned is SQLITE_SCHEMA, - transparently attempt to rebuild the SQL statement and throw an error if that was not possible. - - The statement to reset - Returns -1 if the schema changed while resetting, 0 if the reset was sucessful or 6 (SQLITE_LOCKED) if the reset failed due to a lock - - - - Attempts to interrupt the query currently executing on the associated - native database connection. - - - - - This function binds a user-defined functions to the connection. - - - The object instance containing - the metadata for the function to be bound. - - - The object instance that implements the - function to be bound. - - - The flags associated with the parent connection object. - - - - - Calls the native SQLite core library in order to create a disposable - module containing the implementation of a virtual table. - - - The module object to be used when creating the native disposable module. - - - The flags for the associated object instance. - - - - - Calls the native SQLite core library in order to cleanup the resources - associated with a module containing the implementation of a virtual table. - - - The module object previously passed to the - method. - - - The flags for the associated object instance. - - - - - Calls the native SQLite core library in order to declare a virtual table - in response to a call into the - or virtual table methods. - - - The virtual table module that is to be responsible for the virtual table - being declared. - - - The string containing the SQL statement describing the virtual table to - be declared. - - - Upon success, the contents of this parameter are undefined. Upon failure, - it should contain an appropriate error message. - - - A standard SQLite return code. - - - - - Calls the native SQLite core library in order to declare a virtual table - function in response to a call into the - or virtual table methods. - - - The virtual table module that is to be responsible for the virtual table - function being declared. - - - The number of arguments to the function being declared. - - - The name of the function being declared. - - - Upon success, the contents of this parameter are undefined. Upon failure, - it should contain an appropriate error message. - - - A standard SQLite return code. - - - - - Enables or disabled extension loading by SQLite. - - - True to enable loading of extensions, false to disable. - - - - - Loads a SQLite extension library from the named file. - - - The name of the dynamic link library file containing the extension. - - - The name of the exported function used to initialize the extension. - If null, the default "sqlite3_extension_init" will be used. - - - - - Enables or disabled extened result codes returned by SQLite - - true to enable extended result codes, false to disable. - - - - - Returns the numeric result code for the most recent failed SQLite API call - associated with the database connection. - - Result code - - - - Returns the extended numeric result code for the most recent failed SQLite API call - associated with the database connection. - - Extended result code - - - - Add a log message via the SQLite sqlite3_log interface. - - Error code to be logged with the message. - String to be logged. Unlike the SQLite sqlite3_log() - interface, this should be pre-formatted. Consider using the - String.Format() function. - - - - - Checks if the SQLite core library has been initialized in the current process. - - - Non-zero if the SQLite core library has been initialized in the current process, - zero otherwise. - - - - - Creates a new SQLite backup object based on the provided destination - database connection. The source database connection is the one - associated with this object. The source and destination database - connections cannot be the same. - - The destination database connection. - The destination database name. - The source database name. - The newly created backup object. - - - - Copies up to N pages from the source database to the destination - database associated with the specified backup object. - - The backup object to use. - - The number of pages to copy or negative to copy all remaining pages. - - - Set to true if the operation needs to be retried due to database - locking issues. - - - True if there are more pages to be copied, false otherwise. - - - - - Returns the number of pages remaining to be copied from the source - database to the destination database associated with the specified - backup object. - - The backup object to check. - The number of pages remaining to be copied. - - - - Returns the total number of pages in the source database associated - with the specified backup object. - - The backup object to check. - The total number of pages in the source database. - - - - Destroys the backup object, rolling back any backup that may be in - progess. - - The backup object to destroy. - - - - Returns the error message for the specified SQLite return code using - the internal static lookup table. - - The SQLite return code. - The error message or null if it cannot be found. - - - - Returns the error message for the specified SQLite return code using - the sqlite3_errstr() function, falling back to the internal lookup - table if necessary. - - The SQLite return code. - The error message or null if it cannot be found. - - - - Returns a string representing the active version of SQLite - - - - - Returns an integer representing the active version of SQLite - - - - - Returns the rowid of the most recent successful INSERT into the database from this connection. - - - - - Returns the number of changes the last executing insert/update caused. - - - - - Returns the amount of memory (in bytes) currently in use by the SQLite core library. This is not really a per-connection - value, it is global to the process. - - - - - Returns the maximum amount of memory (in bytes) used by the SQLite core library since the high-water mark was last reset. - This is not really a per-connection value, it is global to the process. - - - - - Returns non-zero if the underlying native connection handle is owned by this instance. - - - - - Returns non-zero if the given database connection is in autocommit mode. - Autocommit mode is on by default. Autocommit mode is disabled by a BEGIN - statement. Autocommit mode is re-enabled by a COMMIT or ROLLBACK. - - - - - The opaque pointer returned to us by the sqlite provider - - - - - The user-defined functions registered on this connection - - - - - The modules created using this connection. - - - - - Constructs the object used to interact with the SQLite core library - using the UTF-8 text encoding. - - - The DateTime format to be used when converting string values to a - DateTime and binding DateTime parameters. - - - The to be used when creating DateTime - values. - - - The format string to be used when parsing and formatting DateTime - values. - - - The native handle to be associated with the database connection. - - - The fully qualified file name associated with . - - - Non-zero if the newly created object instance will need to dispose - of when it is no longer needed. - - - - - This method attempts to dispose of all the derived - object instances currently associated with the native database connection. - - - - - Attempts to interrupt the query currently executing on the associated - native database connection. - - - - - This function binds a user-defined function to the connection. - - - The object instance containing - the metadata for the function to be bound. - - - The object instance that implements the - function to be bound. - - - The flags associated with the parent connection object. - - - - - Attempts to free as much heap memory as possible for the database connection. - - A standard SQLite return code (i.e. zero for success and non-zero for failure). - - - - Attempts to free N bytes of heap memory by deallocating non-essential memory - allocations held by the database library. Memory used to cache database pages - to improve performance is an example of non-essential memory. This is a no-op - returning zero if the SQLite core library was not compiled with the compile-time - option SQLITE_ENABLE_MEMORY_MANAGEMENT. Optionally, attempts to reset and/or - compact the Win32 native heap, if applicable. - - - The requested number of bytes to free. - - - Non-zero to attempt a heap reset. - - - Non-zero to attempt heap compaction. - - - The number of bytes actually freed. This value may be zero. - - - This value will be non-zero if the heap reset was successful. - - - The size of the largest committed free block in the heap, in bytes. - This value will be zero unless heap compaction is enabled. - - - A standard SQLite return code (i.e. zero for success and non-zero - for failure). - - - - - Shutdown the SQLite engine so that it can be restarted with different - configuration options. We depend on auto initialization to recover. - - Returns a standard SQLite result code. - - - - Shutdown the SQLite engine so that it can be restarted with different - configuration options. We depend on auto initialization to recover. - - - Non-zero to reset the database and temporary directories to their - default values, which should be null for both. This parameter has no - effect on non-Windows operating systems. - - Returns a standard SQLite result code. - - - - Determines if the associated native connection handle is open. - - - Non-zero if the associated native connection handle is open. - - - - - Calls the native SQLite core library in order to create a disposable - module containing the implementation of a virtual table. - - - The module object to be used when creating the native disposable module. - - - The flags for the associated object instance. - - - - - Calls the native SQLite core library in order to cleanup the resources - associated with a module containing the implementation of a virtual table. - - - The module object previously passed to the - method. - - - The flags for the associated object instance. - - - - - Calls the native SQLite core library in order to declare a virtual table - in response to a call into the - or virtual table methods. - - - The virtual table module that is to be responsible for the virtual table - being declared. - - - The string containing the SQL statement describing the virtual table to - be declared. - - - Upon success, the contents of this parameter are undefined. Upon failure, - it should contain an appropriate error message. - - - A standard SQLite return code. - - - - - Calls the native SQLite core library in order to declare a virtual table - function in response to a call into the - or virtual table methods. - - - The virtual table module that is to be responsible for the virtual table - function being declared. - - - The number of arguments to the function being declared. - - - The name of the function being declared. - - - Upon success, the contents of this parameter are undefined. Upon failure, - it should contain an appropriate error message. - - - A standard SQLite return code. - - - - - Enables or disabled extension loading by SQLite. - - - True to enable loading of extensions, false to disable. - - - - - Loads a SQLite extension library from the named file. - - - The name of the dynamic link library file containing the extension. - - - The name of the exported function used to initialize the extension. - If null, the default "sqlite3_extension_init" will be used. - - - - Enables or disabled extended result codes returned by SQLite - - - Gets the last SQLite error code - - - Gets the last SQLite extended error code - - - Add a log message via the SQLite sqlite3_log interface. - - - Add a log message via the SQLite sqlite3_log interface. - - - - Allows the setting of a logging callback invoked by SQLite when a - log event occurs. Only one callback may be set. If NULL is passed, - the logging callback is unregistered. - - The callback function to invoke. - Returns a result code - - - - Creates a new SQLite backup object based on the provided destination - database connection. The source database connection is the one - associated with this object. The source and destination database - connections cannot be the same. - - The destination database connection. - The destination database name. - The source database name. - The newly created backup object. - - - - Copies up to N pages from the source database to the destination - database associated with the specified backup object. - - The backup object to use. - - The number of pages to copy, negative to copy all remaining pages. - - - Set to true if the operation needs to be retried due to database - locking issues; otherwise, set to false. - - - True if there are more pages to be copied, false otherwise. - - - - - Returns the number of pages remaining to be copied from the source - database to the destination database associated with the specified - backup object. - - The backup object to check. - The number of pages remaining to be copied. - - - - Returns the total number of pages in the source database associated - with the specified backup object. - - The backup object to check. - The total number of pages in the source database. - - - - Destroys the backup object, rolling back any backup that may be in - progess. - - The backup object to destroy. - - - - Determines if the SQLite core library has been initialized for the - current process. - - - A boolean indicating whether or not the SQLite core library has been - initialized for the current process. - - - - - Determines if the SQLite core library has been initialized for the - current process. - - - A boolean indicating whether or not the SQLite core library has been - initialized for the current process. - - - - - Helper function to retrieve a column of data from an active statement. - - The statement being step()'d through - The flags associated with the connection. - The column index to retrieve - The type of data contained in the column. If Uninitialized, this function will retrieve the datatype information. - Returns the data in the column - - - - Returns non-zero if the underlying native connection handle is owned - by this instance. - - - - - Alternate SQLite3 object, overriding many text behaviors to support UTF-16 (Unicode) - - - - - Constructs the object used to interact with the SQLite core library - using the UTF-8 text encoding. - - - The DateTime format to be used when converting string values to a - DateTime and binding DateTime parameters. - - - The to be used when creating DateTime - values. - - - The format string to be used when parsing and formatting DateTime - values. - - - The native handle to be associated with the database connection. - - - The fully qualified file name associated with . - - - Non-zero if the newly created object instance will need to dispose - of when it is no longer needed. - - - - - Overrides SQLiteConvert.ToString() to marshal UTF-16 strings instead of UTF-8 - - A pointer to a UTF-16 string - The length (IN BYTES) of the string - A .NET string - - - - Represents a single SQL backup in SQLite. - - - - - The underlying SQLite object this backup is bound to. - - - - - The actual backup handle. - - - - - The destination database for the backup. - - - - - The destination database name for the backup. - - - - - The source database for the backup. - - - - - The source database name for the backup. - - - - - The last result from the StepBackup method of the SQLite3 class. - This is used to determine if the call to the FinishBackup method of - the SQLite3 class should throw an exception when it receives a non-Ok - return code from the core SQLite library. - - - - - Initializes the backup. - - The base SQLite object. - The backup handle. - The destination database for the backup. - The destination database name for the backup. - The source database for the backup. - The source database name for the backup. - - - - Disposes and finalizes the backup. - - - - - The extra behavioral flags that can be applied to a connection. - - - - - No extra flags. - - - - - Enable logging of all SQL statements to be prepared. - - - - - Enable logging of all bound parameter types and raw values. - - - - - Enable logging of all bound parameter strongly typed values. - - - - - Enable logging of all exceptions caught from user-provided - managed code called from native code via delegates. - - - - - Enable logging of backup API errors. - - - - - Skip adding the extension functions provided by the native - interop assembly. - - - - - When binding parameter values with the - type, use the interop method that accepts an - value. - - - - - When binding parameter values, always bind them as though they were - plain text (i.e. no numeric, date/time, or other conversions should - be attempted). - - - - - When returning column values, always return them as though they were - plain text (i.e. no numeric, date/time, or other conversions should - be attempted). - - - - - Prevent this object instance from - loading extensions. - - - - - Prevent this object instance from - creating virtual table modules. - - - - - Skip binding any functions provided by other managed assemblies when - opening the connection. - - - - - Skip setting the logging related properties of the - object instance that was passed to - the method. - - - - - Enable logging of all virtual table module errors seen by the - method. - - - - - Enable logging of certain virtual table module exceptions that cannot - be easily discovered via other means. - - - - - Enable tracing of potentially important [non-fatal] error conditions - that cannot be easily reported through other means. - - - - - When binding parameter values, always use the invariant culture when - converting their values from strings. - - - - - When binding parameter values, always use the invariant culture when - converting their values to strings. - - - - - Disable using the connection pool by default. If the "Pooling" - connection string property is specified, its value will override - this flag. The precise outcome of combining this flag with the - flag is unspecified; however, - one of the flags will be in effect. - - - - - Enable using the connection pool by default. If the "Pooling" - connection string property is specified, its value will override - this flag. The precise outcome of combining this flag with the - flag is unspecified; however, - one of the flags will be in effect. - - - - - Enable using per-connection mappings between type names and - values. Also see the - , - , and - methods. These - per-connection mappings, when present, override the corresponding - global mappings. - - - - - Disable using global mappings between type names and - values. This may be useful in some very narrow - cases; however, if there are no per-connection type mappings, the - fallback defaults will be used for both type names and their - associated values. Therefore, use of this flag - is not recommended. - - - - - When binding parameter values or returning column values, always - treat them as though they were plain text (i.e. no numeric, - date/time, or other conversions should be attempted). - - - - - When binding parameter values, always use the invariant culture when - converting their values to strings or from strings. - - - - - When binding parameter values or returning column values, always - treat them as though they were plain text (i.e. no numeric, - date/time, or other conversions should be attempted) and always - use the invariant culture when converting their values to strings. - - - - - When binding parameter values or returning column values, always - treat them as though they were plain text (i.e. no numeric, - date/time, or other conversions should be attempted) and always - use the invariant culture when converting their values to strings - or from strings. - - - - - Enable all logging. - - - - - The default extra flags for new connections. - - - - - SQLite implementation of DbCommand. - - - - - The default connection string to be used when creating a temporary - connection to execute a command via the static - or - - methods. - - - - - The command text this command is based on - - - - - The connection the command is associated with - - - - - The version of the connection the command is associated with - - - - - Indicates whether or not a DataReader is active on the command. - - - - - The timeout for the command, kludged because SQLite doesn't support per-command timeout values - - - - - Designer support - - - - - Used by DbDataAdapter to determine updating behavior - - - - - The collection of parameters for the command - - - - - The SQL command text, broken into individual SQL statements as they are executed - - - - - Unprocessed SQL text that has not been executed - - - - - Transaction associated with this command - - - - - Constructs a new SQLiteCommand - - - Default constructor - - - - - Initializes the command with the given command text - - The SQL command text - - - - Initializes the command with the given SQL command text and attach the command to the specified - connection. - - The SQL command text - The connection to associate with the command - - - - Initializes the command and associates it with the specified connection. - - The connection to associate with the command - - - - Initializes a command with the given SQL, connection and transaction - - The SQL command text - The connection to associate with the command - The transaction the command should be associated with - - - - Disposes of the command and clears all member variables - - Whether or not the class is being explicitly or implicitly disposed - - - - This method attempts to query the flags associated with the database - connection in use. If the database connection is disposed, the default - flags will be returned. - - - The command containing the databse connection to query the flags from. - - - The connection flags value. - - - - - Clears and destroys all statements currently prepared - - - - - Builds an array of prepared statements for each complete SQL statement in the command text - - - - - Not implemented - - - - - Forwards to the local CreateParameter() function - - - - - - Create a new parameter - - - - - - This function ensures there are no active readers, that we have a valid connection, - that the connection is open, that all statements are prepared and all parameters are assigned - in preparation for allocating a data reader. - - - - - Creates a new SQLiteDataReader to execute/iterate the array of SQLite prepared statements - - The behavior the data reader should adopt - Returns a SQLiteDataReader object - - - - This method creates a new connection, executes the query using the given - execution type, closes the connection, and returns the results. If the - connection string is null, a temporary in-memory database connection will - be used. - - - The text of the command to be executed. - - - The execution type for the command. This is used to determine which method - of the command object to call, which then determines the type of results - returned, if any. - - - The connection string to the database to be opened, used, and closed. If - this parameter is null, a temporary in-memory databse will be used. - - - The SQL parameter values to be used when building the command object to be - executed, if any. - - - The results of the query -OR- null if no results were produced from the - given execution type. - - - - - This method creates a new connection, executes the query using the given - execution type and command behavior, closes the connection, and returns - the results. If the connection string is null, a temporary in-memory - database connection will be used. - - - The text of the command to be executed. - - - The execution type for the command. This is used to determine which method - of the command object to call, which then determines the type of results - returned, if any. - - - The command behavior flags for the command. - - - The connection string to the database to be opened, used, and closed. If - this parameter is null, a temporary in-memory databse will be used. - - - The SQL parameter values to be used when building the command object to be - executed, if any. - - - The results of the query -OR- null if no results were produced from the - given execution type. - - - - - Overrides the default behavior to return a SQLiteDataReader specialization class - - The flags to be associated with the reader. - A SQLiteDataReader - - - - Overrides the default behavior of DbDataReader to return a specialized SQLiteDataReader class - - A SQLiteDataReader - - - - Called by the SQLiteDataReader when the data reader is closed. - - - - - Execute the command and return the number of rows inserted/updated affected by it. - - The number of rows inserted/updated affected by it. - - - - Execute the command and return the number of rows inserted/updated affected by it. - - The flags to be associated with the reader. - The number of rows inserted/updated affected by it. - - - - Execute the command and return the first column of the first row of the resultset - (if present), or null if no resultset was returned. - - The first column of the first row of the first resultset from the query. - - - - Execute the command and return the first column of the first row of the resultset - (if present), or null if no resultset was returned. - - The flags to be associated with the reader. - The first column of the first row of the first resultset from the query. - - - - Does nothing. Commands are prepared as they are executed the first time, and kept in prepared state afterwards. - - - - - Clones a command, including all its parameters - - A new SQLiteCommand with the same commandtext, connection and parameters - - - - The SQL command text associated with the command - - - - - The amount of time to wait for the connection to become available before erroring out - - - - - The type of the command. SQLite only supports CommandType.Text - - - - - The connection associated with this command - - - - - Forwards to the local Connection property - - - - - Returns the SQLiteParameterCollection for the given command - - - - - Forwards to the local Parameters property - - - - - The transaction associated with this command. SQLite only supports one transaction per connection, so this property forwards to the - command's underlying connection. - - - - - Forwards to the local Transaction property - - - - - Sets the method the SQLiteCommandBuilder uses to determine how to update inserted or updated rows in a DataTable. - - - - - Determines if the command is visible at design time. Defaults to True. - - - - - SQLite implementation of DbCommandBuilder. - - - - - Default constructor - - - - - Initializes the command builder and associates it with the specified data adapter. - - - - - - Minimal amount of parameter processing. Primarily sets the DbType for the parameter equal to the provider type in the schema - - The parameter to use in applying custom behaviors to a row - The row to apply the parameter to - The type of statement - Whether the application of the parameter is part of a WHERE clause - - - - Returns a valid named parameter - - The name of the parameter - Error - - - - Returns a named parameter for the given ordinal - - The i of the parameter - Error - - - - Returns a placeholder character for the specified parameter i. - - The index of the parameter to provide a placeholder for - Returns a named parameter - - - - Sets the handler for receiving row updating events. Used by the DbCommandBuilder to autogenerate SQL - statements that may not have previously been generated. - - A data adapter to receive events on. - - - - Returns the automatically-generated SQLite command to delete rows from the database - - - - - - Returns the automatically-generated SQLite command to delete rows from the database - - - - - - - Returns the automatically-generated SQLite command to update rows in the database - - - - - - Returns the automatically-generated SQLite command to update rows in the database - - - - - - - Returns the automatically-generated SQLite command to insert rows into the database - - - - - - Returns the automatically-generated SQLite command to insert rows into the database - - - - - - - Places brackets around an identifier - - The identifier to quote - The bracketed identifier - - - - Removes brackets around an identifier - - The quoted (bracketed) identifier - The undecorated identifier - - - - Override helper, which can help the base command builder choose the right keys for the given query - - - - - - - Gets/sets the DataAdapter for this CommandBuilder - - - - - Overridden to hide its property from the designer - - - - - Overridden to hide its property from the designer - - - - - Overridden to hide its property from the designer - - - - - Overridden to hide its property from the designer - - - - - Overridden to hide its property from the designer - - - - - Event data for connection event handlers. - - - - - The type of event being raised. - - - - - The associated with this event, if any. - - - - - The transaction associated with this event, if any. - - - - - The command associated with this event, if any. - - - - - The data reader associated with this event, if any. - - - - - The critical handle associated with this event, if any. - - - - - Command or message text associated with this event, if any. - - - - - Extra data associated with this event, if any. - - - - - Constructs the object. - - The type of event being raised. - The base associated - with this event, if any. - The transaction associated with this event, if any. - The command associated with this event, if any. - The data reader associated with this event, if any. - The critical handle associated with this event, if any. - The command or message text, if any. - The extra data, if any. - - - - Raised when an event pertaining to a connection occurs. - - The connection involved. - Extra information about the event. - - - - SQLite implentation of DbConnection. - - - The property can contain the following parameter(s), delimited with a semi-colon: - - - Parameter - Values - Required - Default - - - Data Source - - This may be a file name, the string ":memory:", or any supported URI (starting with SQLite 3.7.7). - Starting with release 1.0.86.0, in order to use more than one consecutive backslash (e.g. for a - UNC path), each of the adjoining backslash characters must be doubled (e.g. "\\Network\Share\test.db" - would become "\\\\Network\Share\test.db"). - - Y - - - - Version - 3 - N - 3 - - - UseUTF16Encoding - True
False
- N - False -
- - DateTimeFormat - - Ticks - Use the value of DateTime.Ticks.
- ISO8601 - Use the ISO-8601 format. Uses the "yyyy-MM-dd HH:mm:ss.FFFFFFFK" format for UTC - DateTime values and "yyyy-MM-dd HH:mm:ss.FFFFFFF" format for local DateTime values).
- JulianDay - The interval of time in days and fractions of a day since January 1, 4713 BC.
- UnixEpoch - The whole number of seconds since the Unix epoch (January 1, 1970).
- InvariantCulture - Any culture-independent string value that the .NET Framework can interpret as a valid DateTime.
- CurrentCulture - Any string value that the .NET Framework can interpret as a valid DateTime using the current culture.
- N - ISO8601 -
- - DateTimeKind - Unspecified - Not specified as either UTC or local time.
Utc - The time represented is UTC.
Local - The time represented is local time.
- N - Unspecified -
- - DateTimeFormatString - The exact DateTime format string to use for all formatting and parsing of all DateTime - values for this connection. - N - null - - - BaseSchemaName - Some base data classes in the framework (e.g. those that build SQL queries dynamically) - assume that an ADO.NET provider cannot support an alternate catalog (i.e. database) without supporting - alternate schemas as well; however, SQLite does not fit into this model. Therefore, this value is used - as a placeholder and removed prior to preparing any SQL statements that may contain it. - N - sqlite_default_schema - - - BinaryGUID - True - Store GUID columns in binary form
False - Store GUID columns as text
- N - True -
- - Cache Size - {size in bytes} - N - 2000 - - - Synchronous - Normal - Normal file flushing behavior
Full - Full flushing after all writes
Off - Underlying OS flushes I/O's
- N - Full -
- - Page Size - {size in bytes} - N - 1024 - - - Password - {password} - Using this parameter requires that the CryptoAPI based codec be enabled at compile-time for both the native interop assembly and the core managed assemblies; otherwise, using this parameter may result in an exception being thrown when attempting to open the connection. - N - - - - HexPassword - {hexPassword} - Must contain a sequence of zero or more hexadecimal encoded byte values without a leading "0x" prefix. Using this parameter requires that the CryptoAPI based codec be enabled at compile-time for both the native interop assembly and the core managed assemblies; otherwise, using this parameter may result in an exception being thrown when attempting to open the connection. - N - - - - Enlist - Y - Automatically enlist in distributed transactions
N - No automatic enlistment
- N - Y -
- - Pooling - - True - Use connection pooling.
- False - Do not use connection pooling.

- WARNING: When using the default connection pool implementation, - setting this property to True should be avoided by applications that make - use of COM (either directly or indirectly) due to possible deadlocks that - can occur during the finalization of some COM objects. -
- N - False -
- - FailIfMissing - True - Don't create the database if it does not exist, throw an error instead
False - Automatically create the database if it does not exist
- N - False -
- - Max Page Count - {size in pages} - Limits the maximum number of pages (limits the size) of the database - N - 0 - - - Legacy Format - True - Use the more compatible legacy 3.x database format
False - Use the newer 3.3x database format which compresses numbers more effectively
- N - False -
- - Default Timeout - {time in seconds}
The default command timeout
- N - 30 -
- - Journal Mode - Delete - Delete the journal file after a commit
Persist - Zero out and leave the journal file on disk after a commit
Off - Disable the rollback journal entirely
- N - Delete -
- - Read Only - True - Open the database for read only access
False - Open the database for normal read/write access
- N - False -
- - Max Pool Size - The maximum number of connections for the given connection string that can be in the connection pool - N - 100 - - - Default IsolationLevel - The default transaciton isolation level - N - Serializable - - - Foreign Keys - Enable foreign key constraints - N - False - - - Flags - Extra behavioral flags for the connection. See the enumeration for possible values. - N - Default - - - SetDefaults - - True - Apply the default connection settings to the opened database.
- False - Skip applying the default connection settings to the opened database. -
- N - True -
- - ToFullPath - - True - Attempt to expand the data source file name to a fully qualified path before opening.
- False - Skip attempting to expand the data source file name to a fully qualified path before opening. -
- N - True -
-
-
-
- - - The default "stub" (i.e. placeholder) base schema name to use when - returning column schema information. Used as the initial value of - the BaseSchemaName property. This should start with "sqlite_*" - because those names are reserved for use by SQLite (i.e. they cannot - be confused with the names of user objects). - - - - - The managed assembly containing this type. - - - - - Object used to synchronize access to the static instance data - for this class. - - - - - State of the current connection - - - - - The connection string - - - - - Nesting level of the transactions open on the connection - - - - - If set, then the connection is currently being disposed. - - - - - The default isolation level for new transactions - - - - - Whether or not the connection is enlisted in a distrubuted transaction - - - - - The per-connection mappings between type names and - values. These mappings override the corresponding global mappings. - - - - - The base SQLite object to interop with - - - - - The database filename minus path and extension - - - - - Temporary password storage, emptied after the database has been opened - - - - - The "stub" (i.e. placeholder) base schema name to use when returning - column schema information. - - - - - The extra behavioral flags for this connection, if any. See the - enumeration for a list of - possible values. - - - - - Default command timeout - - - - - Non-zero if the built-in (i.e. framework provided) connection string - parser should be used when opening the connection. - - - - - Constructs a new SQLiteConnection object - - - Default constructor - - - - - Initializes the connection with the specified connection string. - - The connection string to use. - - - - Initializes the connection with a pre-existing native connection handle. - This constructor overload is intended to be used only by the private - method. - - - The native connection handle to use. - - - The file name corresponding to the native connection handle. - - - Non-zero if this instance owns the native connection handle and - should dispose of it when it is no longer needed. - - - - - Initializes the connection with the specified connection string. - - - The connection string to use. - - - Non-zero to parse the connection string using the built-in (i.e. - framework provided) parser when opening the connection. - - - - - Clones the settings and connection string from an existing connection. If the existing connection is already open, this - function will open its own connection, enumerate any attached databases of the original connection, and automatically - attach to them. - - The connection to copy the settings from. - - - - Raises the event. - - - The connection associated with this event. If this parameter is not - null and the specified connection cannot raise events, then the - registered event handlers will not be invoked. - - - A that contains the event data. - - - - - Creates and returns a new managed database connection handle. This - method is intended to be used by implementations of the - interface only. In theory, it - could be used by other classes; however, that usage is not supported. - - - This must be a native database connection handle returned by the - SQLite core library and it must remain valid and open during the - entire duration of the calling method. - - - The new managed database connection handle or null if it cannot be - created. - - - - - Backs up the database, using the specified database connection as the - destination. - - The destination database connection. - The destination database name. - The source database name. - - The number of pages to copy or negative to copy all remaining pages. - - - The method to invoke between each step of the backup process. This - parameter may be null (i.e. no callbacks will be performed). - - - The number of milliseconds to sleep after encountering a locking error - during the backup process. A value less than zero means that no sleep - should be performed. - - - - - Clears the per-connection type mappings. - - - The total number of per-connection type mappings cleared. - - - - - Returns the per-connection type mappings. - - - The per-connection type mappings -OR- null if they are unavailable. - - - - - Adds a per-connection type mapping, possibly replacing one or more - that already exist. - - - The case-insensitive database type name (e.g. "MYDATE"). The value - of this parameter cannot be null. Using an empty string value (or - a string value consisting entirely of whitespace) for this parameter - is not recommended. - - - The value that should be associated with the - specified type name. - - - Non-zero if this mapping should be considered to be the primary one - for the specified . - - - A negative value if nothing was done. Zero if no per-connection type - mappings were replaced (i.e. it was a pure add operation). More than - zero if some per-connection type mappings were replaced. - - - - - Attempts to bind the specified object - instance to this connection. - - - The object instance containing - the metadata for the function to be bound. - - - The object instance that implements the - function to be bound. - - - - - Creates a clone of the connection. All attached databases and user-defined functions are cloned. If the existing connection is open, the cloned connection - will also be opened. - - - - - - Creates a database file. This just creates a zero-byte file which SQLite - will turn into a database when the file is opened properly. - - The file to create - - - - Raises the state change event when the state of the connection changes - - The new connection state. If this is different - from the previous state, the event is - raised. - The event data created for the raised event, if - it was actually raised. - - - - Determines and returns the fallback default isolation level when one cannot be - obtained from an existing connection instance. - - - The fallback default isolation level for this connection instance -OR- - if it cannot be determined. - - - - - Determines and returns the default isolation level for this connection instance. - - - The default isolation level for this connection instance -OR- - if it cannot be determined. - - - - - OBSOLETE. Creates a new SQLiteTransaction if one isn't already active on the connection. - - This parameter is ignored. - When TRUE, SQLite defers obtaining a write lock until a write operation is requested. - When FALSE, a writelock is obtained immediately. The default is TRUE, but in a multi-threaded multi-writer - environment, one may instead choose to lock the database immediately to avoid any possible writer deadlock. - Returns a SQLiteTransaction object. - - - - OBSOLETE. Creates a new SQLiteTransaction if one isn't already active on the connection. - - When TRUE, SQLite defers obtaining a write lock until a write operation is requested. - When FALSE, a writelock is obtained immediately. The default is false, but in a multi-threaded multi-writer - environment, one may instead choose to lock the database immediately to avoid any possible writer deadlock. - Returns a SQLiteTransaction object. - - - - Creates a new if one isn't already active on the connection. - - Supported isolation levels are Serializable, ReadCommitted and Unspecified. - - Unspecified will use the default isolation level specified in the connection string. If no isolation level is specified in the - connection string, Serializable is used. - Serializable transactions are the default. In this mode, the engine gets an immediate lock on the database, and no other threads - may begin a transaction. Other threads may read from the database, but not write. - With a ReadCommitted isolation level, locks are deferred and elevated as needed. It is possible for multiple threads to start - a transaction in ReadCommitted mode, but if a thread attempts to commit a transaction while another thread - has a ReadCommitted lock, it may timeout or cause a deadlock on both threads until both threads' CommandTimeout's are reached. - - Returns a SQLiteTransaction object. - - - - Creates a new if one isn't already - active on the connection. - - Returns the new transaction object. - - - - Forwards to the local function - - Supported isolation levels are Unspecified, Serializable, and ReadCommitted - - - - - This method is not implemented; however, the - event will still be raised. - - - - - - When the database connection is closed, all commands linked to this connection are automatically reset. - - - - - Clears the connection pool associated with the connection. Any other active connections using the same database file - will be discarded instead of returned to the pool when they are closed. - - - - - - Clears all connection pools. Any active connections will be discarded instead of sent to the pool when they are closed. - - - - - Create a new and associate it with this connection. - - Returns a new command object already assigned to this connection. - - - - Forwards to the local function. - - - - - - Parses the connection string into component parts using the custom - connection string parser. - - The connection string to parse - An array of key-value pairs representing each parameter of the connection string - - - - Parses a connection string using the built-in (i.e. framework provided) - connection string parser class and returns the key/value pairs. An - exception may be thrown if the connection string is invalid or cannot be - parsed. When compiled for the .NET Compact Framework, the custom - connection string parser is always used instead because the framework - provided one is unavailable there. - - - The connection string to parse. - - - Non-zero to throw an exception if any connection string values are not of - the type. - - The list of key/value pairs. - - - - Manual distributed transaction enlistment support - - The distributed transaction to enlist in - - - - Looks for a key in the array of key/values of the parameter string. If not found, return the specified default value - - The list to look in - The key to find - The default value to return if the key is not found - The value corresponding to the specified key, or the default value if not found. - - - - Attempts to convert the string value to an enumerated value of the specified type. - - The enumerated type to convert the string value to. - The string value to be converted. - Non-zero to make the conversion case-insensitive. - The enumerated value upon success or null upon error. - - - - Attempts to convert an input string into a byte value. - - - The string value to be converted. - - - The number styles to use for the conversion. - - - Upon sucess, this will contain the parsed byte value. - Upon failure, the value of this parameter is undefined. - - - Non-zero upon success; zero on failure. - - - - - Enables or disabled extension loading. - - - True to enable loading of extensions, false to disable. - - - - - Loads a SQLite extension library from the named dynamic link library file. - - - The name of the dynamic link library file containing the extension. - - - - - Loads a SQLite extension library from the named dynamic link library file. - - - The name of the dynamic link library file containing the extension. - - - The name of the exported function used to initialize the extension. - If null, the default "sqlite3_extension_init" will be used. - - - - - Creates a disposable module containing the implementation of a virtual - table. - - - The module object to be used when creating the disposable module. - - - - - Parses a string containing a sequence of zero or more hexadecimal - encoded byte values and returns the resulting byte array. The - "0x" prefix is not allowed on the input string. - - - The input string containing zero or more hexadecimal encoded byte - values. - - - A byte array containing the parsed byte values or null if an error - was encountered. - - - - - Creates and returns a string containing the hexadecimal encoded byte - values from the input array. - - - The input array of bytes. - - - The resulting string or null upon failure. - - - - - Parses a string containing a sequence of zero or more hexadecimal - encoded byte values and returns the resulting byte array. The - "0x" prefix is not allowed on the input string. - - - The input string containing zero or more hexadecimal encoded byte - values. - - - Upon failure, this will contain an appropriate error message. - - - A byte array containing the parsed byte values or null if an error - was encountered. - - - - - This method figures out what the default connection pool setting should - be based on the connection flags. When present, the "Pooling" connection - string property value always overrides the value returned by this method. - - - Non-zero if the connection pool should be enabled by default; otherwise, - zero. - - - - - Opens the connection using the parameters found in the . - - - - - Opens the connection using the parameters found in the and then returns it. - - The current connection object. - - - - This method causes any pending database operation to abort and return at - its earliest opportunity. This routine is typically called in response - to a user action such as pressing "Cancel" or Ctrl-C where the user wants - a long query operation to halt immediately. It is safe to call this - routine from any thread. However, it is not safe to call this routine - with a database connection that is closed or might close before this method - returns. - - - - - Returns various global memory statistics for the SQLite core library via - a dictionary of key/value pairs. Currently, only the "MemoryUsed" and - "MemoryHighwater" keys are returned and they have values that correspond - to the values that could be obtained via the - and connection properties. - - - This dictionary will be populated with the global memory statistics. It - will be created if necessary. - - - - - Attempts to free as much heap memory as possible for this database connection. - - - - - Attempts to free N bytes of heap memory by deallocating non-essential memory - allocations held by the database library. Memory used to cache database pages - to improve performance is an example of non-essential memory. This is a no-op - returning zero if the SQLite core library was not compiled with the compile-time - option SQLITE_ENABLE_MEMORY_MANAGEMENT. Optionally, attempts to reset and/or - compact the Win32 native heap, if applicable. - - - The requested number of bytes to free. - - - Non-zero to attempt a heap reset. - - - Non-zero to attempt heap compaction. - - - The number of bytes actually freed. This value may be zero. - - - This value will be non-zero if the heap reset was successful. - - - The size of the largest committed free block in the heap, in bytes. - This value will be zero unless heap compaction is enabled. - - - A standard SQLite return code (i.e. zero for success and non-zero - for failure). - - - - - Sets the status of the memory usage tracking subsystem in the SQLite core library. By default, this is enabled. - If this is disabled, memory usage tracking will not be performed. This is not really a per-connection value, it is - global to the process. - - Non-zero to enable memory usage tracking, zero otherwise. - A standard SQLite return code (i.e. zero for success and non-zero for failure). - - - - Passes a shutdown request to the SQLite core library. Does not throw - an exception if the shutdown request fails. - - - A standard SQLite return code (i.e. zero for success and non-zero for - failure). - - - - - Passes a shutdown request to the SQLite core library. Throws an - exception if the shutdown request fails and the no-throw parameter - is non-zero. - - - Non-zero to reset the database and temporary directories to their - default values, which should be null for both. - - - When non-zero, throw an exception if the shutdown request fails. - - - - Enables or disabled extended result codes returned by SQLite - - - Enables or disabled extended result codes returned by SQLite - - - Enables or disabled extended result codes returned by SQLite - - - Add a log message via the SQLite sqlite3_log interface. - - - Add a log message via the SQLite sqlite3_log interface. - - - - Change the password (or assign a password) to an open database. - - - No readers or writers may be active for this process. The database must already be open - and if it already was password protected, the existing password must already have been supplied. - - The new password to assign to the database - - - - Change the password (or assign a password) to an open database. - - - No readers or writers may be active for this process. The database must already be open - and if it already was password protected, the existing password must already have been supplied. - - The new password to assign to the database - - - - Sets the password for a password-protected database. A password-protected database is - unusable for any operation until the password has been set. - - The password for the database - - - - Sets the password for a password-protected database. A password-protected database is - unusable for any operation until the password has been set. - - The password for the database - - - - Queries or modifies the number of retries or the retry interval (in milliseconds) for - certain I/O operations that may fail due to anti-virus software. - - The number of times to retry the I/O operation. A negative value - will cause the current count to be queried and replace that negative value. - The number of milliseconds to wait before retrying the I/O - operation. This number is multiplied by the number of retry attempts so far to come - up with the final number of milliseconds to wait. A negative value will cause the - current interval to be queried and replace that negative value. - Zero for success, non-zero for error. - - - - Removes one set of surrounding single -OR- double quotes from the string - value and returns the resulting string value. If the string is null, empty, - or contains quotes that are not balanced, nothing is done and the original - string value will be returned. - - The string value to process. - - The string value, modified to remove one set of surrounding single -OR- - double quotes, if applicable. - - - - - Expand the filename of the data source, resolving the |DataDirectory| - macro as appropriate. - - The database filename to expand - - Non-zero if the returned file name should be converted to a full path - (except when using the .NET Compact Framework). - - The expanded path and filename of the filename - - - - The following commands are used to extract schema information out of the database. Valid schema types are: - - - MetaDataCollections - - - DataSourceInformation - - - Catalogs - - - Columns - - - ForeignKeys - - - Indexes - - - IndexColumns - - - Tables - - - Views - - - ViewColumns - - - - - Returns the MetaDataCollections schema - - A DataTable of the MetaDataCollections schema - - - - Returns schema information of the specified collection - - The schema collection to retrieve - A DataTable of the specified collection - - - - Retrieves schema information using the specified constraint(s) for the specified collection - - The collection to retrieve - The restrictions to impose - A DataTable of the specified collection - - - - Builds a MetaDataCollections schema datatable - - DataTable - - - - Builds a DataSourceInformation datatable - - DataTable - - - - Build a Columns schema - - The catalog (attached database) to query, can be null - The table to retrieve schema information for, must not be null - The column to retrieve schema information for, can be null - DataTable - - - - Returns index information for the given database and catalog - - The catalog (attached database) to query, can be null - The name of the index to retrieve information for, can be null - The table to retrieve index information for, can be null - DataTable - - - - Retrieves table schema information for the database and catalog - - The catalog (attached database) to retrieve tables on - The table to retrieve, can be null - The table type, can be null - DataTable - - - - Retrieves view schema information for the database - - The catalog (attached database) to retrieve views on - The view name, can be null - DataTable - - - - Retrieves catalog (attached databases) schema information for the database - - The catalog to retrieve, can be null - DataTable - - - - Returns the base column information for indexes in a database - - The catalog to retrieve indexes for (can be null) - The table to restrict index information by (can be null) - The index to restrict index information by (can be null) - The source column to restrict index information by (can be null) - A DataTable containing the results - - - - Returns detailed column information for a specified view - - The catalog to retrieve columns for (can be null) - The view to restrict column information by (can be null) - The source column to restrict column information by (can be null) - A DataTable containing the results - - - - Retrieves foreign key information from the specified set of filters - - An optional catalog to restrict results on - An optional table to restrict results on - An optional foreign key name to restrict results on - A DataTable with the results of the query - - - - Static variable to store the connection event handlers to call. - - - - - This event is raised whenever the database is opened or closed. - - - - - This event is raised when events related to the lifecycle of a - SQLiteConnection object occur. - - - - - This property is used to obtain or set the custom connection pool - implementation to use, if any. Setting this property to null will - cause the default connection pool implementation to be used. - - - - - Returns the number of pool entries for the file name associated with this connection. - - - - - The connection string containing the parameters for the connection - - - - - Parameter - Values - Required - Default - - - Data Source - - This may be a file name, the string ":memory:", or any supported URI (starting with SQLite 3.7.7). - Starting with release 1.0.86.0, in order to use more than one consecutive backslash (e.g. for a - UNC path), each of the adjoining backslash characters must be doubled (e.g. "\\Network\Share\test.db" - would become "\\\\Network\Share\test.db"). - - Y - - - - Version - 3 - N - 3 - - - UseUTF16Encoding - True
False
- N - False -
- - DateTimeFormat - - Ticks - Use the value of DateTime.Ticks.
- ISO8601 - Use the ISO-8601 format. Uses the "yyyy-MM-dd HH:mm:ss.FFFFFFFK" format for UTC - DateTime values and "yyyy-MM-dd HH:mm:ss.FFFFFFF" format for local DateTime values).
- JulianDay - The interval of time in days and fractions of a day since January 1, 4713 BC.
- UnixEpoch - The whole number of seconds since the Unix epoch (January 1, 1970).
- InvariantCulture - Any culture-independent string value that the .NET Framework can interpret as a valid DateTime.
- CurrentCulture - Any string value that the .NET Framework can interpret as a valid DateTime using the current culture.
- N - ISO8601 -
- - DateTimeKind - Unspecified - Not specified as either UTC or local time.
Utc - The time represented is UTC.
Local - The time represented is local time.
- N - Unspecified -
- - DateTimeFormatString - The exact DateTime format string to use for all formatting and parsing of all DateTime - values for this connection. - N - null - - - BaseSchemaName - Some base data classes in the framework (e.g. those that build SQL queries dynamically) - assume that an ADO.NET provider cannot support an alternate catalog (i.e. database) without supporting - alternate schemas as well; however, SQLite does not fit into this model. Therefore, this value is used - as a placeholder and removed prior to preparing any SQL statements that may contain it. - N - sqlite_default_schema - - - BinaryGUID - True - Store GUID columns in binary form
False - Store GUID columns as text
- N - True -
- - Cache Size - {size in bytes} - N - 2000 - - - Synchronous - Normal - Normal file flushing behavior
Full - Full flushing after all writes
Off - Underlying OS flushes I/O's
- N - Full -
- - Page Size - {size in bytes} - N - 1024 - - - Password - {password} - Using this parameter requires that the CryptoAPI based codec be enabled at compile-time for both the native interop assembly and the core managed assemblies; otherwise, using this parameter may result in an exception being thrown when attempting to open the connection. - N - - - - HexPassword - {hexPassword} - Must contain a sequence of zero or more hexadecimal encoded byte values without a leading "0x" prefix. Using this parameter requires that the CryptoAPI based codec be enabled at compile-time for both the native interop assembly and the core managed assemblies; otherwise, using this parameter may result in an exception being thrown when attempting to open the connection. - N - - - - Enlist - Y - Automatically enlist in distributed transactions
N - No automatic enlistment
- N - Y -
- - Pooling - - True - Use connection pooling.
- False - Do not use connection pooling.

- WARNING: When using the default connection pool implementation, - setting this property to True should be avoided by applications that - make use of COM (either directly or indirectly) due to possible - deadlocks that can occur during the finalization of some COM objects. -
- N - False -
- - FailIfMissing - True - Don't create the database if it does not exist, throw an error instead
False - Automatically create the database if it does not exist
- N - False -
- - Max Page Count - {size in pages} - Limits the maximum number of pages (limits the size) of the database - N - 0 - - - Legacy Format - True - Use the more compatible legacy 3.x database format
False - Use the newer 3.3x database format which compresses numbers more effectively
- N - False -
- - Default Timeout - {time in seconds}
The default command timeout
- N - 30 -
- - Journal Mode - Delete - Delete the journal file after a commit
Persist - Zero out and leave the journal file on disk after a commit
Off - Disable the rollback journal entirely
- N - Delete -
- - Read Only - True - Open the database for read only access
False - Open the database for normal read/write access
- N - False -
- - Max Pool Size - The maximum number of connections for the given connection string that can be in the connection pool - N - 100 - - - Default IsolationLevel - The default transaciton isolation level - N - Serializable - - - Foreign Keys - Enable foreign key constraints - N - False - - - Flags - Extra behavioral flags for the connection. See the enumeration for possible values. - N - Default - - - SetDefaults - - True - Apply the default connection settings to the opened database.
- False - Skip applying the default connection settings to the opened database. -
- N - True -
- - ToFullPath - - True - Attempt to expand the data source file name to a fully qualified path before opening.
- False - Skip attempting to expand the data source file name to a fully qualified path before opening. -
- N - True -
-
-
-
- - - Returns the data source file name without extension or path. - - - - - Returns the string "main". - - - - - Gets/sets the default command timeout for newly-created commands. This is especially useful for - commands used internally such as inside a SQLiteTransaction, where setting the timeout is not possible. - This can also be set in the ConnectionString with "Default Timeout" - - - - - Non-zero if the built-in (i.e. framework provided) connection string - parser should be used when opening the connection. - - - - - Gets/sets the extra behavioral flags for this connection. See the - enumeration for a list of - possible values. - - - - - Returns non-zero if the underlying native connection handle is - owned by this instance. - - - - - Returns the version of the underlying SQLite database engine - - - - - Returns the rowid of the most recent successful INSERT into the database from this connection. - - - - - Returns the number of rows changed by the last INSERT, UPDATE, or DELETE statement executed on - this connection. - - - - - Returns non-zero if the given database connection is in autocommit mode. - Autocommit mode is on by default. Autocommit mode is disabled by a BEGIN - statement. Autocommit mode is re-enabled by a COMMIT or ROLLBACK. - - - - - Returns the amount of memory (in bytes) currently in use by the SQLite core library. - - - - - Returns the maximum amount of memory (in bytes) used by the SQLite core library since the high-water mark was last reset. - - - - - Returns a string containing the define constants (i.e. compile-time - options) used to compile the core managed assembly, delimited with - spaces. - - - - - Returns the version of the underlying SQLite core library. - - - - - This method returns the string whose value is the same as the - SQLITE_SOURCE_ID C preprocessor macro used when compiling the - SQLite core library. - - - - - Returns a string containing the compile-time options used to - compile the SQLite core native library, delimited with spaces. - - - - - This method returns the version of the interop SQLite assembly - used. If the SQLite interop assembly is not in use or the - necessary information cannot be obtained for any reason, a null - value may be returned. - - - - - This method returns the string whose value contains the unique - identifier for the source checkout used to build the interop - assembly. If the SQLite interop assembly is not in use or the - necessary information cannot be obtained for any reason, a null - value may be returned. - - - - - Returns a string containing the compile-time options used to - compile the SQLite interop assembly, delimited with spaces. - - - - - This method returns the version of the managed components used - to interact with the SQLite core library. If the necessary - information cannot be obtained for any reason, a null value may - be returned. - - - - - This method returns the string whose value contains the unique - identifier for the source checkout used to build the managed - components currently executing. If the necessary information - cannot be obtained for any reason, a null value may be returned. - - - - - Returns the state of the connection. - - - - - This event is raised whenever SQLite encounters an action covered by the - authorizer during query preparation. Changing the value of the - property will determine if - the specific action will be allowed, ignored, or denied. For the entire - duration of the event, the associated connection and statement objects - must not be modified, either directly or indirectly, by the called code. - - - - - This event is raised whenever SQLite makes an update/delete/insert into the database on - this connection. It only applies to the given connection. - - - - - This event is raised whenever SQLite is committing a transaction. - Return non-zero to trigger a rollback. - - - - - This event is raised whenever SQLite statement first begins executing on - this connection. It only applies to the given connection. - - - - - This event is raised whenever SQLite is rolling back a transaction. - - - - - Returns the instance. - - - - - The I/O file cache flushing behavior for the connection - - - - - Normal file flushing at critical sections of the code - - - - - Full file flushing after every write operation - - - - - Use the default operating system's file flushing, SQLite does not explicitly flush the file buffers after writing - - - - - Raised when authorization is required to perform an action contained - within a SQL query. - - The connection performing the action. - A that contains the - event data. - - - - Raised when a transaction is about to be committed. To roll back a transaction, set the - rollbackTrans boolean value to true. - - The connection committing the transaction - Event arguments on the transaction - - - - Raised when data is inserted, updated and deleted on a given connection - - The connection committing the transaction - The event parameters which triggered the event - - - - Raised when a statement first begins executing on a given connection - - The connection executing the statement - Event arguments of the trace - - - - Raised between each backup step. - - - The source database connection. - - - The source database name. - - - The destination database connection. - - - The destination database name. - - - The number of pages copied with each step. - - - The number of pages remaining to be copied. - - - The total number of pages in the source database. - - - Set to true if the operation needs to be retried due to database - locking issues; otherwise, set to false. - - - True to continue with the backup process or false to halt the backup - process, rolling back any changes that have been made so far. - - - - - The data associated with a call into the authorizer. - - - - - The user-defined native data associated with this event. Currently, - this will always contain the value of . - - - - - The action code responsible for the current call into the authorizer. - - - - - The first string argument for the current call into the authorizer. - The exact value will vary based on the action code, see the - enumeration for possible - values. - - - - - The second string argument for the current call into the authorizer. - The exact value will vary based on the action code, see the - enumeration for possible - values. - - - - - The database name for the current call into the authorizer, if - applicable. - - - - - The name of the inner-most trigger or view that is responsible for - the access attempt or a null value if this access attempt is directly - from top-level SQL code. - - - - - The return code for the current call into the authorizer. - - - - - Constructs an instance of this class with default property values. - - - - - Constructs an instance of this class with specific property values. - - - The user-defined native data associated with this event. - - - The authorizer action code. - - - The first authorizer argument. - - - The second authorizer argument. - - - The database name, if applicable. - - - The name of the inner-most trigger or view that is responsible for - the access attempt or a null value if this access attempt is directly - from top-level SQL code. - - - The authorizer return code. - - - - - Whenever an update event is triggered on a connection, this enum will indicate - exactly what type of operation is being performed. - - - - - A row is being deleted from the given database and table - - - - - A row is being inserted into the table. - - - - - A row is being updated in the table. - - - - - Passed during an Update callback, these event arguments detail the type of update operation being performed - on the given connection. - - - - - The name of the database being updated (usually "main" but can be any attached or temporary database) - - - - - The name of the table being updated - - - - - The type of update being performed (insert/update/delete) - - - - - The RowId affected by this update. - - - - - Event arguments raised when a transaction is being committed - - - - - Set to true to abort the transaction and trigger a rollback - - - - - Passed during an Trace callback, these event arguments contain the UTF-8 rendering of the SQL statement text - - - - - SQL statement text as the statement first begins executing - - - - - This interface represents a custom connection pool implementation - usable by System.Data.SQLite. - - - - - Counts the number of pool entries matching the specified file name. - - - The file name to match or null to match all files. - - - The pool entry counts for each matching file. - - - The total number of connections successfully opened from any pool. - - - The total number of connections successfully closed from any pool. - - - The total number of pool entries for all matching files. - - - - - Disposes of all pooled connections associated with the specified - database file name. - - - The database file name. - - - - - Disposes of all pooled connections. - - - - - Adds a connection to the pool of those associated with the - specified database file name. - - - The database file name. - - - The database connection handle. - - - The connection pool version at the point the database connection - handle was received from the connection pool. This is also the - connection pool version that the database connection handle was - created under. - - - - - Removes a connection from the pool of those associated with the - specified database file name with the intent of using it to - interact with the database. - - - The database file name. - - - The new maximum size of the connection pool for the specified - database file name. - - - The connection pool version associated with the returned database - connection handle, if any. - - - The database connection handle associated with the specified - database file name or null if it cannot be obtained. - - - - - This default method implementations in this class should not be used by - applications that make use of COM (either directly or indirectly) due - to possible deadlocks that can occur during finalization of some COM - objects. - - - - - This field is used to synchronize access to the private static data - in this class. - - - - - When this field is non-null, it will be used to provide the - implementation of all the connection pool methods; otherwise, - the default method implementations will be used. - - - - - The dictionary of connection pools, based on the normalized file - name of the SQLite database. - - - - - The default version number new pools will get. - - - - - The number of connections successfully opened from any pool. - This value is incremented by the Remove method. - - - - - The number of connections successfully closed from any pool. - This value is incremented by the Add method. - - - - - Counts the number of pool entries matching the specified file name. - - - The file name to match or null to match all files. - - - The pool entry counts for each matching file. - - - The total number of connections successfully opened from any pool. - - - The total number of connections successfully closed from any pool. - - - The total number of pool entries for all matching files. - - - - - Disposes of all pooled connections associated with the specified - database file name. - - - The database file name. - - - - - Disposes of all pooled connections. - - - - - Adds a connection to the pool of those associated with the - specified database file name. - - - The database file name. - - - The database connection handle. - - - The connection pool version at the point the database connection - handle was received from the connection pool. This is also the - connection pool version that the database connection handle was - created under. - - - - - Removes a connection from the pool of those associated with the - specified database file name with the intent of using it to - interact with the database. - - - The database file name. - - - The new maximum size of the connection pool for the specified - database file name. - - - The connection pool version associated with the returned database - connection handle, if any. - - - The database connection handle associated with the specified - database file name or null if it cannot be obtained. - - - - - This method is used to obtain a reference to the custom connection - pool implementation currently in use, if any. - - - The custom connection pool implementation or null if the default - connection pool implementation should be used. - - - - - This method is used to set the reference to the custom connection - pool implementation to use, if any. - - - The custom connection pool implementation to use or null if the - default connection pool implementation should be used. - - - - - We do not have to thread-lock anything in this function, because it - is only called by other functions above which already take the lock. - - - The pool queue to resize. - - - If a function intends to add to the pool, this is true, which - forces the resize to take one more than it needs from the pool. - - - - - Keeps track of connections made on a specified file. The PoolVersion - dictates whether old objects get returned to the pool or discarded - when no longer in use. - - - - - The queue of weak references to the actual database connection - handles. - - - - - This pool version associated with the database connection - handles in this pool queue. - - - - - The maximum size of this pool queue. - - - - - Constructs a connection pool queue using the specified version - and maximum size. Normally, all the database connection - handles in this pool are associated with a single database file - name. - - - The initial pool version for this connection pool queue. - - - The initial maximum size for this connection pool queue. - - - - - SQLite implementation of DbConnectionStringBuilder. - - - - - Properties of this class - - - - - Constructs a new instance of the class - - - Default constructor - - - - - Constructs a new instance of the class using the specified connection string. - - The connection string to parse - - - - Private initializer, which assigns the connection string and resets the builder - - The connection string to assign - - - - Helper function for retrieving values from the connectionstring - - The keyword to retrieve settings for - The resulting parameter value - Returns true if the value was found and returned - - - - Fallback method for MONO, which doesn't implement DbConnectionStringBuilder.GetProperties() - - The hashtable to fill with property descriptors - - - - Gets/Sets the default version of the SQLite engine to instantiate. Currently the only valid value is 3, indicating version 3 of the sqlite library. - - - - - Gets/Sets the synchronization mode (file flushing) of the connection string. Default is "Normal". - - - - - Gets/Sets the encoding for the connection string. The default is "False" which indicates UTF-8 encoding. - - - - - Gets/Sets whether or not to use connection pooling. The default is "False" - - - - - Gets/Sets whethor not to store GUID's in binary format. The default is True - which saves space in the database. - - - - - Gets/Sets the filename to open on the connection string. - - - - - An alternate to the data source property - - - - - An alternate to the data source property that uses the SQLite URI syntax. - - - - - Gets/sets the default command timeout for newly-created commands. This is especially useful for - commands used internally such as inside a SQLiteTransaction, where setting the timeout is not possible. - - - - - Determines whether or not the connection will automatically participate - in the current distributed transaction (if one exists) - - - - - If set to true, will throw an exception if the database specified in the connection - string does not exist. If false, the database will be created automatically. - - - - - If enabled, uses the legacy 3.xx format for maximum compatibility, but results in larger - database sizes. - - - - - When enabled, the database will be opened for read-only access and writing will be disabled. - - - - - Gets/sets the database encryption password - - - - - Gets/sets the database encryption hexadecimal password - - - - - Gets/Sets the page size for the connection. - - - - - Gets/Sets the maximum number of pages the database may hold - - - - - Gets/Sets the cache size for the connection. - - - - - Gets/Sets the DateTime format for the connection. - - - - - Gets/Sets the DateTime kind for the connection. - - - - - Gets/sets the DateTime format string used for formatting - and parsing purposes. - - - - - Gets/Sets the placeholder base schema name used for - .NET Framework compatibility purposes. - - - - - Determines how SQLite handles the transaction journal file. - - - - - Sets the default isolation level for transactions on the connection. - - - - - If enabled, use foreign key constraints - - - - - Gets/Sets the extra behavioral flags. - - - - - If enabled, apply the default connection settings to opened databases. - - - - - If enabled, attempt to resolve the provided data source file name to a - full path before opening. - - - - - SQLite has very limited types, and is inherently text-based. The first 5 types below represent the sum of all types SQLite - understands. The DateTime extension to the spec is for internal use only. - - - - - Not used - - - - - All integers in SQLite default to Int64 - - - - - All floating point numbers in SQLite default to double - - - - - The default data type of SQLite is text - - - - - Typically blob types are only seen when returned from a function - - - - - Null types can be returned from functions - - - - - Used internally by this provider - - - - - Used internally by this provider - - - - - These are the event types associated with the - - delegate (and its corresponding event) and the - class. - - - - - Not used. - - - - - Not used. - - - - - The connection is being opened. - - - - - The connection string has been parsed. - - - - - The connection was opened. - - - - - The method was called on the - connection. - - - - - A transaction was created using the connection. - - - - - The connection was enlisted into a transaction. - - - - - A command was created using the connection. - - - - - A data reader was created using the connection. - - - - - An instance of a derived class has - been created to wrap a native resource. - - - - - The connection is being closed. - - - - - The connection was closed. - - - - - This implementation of SQLite for ADO.NET can process date/time fields in - databases in one of six formats. - - - ISO8601 format is more compatible, readable, fully-processable, but less - accurate as it does not provide time down to fractions of a second. - JulianDay is the numeric format the SQLite uses internally and is arguably - the most compatible with 3rd party tools. It is not readable as text - without post-processing. Ticks less compatible with 3rd party tools that - query the database, and renders the DateTime field unreadable as text - without post-processing. UnixEpoch is more compatible with Unix systems. - InvariantCulture allows the configured format for the invariant culture - format to be used and is human readable. CurrentCulture allows the - configured format for the current culture to be used and is also human - readable. - - The preferred order of choosing a DateTime format is JulianDay, ISO8601, - and then Ticks. Ticks is mainly present for legacy code support. - - - - - Use the value of DateTime.Ticks. This value is not recommended and is not well supported with LINQ. - - - - - Use the ISO-8601 format. Uses the "yyyy-MM-dd HH:mm:ss.FFFFFFFK" format for UTC DateTime values and - "yyyy-MM-dd HH:mm:ss.FFFFFFF" format for local DateTime values). - - - - - The interval of time in days and fractions of a day since January 1, 4713 BC. - - - - - The whole number of seconds since the Unix epoch (January 1, 1970). - - - - - Any culture-independent string value that the .NET Framework can interpret as a valid DateTime. - - - - - Any string value that the .NET Framework can interpret as a valid DateTime using the current culture. - - - - - The default format for this provider. - - - - - This enum determines how SQLite treats its journal file. - - - By default SQLite will create and delete the journal file when needed during a transaction. - However, for some computers running certain filesystem monitoring tools, the rapid - creation and deletion of the journal file can cause those programs to fail, or to interfere with SQLite. - - If a program or virus scanner is interfering with SQLite's journal file, you may receive errors like "unable to open database file" - when starting a transaction. If this is happening, you may want to change the default journal mode to Persist. - - - - - The default mode, this causes SQLite to use the existing journaling mode for the database. - - - - - SQLite will create and destroy the journal file as-needed. - - - - - When this is set, SQLite will keep the journal file even after a transaction has completed. It's contents will be erased, - and the journal re-used as often as needed. If it is deleted, it will be recreated the next time it is needed. - - - - - This option disables the rollback journal entirely. Interrupted transactions or a program crash can cause database - corruption in this mode! - - - - - SQLite will truncate the journal file to zero-length instead of deleting it. - - - - - SQLite will store the journal in volatile RAM. This saves disk I/O but at the expense of database safety and integrity. - If the application using SQLite crashes in the middle of a transaction when the MEMORY journaling mode is set, then the - database file will very likely go corrupt. - - - - - SQLite uses a write-ahead log instead of a rollback journal to implement transactions. The WAL journaling mode is persistent; - after being set it stays in effect across multiple database connections and after closing and reopening the database. A database - in WAL journaling mode can only be accessed by SQLite version 3.7.0 or later. - - - - - Possible values for the "synchronous" database setting. This setting determines - how often the database engine calls the xSync method of the VFS. - - - - - Use the default "synchronous" database setting. Currently, this should be - the same as using the FULL mode. - - - - - The database engine continues without syncing as soon as it has handed - data off to the operating system. If the application running SQLite - crashes, the data will be safe, but the database might become corrupted - if the operating system crashes or the computer loses power before that - data has been written to the disk surface. - - - - - The database engine will still sync at the most critical moments, but - less often than in FULL mode. There is a very small (though non-zero) - chance that a power failure at just the wrong time could corrupt the - database in NORMAL mode. - - - - - The database engine will use the xSync method of the VFS to ensure that - all content is safely written to the disk surface prior to continuing. - This ensures that an operating system crash or power failure will not - corrupt the database. FULL synchronous is very safe, but it is also - slower. - - - - - The requested command execution type. This controls which method of the - object will be called. - - - - - Do nothing. No method will be called. - - - - - The command is not expected to return a result -OR- the result is not - needed. The or - method - will be called. - - - - - The command is expected to return a scalar result -OR- the result should - be limited to a scalar result. The - or method will - be called. - - - - - The command is expected to return result. - The or - method will - be called. - - - - - Use the default command execution type. Using this value is the same - as using the value. - - - - - The action code responsible for the current call into the authorizer. - - - - - No action is being performed. This value should not be used from - external code. - - - - - No longer used. - - - - - An index will be created. The action-specific arguments are the - index name and the table name. - - - - - - A table will be created. The action-specific arguments are the - table name and a null value. - - - - - A temporary index will be created. The action-specific arguments - are the index name and the table name. - - - - - A temporary table will be created. The action-specific arguments - are the table name and a null value. - - - - - A temporary trigger will be created. The action-specific arguments - are the trigger name and the table name. - - - - - A temporary view will be created. The action-specific arguments are - the view name and a null value. - - - - - A trigger will be created. The action-specific arguments are the - trigger name and the table name. - - - - - A view will be created. The action-specific arguments are the view - name and a null value. - - - - - A DELETE statement will be executed. The action-specific arguments - are the table name and a null value. - - - - - An index will be dropped. The action-specific arguments are the - index name and the table name. - - - - - A table will be dropped. The action-specific arguments are the tables - name and a null value. - - - - - A temporary index will be dropped. The action-specific arguments are - the index name and the table name. - - - - - A temporary table will be dropped. The action-specific arguments are - the table name and a null value. - - - - - A temporary trigger will be dropped. The action-specific arguments - are the trigger name and the table name. - - - - - A temporary view will be dropped. The action-specific arguments are - the view name and a null value. - - - - - A trigger will be dropped. The action-specific arguments are the - trigger name and the table name. - - - - - A view will be dropped. The action-specific arguments are the view - name and a null value. - - - - - An INSERT statement will be executed. The action-specific arguments - are the table name and a null value. - - - - - A PRAGMA statement will be executed. The action-specific arguments - are the name of the PRAGMA and the new value or a null value. - - - - - A table column will be read. The action-specific arguments are the - table name and the column name. - - - - - A SELECT statement will be executed. The action-specific arguments - are both null values. - - - - - A transaction will be started, committed, or rolled back. The - action-specific arguments are the name of the operation (BEGIN, - COMMIT, or ROLLBACK) and a null value. - - - - - An UPDATE statement will be executed. The action-specific arguments - are the table name and the column name. - - - - - A database will be attached to the connection. The action-specific - arguments are the database file name and a null value. - - - - - A database will be detached from the connection. The action-specific - arguments are the database name and a null value. - - - - - The schema of a table will be altered. The action-specific arguments - are the database name and the table name. - - - - - An index will be deleted and then recreated. The action-specific - arguments are the index name and a null value. - - - - - A table will be analyzed to gathers statistics about it. The - action-specific arguments are the table name and a null value. - - - - - A virtual table will be created. The action-specific arguments are - the table name and the module name. - - - - - A virtual table will be dropped. The action-specific arguments are - the table name and the module name. - - - - - A SQL function will be called. The action-specific arguments are a - null value and the function name. - - - - - A savepoint will be created, released, or rolled back. The - action-specific arguments are the name of the operation (BEGIN, - RELEASE, or ROLLBACK) and the savepoint name. - - - - - A recursive query will be executed. The action-specific arguments - are two null values. - - - - - The return code for the current call into the authorizer. - - - - - The action will be allowed. - - - - - The overall action will be disallowed and an error message will be - returned from the query preparation method. - - - - - The specific action will be disallowed; however, the overall action - will continue. The exact effects of this return code vary depending - on the specific action, please refer to the SQLite core library - documentation for futher details. - - - - - Class used internally to determine the datatype of a column in a resultset - - - - - The DbType of the column, or DbType.Object if it cannot be determined - - - - - The affinity of a column, used for expressions or when Type is DbType.Object - - - - - SQLite implementation of DbDataAdapter. - - - - - This class is just a shell around the DbDataAdapter. Nothing from - DbDataAdapter is overridden here, just a few constructors are defined. - - - Default constructor. - - - - - Constructs a data adapter using the specified select command. - - - The select command to associate with the adapter. - - - - - Constructs a data adapter with the supplied select command text and - associated with the specified connection. - - - The select command text to associate with the data adapter. - - - The connection to associate with the select command. - - - - - Constructs a data adapter with the specified select command text, - and using the specified database connection string. - - - The select command text to use to construct a select command. - - - A connection string suitable for passing to a new SQLiteConnection, - which is associated with the select command. - - - - - Constructs a data adapter with the specified select command text, - and using the specified database connection string. - - - The select command text to use to construct a select command. - - - A connection string suitable for passing to a new SQLiteConnection, - which is associated with the select command. - - - Non-zero to parse the connection string using the built-in (i.e. - framework provided) parser when opening the connection. - - - - - Raised by the underlying DbDataAdapter when a row is being updated - - The event's specifics - - - - Raised by DbDataAdapter after a row is updated - - The event's specifics - - - - Row updating event handler - - - - - Row updated event handler - - - - - Gets/sets the select command for this DataAdapter - - - - - Gets/sets the insert command for this DataAdapter - - - - - Gets/sets the update command for this DataAdapter - - - - - Gets/sets the delete command for this DataAdapter - - - - - SQLite implementation of DbDataReader. - - - - - Underlying command this reader is attached to - - - - - Index of the current statement in the command being processed - - - - - Current statement being Read() - - - - - State of the current statement being processed. - -1 = First Step() executed, so the first Read() will be ignored - 0 = Actively reading - 1 = Finished reading - 2 = Non-row-returning statement, no records - - - - - Number of records affected by the insert/update statements executed on the command - - - - - Count of fields (columns) in the row-returning statement currently being processed - - - - - Maps the field (column) names to their corresponding indexes within the results. - - - - - Datatypes of active fields (columns) in the current statement, used for type-restricting data - - - - - The behavior of the datareader - - - - - If set, then dispose of the command object when the reader is finished - - - - - If set, then raise an exception when the object is accessed after being disposed. - - - - - An array of rowid's for the active statement if CommandBehavior.KeyInfo is specified - - - - - Matches the version of the connection. - - - - - The "stub" (i.e. placeholder) base schema name to use when returning - column schema information. Matches the base schema name used by the - associated connection. - - - - - Internal constructor, initializes the datareader and sets up to begin executing statements - - The SQLiteCommand this data reader is for - The expected behavior of the data reader - - - - Dispose of all resources used by this datareader. - - - - - - Closes the datareader, potentially closing the connection as well if CommandBehavior.CloseConnection was specified. - - - - - Throw an error if the datareader is closed - - - - - Throw an error if a row is not loaded - - - - - Enumerator support - - Returns a DbEnumerator object. - - - - SQLite is inherently un-typed. All datatypes in SQLite are natively strings. The definition of the columns of a table - and the affinity of returned types are all we have to go on to type-restrict data in the reader. - - This function attempts to verify that the type of data being requested of a column matches the datatype of the column. In - the case of columns that are not backed into a table definition, we attempt to match up the affinity of a column (int, double, string or blob) - to a set of known types that closely match that affinity. It's not an exact science, but its the best we can do. - - - This function throws an InvalidTypeCast() exception if the requested type doesn't match the column's definition or affinity. - - The index of the column to type-check - The type we want to get out of the column - - - - Retrieves the column as a boolean value - - The index of the column to retrieve - bool - - - - Retrieves the column as a single byte value - - The index of the column to retrieve - byte - - - - Retrieves a column as an array of bytes (blob) - - The index of the column to retrieve - The zero-based index of where to begin reading the data - The buffer to write the bytes into - The zero-based index of where to begin writing into the array - The number of bytes to retrieve - The actual number of bytes written into the array - - To determine the number of bytes in the column, pass a null value for the buffer. The total length will be returned. - - - - - Returns the column as a single character - - The index of the column to retrieve - char - - - - Retrieves a column as an array of chars (blob) - - The index of the column to retrieve - The zero-based index of where to begin reading the data - The buffer to write the characters into - The zero-based index of where to begin writing into the array - The number of bytes to retrieve - The actual number of characters written into the array - - To determine the number of characters in the column, pass a null value for the buffer. The total length will be returned. - - - - - Retrieves the name of the back-end datatype of the column - - The index of the column to retrieve - string - - - - Retrieve the column as a date/time value - - The index of the column to retrieve - DateTime - - - - Retrieve the column as a decimal value - - The index of the column to retrieve - decimal - - - - Returns the column as a double - - The index of the column to retrieve - double - - - - Returns the .NET type of a given column - - The index of the column to retrieve - Type - - - - Returns a column as a float value - - The index of the column to retrieve - float - - - - Returns the column as a Guid - - The index of the column to retrieve - Guid - - - - Returns the column as a short - - The index of the column to retrieve - Int16 - - - - Retrieves the column as an int - - The index of the column to retrieve - Int32 - - - - Retrieves the column as a long - - The index of the column to retrieve - Int64 - - - - Retrieves the name of the column - - The index of the column to retrieve - string - - - - Retrieves the i of a column, given its name - - The name of the column to retrieve - The int i of the column - - - - Schema information in SQLite is difficult to map into .NET conventions, so a lot of work must be done - to gather the necessary information so it can be represented in an ADO.NET manner. - - Returns a DataTable containing the schema information for the active SELECT statement being processed. - - - - Retrieves the column as a string - - The index of the column to retrieve - string - - - - Retrieves the column as an object corresponding to the underlying datatype of the column - - The index of the column to retrieve - object - - - - Retreives the values of multiple columns, up to the size of the supplied array - - The array to fill with values from the columns in the current resultset - The number of columns retrieved - - - - Returns a collection containing all the column names and values for the - current row of data in the current resultset, if any. If there is no - current row or no current resultset, an exception may be thrown. - - - The collection containing the column name and value information for the - current row of data in the current resultset or null if this information - cannot be obtained. - - - - - Returns True if the specified column is null - - The index of the column to retrieve - True or False - - - - Moves to the next resultset in multiple row-returning SQL command. - - True if the command was successful and a new resultset is available, False otherwise. - - - - This method attempts to query the database connection associated with - the data reader in use. If the underlying command or connection is - unavailable, a null value will be returned. - - - The connection object -OR- null if it is unavailable. - - - - - This method attempts to query the flags associated with the database - connection in use. If the database connection is disposed, the default - flags will be returned. - - - The data reader containing the databse connection to query the flags from. - - - The connection flags value. - - - - - Retrieves the SQLiteType for a given column, and caches it to avoid repetetive interop calls. - - The index of the column to retrieve - A SQLiteType structure - - - - Reads the next row from the resultset - - True if a new row was successfully loaded and is ready for processing - - - - Not implemented. Returns 0 - - - - - Returns the number of columns in the current resultset - - - - - Returns the number of visible fields in the current resultset - - - - - Returns True if the resultset has rows that can be fetched - - - - - Returns True if the data reader is closed - - - - - Retrieve the count of records affected by an update/insert command. Only valid once the data reader is closed! - - - - - Indexer to retrieve data from a column given its name - - The name of the column to retrieve data for - The value contained in the column - - - - Indexer to retrieve data from a column given its i - - The index of the column to retrieve - The value contained in the column - - - - SQLite exception class. - - - - - Private constructor for use with serialization. - - - Holds the serialized object data about the exception being thrown. - - - Contains contextual information about the source or destination. - - - - - Public constructor for generating a SQLite exception given the error - code and message. - - - The SQLite return code to report. - - - Message text to go along with the return code message text. - - - - - Public constructor that uses the base class constructor for the error - message. - - Error message text. - - - - Public constructor that uses the default base class constructor. - - - - - Public constructor that uses the base class constructor for the error - message and inner exception. - - Error message text. - The original (inner) exception. - - - - Adds extra information to the serialized object data specific to this - class type. This is only used for serialization. - - - Holds the serialized object data about the exception being thrown. - - - Contains contextual information about the source or destination. - - - - - Returns the error message for the specified SQLite return code. - - The SQLite return code. - The error message or null if it cannot be found. - - - - Returns the composite error message based on the SQLite return code - and the optional detailed error message. - - The SQLite return code. - Optional detailed error message. - Error message text for the return code. - - - - Gets the associated SQLite result code for this exception as a - . This property returns the same - underlying value as the property. - - - - - Gets the associated SQLite return code for this exception as an - . For desktop versions of the .NET Framework, - this property overrides the property of the same name within the - - class. This property returns the same underlying value as the - property. - - - - - SQLite error codes. Actually, this enumeration represents a return code, - which may also indicate success in one of several ways (e.g. SQLITE_OK, - SQLITE_ROW, and SQLITE_DONE). Therefore, the name of this enumeration is - something of a misnomer. - - - - - The error code is unknown. This error code - is only used by the managed wrapper itself. - - - - - Successful result - - - - - SQL error or missing database - - - - - Internal logic error in SQLite - - - - - Access permission denied - - - - - Callback routine requested an abort - - - - - The database file is locked - - - - - A table in the database is locked - - - - - A malloc() failed - - - - - Attempt to write a readonly database - - - - - Operation terminated by sqlite3_interrupt() - - - - - Some kind of disk I/O error occurred - - - - - The database disk image is malformed - - - - - Unknown opcode in sqlite3_file_control() - - - - - Insertion failed because database is full - - - - - Unable to open the database file - - - - - Database lock protocol error - - - - - Database is empty - - - - - The database schema changed - - - - - String or BLOB exceeds size limit - - - - - Abort due to constraint violation - - - - - Data type mismatch - - - - - Library used incorrectly - - - - - Uses OS features not supported on host - - - - - Authorization denied - - - - - Auxiliary database format error - - - - - 2nd parameter to sqlite3_bind out of range - - - - - File opened that is not a database file - - - - - Notifications from sqlite3_log() - - - - - Warnings from sqlite3_log() - - - - - sqlite3_step() has another row ready - - - - - sqlite3_step() has finished executing - - - - - Used to mask off extended result codes - - - - - SQLite implementation of . - - - SQLite implementation of . - - - - - Constructs a new instance. - - - - - Static instance member which returns an instanced class. - - - - - Creates and returns a new object. - - The new object. - - - - Creates and returns a new object. - - The new object. - - - - Creates and returns a new object. - - The new object. - - - - Creates and returns a new object. - - The new object. - - - - Creates and returns a new object. - - The new object. - - - - Creates and returns a new object. - - The new object. - - - - Will provide a object in .NET 3.5. - - The class or interface type to query for. - - - - - This event is raised whenever SQLite raises a logging event. - Note that this should be set as one of the first things in the - application. This event is provided for backward compatibility only. - New code should use the class instead. - - - - - This abstract class is designed to handle user-defined functions easily. An instance of the derived class is made for each - connection to the database. - - - Although there is one instance of a class derived from SQLiteFunction per database connection, the derived class has no access - to the underlying connection. This is necessary to deter implementers from thinking it would be a good idea to make database - calls during processing. - - It is important to distinguish between a per-connection instance, and a per-SQL statement context. One instance of this class - services all SQL statements being stepped through on that connection, and there can be many. One should never store per-statement - information in member variables of user-defined function classes. - - For aggregate functions, always create and store your per-statement data in the contextData object on the 1st step. This data will - be automatically freed for you (and Dispose() called if the item supports IDisposable) when the statement completes. - - - - - The base connection this function is attached to - - - - - Internal array used to keep track of aggregate function context data - - - - - The connection flags associated with this object (this should be the - same value as the flags associated with the parent connection object). - - - - - Holds a reference to the callback function for user functions - - - - - Holds a reference to the callbakc function for stepping in an aggregate function - - - - - Holds a reference to the callback function for finalizing an aggregate function - - - - - Holds a reference to the callback function for collation sequences - - - - - Current context of the current callback. Only valid during a callback - - - - - This static list contains all the user-defined functions declared using the proper attributes. - - - - - Internal constructor, initializes the function's internal variables. - - - - - Constructs an instance of this class using the specified data-type - conversion parameters. - - - The DateTime format to be used when converting string values to a - DateTime and binding DateTime parameters. - - - The to be used when creating DateTime - values. - - - The format string to be used when parsing and formatting DateTime - values. - - - Non-zero to create a UTF-16 data-type conversion context; otherwise, - a UTF-8 data-type conversion context will be created. - - - - - Disposes of any active contextData variables that were not automatically cleaned up. Sometimes this can happen if - someone closes the connection while a DataReader is open. - - - - - Placeholder for a user-defined disposal routine - - True if the object is being disposed explicitly - - - - Scalar functions override this method to do their magic. - - - Parameters passed to functions have only an affinity for a certain data type, there is no underlying schema available - to force them into a certain type. Therefore the only types you will ever see as parameters are - DBNull.Value, Int64, Double, String or byte[] array. - - The arguments for the command to process - You may return most simple types as a return value, null or DBNull.Value to return null, DateTime, or - you may return an Exception-derived class if you wish to return an error to SQLite. Do not actually throw the error, - just return it! - - - - Aggregate functions override this method to do their magic. - - - Typically you'll be updating whatever you've placed in the contextData field and returning as quickly as possible. - - The arguments for the command to process - The 1-based step number. This is incrememted each time the step method is called. - A placeholder for implementers to store contextual data pertaining to the current context. - - - - Aggregate functions override this method to finish their aggregate processing. - - - If you implemented your aggregate function properly, - you've been recording and keeping track of your data in the contextData object provided, and now at this stage you should have - all the information you need in there to figure out what to return. - NOTE: It is possible to arrive here without receiving a previous call to Step(), in which case the contextData will - be null. This can happen when no rows were returned. You can either return null, or 0 or some other custom return value - if that is the case. - - Your own assigned contextData, provided for you so you can return your final results. - You may return most simple types as a return value, null or DBNull.Value to return null, DateTime, or - you may return an Exception-derived class if you wish to return an error to SQLite. Do not actually throw the error, - just return it! - - - - - User-defined collation sequences override this method to provide a custom string sorting algorithm. - - The first string to compare - The second strnig to compare - 1 if param1 is greater than param2, 0 if they are equal, or -1 if param1 is less than param2 - - - - Converts an IntPtr array of context arguments to an object array containing the resolved parameters the pointers point to. - - - Parameters passed to functions have only an affinity for a certain data type, there is no underlying schema available - to force them into a certain type. Therefore the only types you will ever see as parameters are - DBNull.Value, Int64, Double, String or byte[] array. - - The number of arguments - A pointer to the array of arguments - An object array of the arguments once they've been converted to .NET values - - - - Takes the return value from Invoke() and Final() and figures out how to return it to SQLite's context. - - The context the return value applies to - The parameter to return to SQLite - - - - Internal scalar callback function, which wraps the raw context pointer and calls the virtual Invoke() method. - WARNING: Must not throw exceptions. - - A raw context pointer - Number of arguments passed in - A pointer to the array of arguments - - - - Internal collation sequence function, which wraps up the raw string pointers and executes the Compare() virtual function. - WARNING: Must not throw exceptions. - - Not used - Length of the string pv1 - Pointer to the first string to compare - Length of the string pv2 - Pointer to the second string to compare - Returns -1 if the first string is less than the second. 0 if they are equal, or 1 if the first string is greater - than the second. Returns 0 if an exception is caught. - - - - Internal collation sequence function, which wraps up the raw string pointers and executes the Compare() virtual function. - WARNING: Must not throw exceptions. - - Not used - Length of the string pv1 - Pointer to the first string to compare - Length of the string pv2 - Pointer to the second string to compare - Returns -1 if the first string is less than the second. 0 if they are equal, or 1 if the first string is greater - than the second. Returns 0 if an exception is caught. - - - - The internal aggregate Step function callback, which wraps the raw context pointer and calls the virtual Step() method. - WARNING: Must not throw exceptions. - - - This function takes care of doing the lookups and getting the important information put together to call the Step() function. - That includes pulling out the user's contextData and updating it after the call is made. We use a sorted list for this so - binary searches can be done to find the data. - - A raw context pointer - Number of arguments passed in - A pointer to the array of arguments - - - - An internal aggregate Final function callback, which wraps the context pointer and calls the virtual Final() method. - WARNING: Must not throw exceptions. - - A raw context pointer - - - - Using reflection, enumerate all assemblies in the current appdomain looking for classes that - have a SQLiteFunctionAttribute attribute, and registering them accordingly. - - - - - Manual method of registering a function. The type must still have the SQLiteFunctionAttributes in order to work - properly, but this is a workaround for the Compact Framework where enumerating assemblies is not currently supported. - - The type of the function to register - - - - Called by SQLiteBase derived classes, this function binds all user-defined functions to a connection. - It is done this way so that all user-defined functions will access the database using the same encoding scheme - as the connection (UTF-8 or UTF-16). - - - The wrapper functions that interop with SQLite will create a unique cookie value, which internally is a pointer to - all the wrapped callback functions. The interop function uses it to map CDecl callbacks to StdCall callbacks. - - The base object on which the functions are to bind - The flags associated with the parent connection object - Returns a logical list of functions which the connection should retain until it is closed. - - - - This function binds a user-defined functions to a connection. - - - The object instance associated with the - that the function should be bound to. - - - The object instance containing - the metadata for the function to be bound. - - - The object instance that implements the - function to be bound. - - - The flags associated with the parent connection object. - - - - - Returns a reference to the underlying connection's SQLiteConvert class, which can be used to convert - strings and DateTime's into the current connection's encoding schema. - - - - - Extends SQLiteFunction and allows an inherited class to obtain the collating sequence associated with a function call. - - - User-defined functions can call the GetCollationSequence() method in this class and use it to compare strings and char arrays. - - - - - Obtains the collating sequence in effect for the given function. - - - - - - The type of user-defined function to declare - - - - - Scalar functions are designed to be called and return a result immediately. Examples include ABS(), Upper(), Lower(), etc. - - - - - Aggregate functions are designed to accumulate data until the end of a call and then return a result gleaned from the accumulated data. - Examples include SUM(), COUNT(), AVG(), etc. - - - - - Collation sequences are used to sort textual data in a custom manner, and appear in an ORDER BY clause. Typically text in an ORDER BY is - sorted using a straight case-insensitive comparison function. Custom collating sequences can be used to alter the behavior of text sorting - in a user-defined manner. - - - - - An internal callback delegate declaration. - - Raw native context pointer for the user function. - Total number of arguments to the user function. - Raw native pointer to the array of raw native argument pointers. - - - - An internal final callback delegate declaration. - - Raw context pointer for the user function - - - - Internal callback delegate for implementing collation sequences - - Not used - Length of the string pv1 - Pointer to the first string to compare - Length of the string pv2 - Pointer to the second string to compare - Returns -1 if the first string is less than the second. 0 if they are equal, or 1 if the first string is greater - than the second. - - - - The type of collating sequence - - - - - The built-in BINARY collating sequence - - - - - The built-in NOCASE collating sequence - - - - - The built-in REVERSE collating sequence - - - - - A custom user-defined collating sequence - - - - - The encoding type the collation sequence uses - - - - - The collation sequence is UTF8 - - - - - The collation sequence is UTF16 little-endian - - - - - The collation sequence is UTF16 big-endian - - - - - A struct describing the collating sequence a function is executing in - - - - - The name of the collating sequence - - - - - The type of collating sequence - - - - - The text encoding of the collation sequence - - - - - Context of the function that requested the collating sequence - - - - - Calls the base collating sequence to compare two strings - - The first string to compare - The second string to compare - -1 if s1 is less than s2, 0 if s1 is equal to s2, and 1 if s1 is greater than s2 - - - - Calls the base collating sequence to compare two character arrays - - The first array to compare - The second array to compare - -1 if c1 is less than c2, 0 if c1 is equal to c2, and 1 if c1 is greater than c2 - - - - A simple custom attribute to enable us to easily find user-defined functions in - the loaded assemblies and initialize them in SQLite as connections are made. - - - - - Default constructor, initializes the internal variables for the function. - - - - - Constructs an instance of this class. - - - The name of the function, as seen by the SQLite core library. - - - The number of arguments that the function will accept. - - - The type of function being declared. This will either be Scalar, - Aggregate, or Collation. - - - - - The function's name as it will be used in SQLite command text. - - - - - The number of arguments this function expects. -1 if the number of arguments is variable. - - - - - The type of function this implementation will be. - - - - - The object instance that describes the class - containing the implementation for the associated function. - - - - - This class provides key info for a given SQLite statement. - - Providing key information for a given statement is non-trivial :( - - - - - - This function does all the nasty work at determining what keys need to be returned for - a given statement. - - - - - - - - Make sure all the subqueries are open and ready and sync'd with the current rowid - of the table they're supporting - - - - - Release any readers on any subqueries - - - - - Append all the columns we've added to the original query to the schema - - - - - - How many additional columns of keyinfo we're holding - - - - - Used to support CommandBehavior.KeyInfo - - - - - A single sub-query for a given table/database. - - - - - Event data for logging event handlers. - - - - - The error code. The type of this object value should be - or . - - - - - SQL statement text as the statement first begins executing - - - - - Extra data associated with this event, if any. - - - - - Constructs the object. - - Should be null. - - The error code. The type of this object value should be - or . - - The error message, if any. - The extra data, if any. - - - - Raised when a log event occurs. - - The current connection - Event arguments of the trace - - - - Manages the SQLite custom logging functionality and the associated - callback for the whole process. - - - - - Object used to synchronize access to the static instance data - for this class. - - - - - Member variable to store the AppDomain.DomainUnload event handler. - - - - - The default log event handler. - - - - - The log callback passed to native SQLite engine. This must live - as long as the SQLite library has a pointer to it. - - - - - The base SQLite object to interop with. - - - - - This will be non-zero if logging is currently enabled. - - - - - Initializes the SQLite logging facilities. - - - - - Handles the AppDomain being unloaded. - - Should be null. - The data associated with this event. - - - - Log a message to all the registered log event handlers without going - through the SQLite library. - - The message to be logged. - - - - Log a message to all the registered log event handlers without going - through the SQLite library. - - The SQLite error code. - The message to be logged. - - - - Log a message to all the registered log event handlers without going - through the SQLite library. - - The integer error code. - The message to be logged. - - - - Log a message to all the registered log event handlers without going - through the SQLite library. - - - The error code. The type of this object value should be - System.Int32 or SQLiteErrorCode. - - The message to be logged. - - - - Creates and initializes the default log event handler. - - - - - Adds the default log event handler to the list of handlers. - - - - - Removes the default log event handler from the list of handlers. - - - - - Internal proxy function that calls any registered application log - event handlers. - - WARNING: This method is used more-or-less directly by native code, - do not modify its type signature. - - - The extra data associated with this message, if any. - - - The error code associated with this message. - - - The message string to be logged. - - - - - Default logger. Currently, uses the Trace class (i.e. sends events - to the current trace listeners, if any). - - Should be null. - The data associated with this event. - - - - Member variable to store the application log handler to call. - - - - - This event is raised whenever SQLite raises a logging event. - Note that this should be set as one of the first things in the - application. - - - - - If this property is true, logging is enabled; otherwise, logging is - disabled. When logging is disabled, no logging events will fire. - - - - - MetaDataCollections specific to SQLite - - - - - Returns a list of databases attached to the connection - - - - - Returns column information for the specified table - - - - - Returns index information for the optionally-specified table - - - - - Returns base columns for the given index - - - - - Returns the tables in the given catalog - - - - - Returns user-defined views in the given catalog - - - - - Returns underlying column information on the given view - - - - - Returns foreign key information for the given catalog - - - - - Returns the triggers on the database - - - - - SQLite implementation of DbParameter. - - - - - The data type of the parameter - - - - - The version information for mapping the parameter - - - - - The value of the data in the parameter - - - - - The source column for the parameter - - - - - The column name - - - - - The data size, unused by SQLite - - - - - Default constructor - - - - - Constructs a named parameter given the specified parameter name - - The parameter name - - - - Constructs a named parameter given the specified parameter name and initial value - - The parameter name - The initial value of the parameter - - - - Constructs a named parameter of the specified type - - The parameter name - The datatype of the parameter - - - - Constructs a named parameter of the specified type and source column reference - - The parameter name - The data type - The source column - - - - Constructs a named parameter of the specified type, source column and row version - - The parameter name - The data type - The source column - The row version information - - - - Constructs an unnamed parameter of the specified data type - - The datatype of the parameter - - - - Constructs an unnamed parameter of the specified data type and sets the initial value - - The datatype of the parameter - The initial value of the parameter - - - - Constructs an unnamed parameter of the specified data type and source column - - The datatype of the parameter - The source column - - - - Constructs an unnamed parameter of the specified data type, source column and row version - - The data type - The source column - The row version information - - - - Constructs a named parameter of the specified type and size - - The parameter name - The data type - The size of the parameter - - - - Constructs a named parameter of the specified type, size and source column - - The name of the parameter - The data type - The size of the parameter - The source column - - - - Constructs a named parameter of the specified type, size, source column and row version - - The name of the parameter - The data type - The size of the parameter - The source column - The row version information - - - - Constructs a named parameter of the specified type, size, source column and row version - - The name of the parameter - The data type - The size of the parameter - Only input parameters are supported in SQLite - Ignored - Ignored - Ignored - The source column - The row version information - The initial value to assign the parameter - - - - Constructs a named parameter, yet another flavor - - The name of the parameter - The data type - The size of the parameter - Only input parameters are supported in SQLite - Ignored - Ignored - The source column - The row version information - Whether or not this parameter is for comparing NULL's - The intial value to assign the parameter - - - - Constructs an unnamed parameter of the specified type and size - - The data type - The size of the parameter - - - - Constructs an unnamed parameter of the specified type, size, and source column - - The data type - The size of the parameter - The source column - - - - Constructs an unnamed parameter of the specified type, size, source column and row version - - The data type - The size of the parameter - The source column - The row version information - - - - Resets the DbType of the parameter so it can be inferred from the value - - - - - Clones a parameter - - A new, unassociated SQLiteParameter - - - - Whether or not the parameter can contain a null value - - - - - Returns the datatype of the parameter - - - - - Supports only input parameters - - - - - Returns the parameter name - - - - - Returns the size of the parameter - - - - - Gets/sets the source column - - - - - Used by DbCommandBuilder to determine the mapping for nullable fields - - - - - Gets and sets the row version - - - - - Gets and sets the parameter value. If no datatype was specified, the datatype will assume the type from the value given. - - - - - SQLite implementation of DbParameterCollection. - - - - - The underlying command to which this collection belongs - - - - - The internal array of parameters in this collection - - - - - Determines whether or not all parameters have been bound to their statement(s) - - - - - Initializes the collection - - The command to which the collection belongs - - - - Retrieves an enumerator for the collection - - An enumerator for the underlying array - - - - Adds a parameter to the collection - - The parameter name - The data type - The size of the value - The source column - A SQLiteParameter object - - - - Adds a parameter to the collection - - The parameter name - The data type - The size of the value - A SQLiteParameter object - - - - Adds a parameter to the collection - - The parameter name - The data type - A SQLiteParameter object - - - - Adds a parameter to the collection - - The parameter to add - A zero-based index of where the parameter is located in the array - - - - Adds a parameter to the collection - - The parameter to add - A zero-based index of where the parameter is located in the array - - - - Adds a named/unnamed parameter and its value to the parameter collection. - - Name of the parameter, or null to indicate an unnamed parameter - The initial value of the parameter - Returns the SQLiteParameter object created during the call. - - - - Adds an array of parameters to the collection - - The array of parameters to add - - - - Adds an array of parameters to the collection - - The array of parameters to add - - - - Clears the array and resets the collection - - - - - Determines if the named parameter exists in the collection - - The name of the parameter to check - True if the parameter is in the collection - - - - Determines if the parameter exists in the collection - - The SQLiteParameter to check - True if the parameter is in the collection - - - - Not implemented - - - - - - - Retrieve a parameter by name from the collection - - The name of the parameter to fetch - A DbParameter object - - - - Retrieves a parameter by its index in the collection - - The index of the parameter to retrieve - A DbParameter object - - - - Returns the index of a parameter given its name - - The name of the parameter to find - -1 if not found, otherwise a zero-based index of the parameter - - - - Returns the index of a parameter - - The parameter to find - -1 if not found, otherwise a zero-based index of the parameter - - - - Inserts a parameter into the array at the specified location - - The zero-based index to insert the parameter at - The parameter to insert - - - - Removes a parameter from the collection - - The parameter to remove - - - - Removes a parameter from the collection given its name - - The name of the parameter to remove - - - - Removes a parameter from the collection given its index - - The zero-based parameter index to remove - - - - Re-assign the named parameter to a new parameter object - - The name of the parameter to replace - The new parameter - - - - Re-assign a parameter at the specified index - - The zero-based index of the parameter to replace - The new parameter - - - - Un-binds all parameters from their statements - - - - - This function attempts to map all parameters in the collection to all statements in a Command. - Since named parameters may span multiple statements, this function makes sure all statements are bound - to the same named parameter. Unnamed parameters are bound in sequence. - - - - - Returns false - - - - - Returns false - - - - - Returns false - - - - - Returns null - - - - - Returns a count of parameters in the collection - - - - - Overloaded to specialize the return value of the default indexer - - Name of the parameter to get/set - The specified named SQLite parameter - - - - Overloaded to specialize the return value of the default indexer - - The index of the parameter to get/set - The specified SQLite parameter - - - - Represents a single SQL statement in SQLite. - - - - - The underlying SQLite object this statement is bound to - - - - - The command text of this SQL statement - - - - - The actual statement pointer - - - - - An index from which unnamed parameters begin - - - - - Names of the parameters as SQLite understands them to be - - - - - Parameters for this statement - - - - - Command this statement belongs to (if any) - - - - - The flags associated with the parent connection object. - - - - - Initializes the statement and attempts to get all information about parameters in the statement - - The base SQLite object - The flags associated with the parent connection object - The statement - The command text for this statement - The previous command in a multi-statement command - - - - Disposes and finalizes the statement - - - - - If the underlying database connection is open, fetches the number of changed rows - resulting from the most recent query; otherwise, does nothing. - - - The number of changes when true is returned. - Undefined if false is returned. - - Non-zero if the number of changed rows was fetched. - - - - Called by SQLiteParameterCollection, this function determines if the specified parameter name belongs to - this statement, and if so, keeps a reference to the parameter so it can be bound later. - - The parameter name to map - The parameter to assign it - - - - Bind all parameters, making sure the caller didn't miss any - - - - - Attempts to convert an arbitrary object to the Boolean data type. - Null object values are converted to false. Throws a SQLiteException - upon failure. - - The object value to convert. - The format provider to use. - The converted boolean value. - - - - Perform the bind operation for an individual parameter - - The index of the parameter to bind - The parameter we're binding - - - - SQLite implementation of DbTransaction. - - - - - The connection to which this transaction is bound - - - - - Constructs the transaction object, binding it to the supplied connection - - The connection to open a transaction on - TRUE to defer the writelock, or FALSE to lock immediately - - - - Disposes the transaction. If it is currently active, any changes are rolled back. - - - - - Commits the current transaction. - - - - - Rolls back the active transaction. - - - - - Returns the underlying connection to which this transaction applies. - - - - - Forwards to the local Connection property - - - - - Gets the isolation level of the transaction. SQLite only supports Serializable transactions. - - - - - A strongly-typed resource class, for looking up localized strings, etc. - - - - - Returns the cached ResourceManager instance used by this class. - - - - - Overrides the current thread's CurrentUICulture property for all - resource lookups using this strongly typed resource class. - - - - - Looks up a localized string similar to <?xml version="1.0" standalone="yes"?> - <DocumentElement> - <DataTypes> - <TypeName>smallint</TypeName> - <ProviderDbType>10</ProviderDbType> - <ColumnSize>5</ColumnSize> - <DataType>System.Int16</DataType> - <CreateFormat>smallint</CreateFormat> - <IsAutoIncrementable>false</IsAutoIncrementable> - <IsCaseSensitive>false</IsCaseSensitive> - <IsFixedLength>true</IsFixedLength> - <IsFixedPrecisionScale>true</IsFixedPrecisionScale> - <IsLong>false</IsLong> - <IsNullable>true</ [rest of string was truncated]";. - - - - - Looks up a localized string similar to ALL,ALTER,AND,AS,AUTOINCREMENT,BETWEEN,BY,CASE,CHECK,COLLATE,COMMIT,CONSTRAINT,CREATE,CROSS,DEFAULT,DEFERRABLE,DELETE,DISTINCT,DROP,ELSE,ESCAPE,EXCEPT,FOREIGN,FROM,FULL,GROUP,HAVING,IN,INDEX,INNER,INSERT,INTERSECT,INTO,IS,ISNULL,JOIN,LEFT,LIMIT,NATURAL,NOT,NOTNULL,NULL,ON,OR,ORDER,OUTER,PRIMARY,REFERENCES,RIGHT,ROLLBACK,SELECT,SET,TABLE,THEN,TO,TRANSACTION,UNION,UNIQUE,UPDATE,USING,VALUES,WHEN,WHERE. - - - - - Looks up a localized string similar to <?xml version="1.0" encoding="utf-8" ?> - <DocumentElement> - <MetaDataCollections> - <CollectionName>MetaDataCollections</CollectionName> - <NumberOfRestrictions>0</NumberOfRestrictions> - <NumberOfIdentifierParts>0</NumberOfIdentifierParts> - </MetaDataCollections> - <MetaDataCollections> - <CollectionName>DataSourceInformation</CollectionName> - <NumberOfRestrictions>0</NumberOfRestrictions> - <NumberOfIdentifierParts>0</NumberOfIdentifierParts> - </MetaDataCollections> - <MetaDataC [rest of string was truncated]";. - - - - - The file extension used for dynamic link libraries. - - - - - The file extension used for the XML configuration file. - - - - - This is the name of the XML configuration file specific to the - System.Data.SQLite assembly. - - - - - This lock is used to protect the static _SQLiteNativeModuleFileName, - _SQLiteNativeModuleHandle, and processorArchitecturePlatforms fields. - - - - - This dictionary stores the mappings between processor architecture - names and platform names. These mappings are now used for two - purposes. First, they are used to determine if the assembly code - base should be used instead of the location, based upon whether one - or more of the named sub-directories exist within the assembly code - base. Second, they are used to assist in loading the appropriate - SQLite interop assembly into the current process. - - - - - For now, this method simply calls the Initialize method. - - - - - Attempts to initialize this class by pre-loading the native SQLite - library for the processor architecture of the current process. - - - - - Queries and returns the XML configuration file name for the assembly - containing the managed System.Data.SQLite components. - - - The XML configuration file name -OR- null if it cannot be determined - or does not exist. - - - - - Queries and returns the value of the specified setting, using the XML - configuration file and/or the environment variables for the current - process and/or the current system, when available. - - - The name of the setting. - - - The value to be returned if the setting has not been set explicitly - or cannot be determined. - - - The value of the setting -OR- the default value specified by - if it has not been set explicitly or - cannot be determined. By default, all references to existing - environment variables will be expanded to their corresponding values - within the value to be returned unless either the "No_Expand" or - "No_Expand_" environment variable is set [to - anything]. - - - - - Queries and returns the directory for the assembly currently being - executed. - - - The directory for the assembly currently being executed -OR- null if - it cannot be determined. - - - - - The name of the environment variable containing the processor - architecture of the current process. - - - - - This is the P/Invoke method that wraps the native Win32 LoadLibrary - function. See the MSDN documentation for full details on what it - does. - - - The name of the executable library. - - - The native module handle upon success -OR- IntPtr.Zero on failure. - - - - - The native module file name for the native SQLite library or null. - - - - - The native module handle for the native SQLite library or the value - IntPtr.Zero. - - - - - Searches for the native SQLite library in the directory containing - the assembly currently being executed as well as the base directory - for the current application domain. - - - Upon success, this parameter will be modified to refer to the base - directory containing the native SQLite library. - - - Upon success, this parameter will be modified to refer to the name - of the immediate directory (i.e. the offset from the base directory) - containing the native SQLite library. - - - Non-zero (success) if the native SQLite library was found; otherwise, - zero (failure). - - - - - Queries and returns the base directory of the current application - domain. - - - The base directory for the current application domain -OR- null if it - cannot be determined. - - - - - Determines if the dynamic link library file name requires a suffix - and adds it if necessary. - - - The original dynamic link library file name to inspect. - - - The dynamic link library file name, possibly modified to include an - extension. - - - - - Queries and returns the processor architecture of the current - process. - - - The processor architecture of the current process -OR- null if it - cannot be determined. - - - - - Given the processor architecture, returns the name of the platform. - - - The processor architecture to be translated to a platform name. - - - The platform name for the specified processor architecture -OR- null - if it cannot be determined. - - - - - Attempts to load the native SQLite library based on the specified - directory and processor architecture. - - - The base directory to use, null for default (the base directory of - the current application domain). This directory should contain the - processor architecture specific sub-directories. - - - The requested processor architecture, null for default (the - processor architecture of the current process). This caller should - almost always specify null for this parameter. - - - The candidate native module file name to load will be stored here, - if necessary. - - - The native module handle as returned by LoadLibrary will be stored - here, if necessary. This value will be IntPtr.Zero if the call to - LoadLibrary fails. - - - Non-zero if the native module was loaded successfully; otherwise, - zero. - - - - - This class represents a context from the SQLite core library that can - be passed to the sqlite3_result_*() and associated functions. - - - - - This interface represents a native handle provided by the SQLite core - library. - - - - - The native handle value. - - - - - The native context handle. - - - - - Constructs an instance of this class using the specified native - context handle. - - - The native context handle to use. - - - - - Sets the context result to NULL. - - - - - Sets the context result to the specified - value. - - - The value to use. - - - - - Sets the context result to the specified - value. - - - The value to use. - - - - - Sets the context result to the specified - value. - - - The value to use. - - - - - Sets the context result to the specified - value. - - - The value to use. This value will be - converted to the UTF-8 encoding prior to being used. - - - - - Sets the context result to the specified - value containing an error message. - - - The value containing the error message text. - This value will be converted to the UTF-8 encoding prior to being - used. - - - - - Sets the context result to the specified - value. - - - The value to use. - - - - - Sets the context result to contain the error code SQLITE_TOOBIG. - - - - - Sets the context result to contain the error code SQLITE_NOMEM. - - - - - Sets the context result to the specified array - value. - - - The array value to use. - - - - - Sets the context result to a BLOB of zeros of the specified size. - - - The number of zero bytes to use for the BLOB context result. - - - - - Sets the context result to the specified . - - - The to use. - - - - - Returns the underlying SQLite native handle associated with this - object instance. - - - - - This class represents a value from the SQLite core library that can be - passed to the sqlite3_value_*() and associated functions. - - - - - The native value handle. - - - - - Constructs an instance of this class using the specified native - value handle. - - - The native value handle to use. - - - - - Invalidates the native value handle, thereby preventing further - access to it from this object instance. - - - - - Converts a logical array of native pointers to native sqlite3_value - structures into a managed array of - object instances. - - - The number of elements in the logical array of native sqlite3_value - structures. - - - The native pointer to the logical array of native sqlite3_value - structures to convert. - - - The managed array of object instances or - null upon failure. - - - - - Gets and returns the type affinity associated with this value. - - - The type affinity associated with this value. - - - - - Gets and returns the number of bytes associated with this value, if - it refers to a UTF-8 encoded string. - - - The number of bytes associated with this value. The returned value - may be zero. - - - - - Gets and returns the associated with this - value. - - - The associated with this value. - - - - - Gets and returns the associated with - this value. - - - The associated with this value. - - - - - Gets and returns the associated with this - value. - - - The associated with this value. - - - - - Gets and returns the associated with this - value. - - - The associated with this value. The value is - converted from the UTF-8 encoding prior to being returned. - - - - - Gets and returns the array associated with this - value. - - - The array associated with this value. - - - - - Uses the native value handle to obtain and store the managed value - for this object instance, thus saving it for later use. The type - of the managed value is determined by the type affinity of the - native value. If the type affinity is not recognized by this - method, no work is done and false is returned. - - - Non-zero if the native value was persisted successfully. - - - - - Returns the underlying SQLite native handle associated with this - object instance. - - - - - Returns non-zero if the native SQLite value has been successfully - persisted as a managed value within this object instance (i.e. the - property may then be read successfully). - - - - - If the managed value for this object instance is available (i.e. it - has been previously persisted via the ) method, - that value is returned; otherwise, an exception is thrown. The - returned value may be null. - - - - - These are the allowed values for the operators that are part of a - constraint term in the WHERE clause of a query that uses a virtual - table. - - - - - This value represents the equality operator. - - - - - This value represents the greater than operator. - - - - - This value represents the less than or equal to operator. - - - - - This value represents the less than operator. - - - - - This value represents the greater than or equal to operator. - - - - - This value represents the MATCH operator. - - - - - This class represents the native sqlite3_index_constraint structure - from the SQLite core library. - - - - - Constructs an instance of this class using the specified native - sqlite3_index_constraint structure. - - - The native sqlite3_index_constraint structure to use. - - - - - Constructs an instance of this class using the specified field - values. - - - Column on left-hand side of constraint. - - - Constraint operator (). - - - True if this constraint is usable. - - - Used internally - - should ignore. - - - - - Column on left-hand side of constraint. - - - - - Constraint operator (). - - - - - True if this constraint is usable. - - - - - Used internally - - should ignore. - - - - - This class represents the native sqlite3_index_orderby structure from - the SQLite core library. - - - - - Constructs an instance of this class using the specified native - sqlite3_index_orderby structure. - - - The native sqlite3_index_orderby structure to use. - - - - - Constructs an instance of this class using the specified field - values. - - - Column number. - - - True for DESC. False for ASC. - - - - - Column number. - - - - - True for DESC. False for ASC. - - - - - This class represents the native sqlite3_index_constraint_usage - structure from the SQLite core library. - - - - - Constructs an instance of this class using the specified native - sqlite3_index_constraint_usage structure. - - - The native sqlite3_index_constraint_usage structure to use. - - - - - Constructs an instance of this class using the specified field - values. - - - If greater than 0, constraint is part of argv to xFilter. - - - Do not code a test for this constraint. - - - - - If greater than 0, constraint is part of argv to xFilter. - - - - - Do not code a test for this constraint. - - - - - This class represents the various inputs provided by the SQLite core - library to the method. - - - - - Constructs an instance of this class. - - - The number of instances to - pre-allocate space for. - - - The number of instances to - pre-allocate space for. - - - - - An array of object instances, - each containing information supplied by the SQLite core library. - - - - - An array of object instances, - each containing information supplied by the SQLite core library. - - - - - This class represents the various outputs provided to the SQLite core - library by the method. - - - - - Constructs an instance of this class. - - - The number of instances - to pre-allocate space for. - - - - - Determines if the native estimatedRows field can be used, based on - the available version of the SQLite core library. - - - Non-zero if the property is supported - by the SQLite core library. - - - - - An array of object - instances, each containing information to be supplied to the SQLite - core library. - - - - - Number used to help identify the selected index. This value will - later be provided to the - method. - - - - - String used to help identify the selected index. This value will - later be provided to the - method. - - - - - Non-zero if the index string must be freed by the SQLite core - library. - - - - - True if output is already ordered. - - - - - Estimated cost of using this index. Using a null value here - indicates that a default estimated cost value should be used. - - - - - Estimated number of rows returned. Using a null value here - indicates that a default estimated rows value should be used. - - - - - This class represents the various inputs and outputs used with the - method. - - - - - Constructs an instance of this class. - - - The number of (and - ) instances to - pre-allocate space for. - - - The number of instances to - pre-allocate space for. - - - - - Converts a native pointer to a native sqlite3_index_info structure - into a new object instance. - - - The native pointer to the native sqlite3_index_info structure to - convert. - - - Upon success, this parameter will be modified to contain the newly - created object instance. - - - - - Populates the outputs of a pre-allocated native sqlite3_index_info - structure using an existing object - instance. - - - The existing object instance containing - the output data to use. - - - The native pointer to the pre-allocated native sqlite3_index_info - structure. - - - - - The object instance containing - the inputs to the - method. - - - - - The object instance containing - the outputs from the - method. - - - - - This class represents a managed virtual table implementation. It is - not sealed and should be used as the base class for any user-defined - virtual table classes implemented in managed code. - - - - - The index within the array of strings provided to the - and - methods containing the - name of the module implementing this virtual table. - - - - - The index within the array of strings provided to the - and - methods containing the - name of the database containing this virtual table. - - - - - The index within the array of strings provided to the - and - methods containing the - name of the virtual table. - - - - - Constructs an instance of this class. - - - The original array of strings provided to the - and - methods. - - - - - This method should normally be used by the - method in order to - perform index selection based on the constraints provided by the - SQLite core library. - - - The object instance containing all the - data for the inputs and outputs relating to index selection. - - - Non-zero upon success. - - - - - Attempts to record the renaming of the virtual table associated - with this object instance. - - - The new name for the virtual table. - - - Non-zero upon success. - - - - - Disposes of this object instance. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is being called - from the finalizer. - - - - - Finalizes this object instance. - - - - - The original array of strings provided to the - and - methods. - - - - - The name of the module implementing this virtual table. - - - - - The name of the database containing this virtual table. - - - - - The name of the virtual table. - - - - - The object instance containing all the - data for the inputs and outputs relating to the most recent index - selection. - - - - - Returns the underlying SQLite native handle associated with this - object instance. - - - - - This class represents a managed virtual table cursor implementation. - It is not sealed and should be used as the base class for any - user-defined virtual table cursor classes implemented in managed code. - - - - - This value represents an invalid integer row sequence number. - - - - - The field holds the integer row sequence number for the current row - pointed to by this cursor object instance. - - - - - Constructs an instance of this class. - - - The object instance associated - with this object instance. - - - - - Constructs an instance of this class. - - - - - Attempts to persist the specified object - instances in order to make them available after the - method returns. - - - The array of object instances to be - persisted. - - - The number of object instances that were - successfully persisted. - - - - - This method should normally be used by the - method in order to - perform filtering of the result rows and/or to record the filtering - criteria provided by the SQLite core library. - - - Number used to help identify the selected index. - - - String used to help identify the selected index. - - - The values corresponding to each column in the selected index. - - - - - Determines the integer row sequence number for the current row. - - - The integer row sequence number for the current row -OR- zero if - it cannot be determined. - - - - - Adjusts the integer row sequence number so that it refers to the - next row. - - - - - Disposes of this object instance. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is being called - from the finalizer. - - - - - Finalizes this object instance. - - - - - The object instance associated - with this object instance. - - - - - Number used to help identify the selected index. This value will - be set via the method. - - - - - String used to help identify the selected index. This value will - be set via the method. - - - - - The values used to filter the rows returned via this cursor object - instance. This value will be set via the - method. - - - - - Returns the underlying SQLite native handle associated with this - object instance. - - - - - This interface represents a virtual table implementation written in - native code. - - - - - - This method is called to create a new instance of a virtual table - in response to a CREATE VIRTUAL TABLE statement. The db parameter - is a pointer to the SQLite database connection that is executing - the CREATE VIRTUAL TABLE statement. The pAux argument is the copy - of the client data pointer that was the fourth argument to the - sqlite3_create_module() or sqlite3_create_module_v2() call that - registered the virtual table module. The argv parameter is an - array of argc pointers to null terminated strings. The first - string, argv[0], is the name of the module being invoked. The - module name is the name provided as the second argument to - sqlite3_create_module() and as the argument to the USING clause of - the CREATE VIRTUAL TABLE statement that is running. The second, - argv[1], is the name of the database in which the new virtual table - is being created. The database name is "main" for the primary - database, or "temp" for TEMP database, or the name given at the - end of the ATTACH statement for attached databases. The third - element of the array, argv[2], is the name of the new virtual - table, as specified following the TABLE keyword in the CREATE - VIRTUAL TABLE statement. If present, the fourth and subsequent - strings in the argv[] array report the arguments to the module name - in the CREATE VIRTUAL TABLE statement. - - - The job of this method is to construct the new virtual table object - (an sqlite3_vtab object) and return a pointer to it in *ppVTab. - - - As part of the task of creating a new sqlite3_vtab structure, this - method must invoke sqlite3_declare_vtab() to tell the SQLite core - about the columns and datatypes in the virtual table. The - sqlite3_declare_vtab() API has the following prototype: - - - - int sqlite3_declare_vtab(sqlite3 *db, const char *zCreateTable) - - - - The first argument to sqlite3_declare_vtab() must be the same - database connection pointer as the first parameter to this method. - The second argument to sqlite3_declare_vtab() must a - zero-terminated UTF-8 string that contains a well-formed CREATE - TABLE statement that defines the columns in the virtual table and - their data types. The name of the table in this CREATE TABLE - statement is ignored, as are all constraints. Only the column names - and datatypes matter. The CREATE TABLE statement string need not to - be held in persistent memory. The string can be deallocated and/or - reused as soon as the sqlite3_declare_vtab() routine returns. - - - - The native database connection handle. - - - The original native pointer value that was provided to the - sqlite3_create_module(), sqlite3_create_module_v2() or - sqlite3_create_disposable_module() functions. - - - The number of arguments from the CREATE VIRTUAL TABLE statement. - - - The array of string arguments from the CREATE VIRTUAL TABLE - statement. - - - Upon success, this parameter must be modified to point to the newly - created native sqlite3_vtab derived structure. - - - Upon failure, this parameter must be modified to point to the error - message, with the underlying memory having been obtained from the - sqlite3_malloc() function. - - - A standard SQLite return code. - - - - - - The xConnect method is very similar to xCreate. It has the same - parameters and constructs a new sqlite3_vtab structure just like - xCreate. And it must also call sqlite3_declare_vtab() like xCreate. - - - The difference is that xConnect is called to establish a new - connection to an existing virtual table whereas xCreate is called - to create a new virtual table from scratch. - - - The xCreate and xConnect methods are only different when the - virtual table has some kind of backing store that must be - initialized the first time the virtual table is created. The - xCreate method creates and initializes the backing store. The - xConnect method just connects to an existing backing store. - - - As an example, consider a virtual table implementation that - provides read-only access to existing comma-separated-value (CSV) - files on disk. There is no backing store that needs to be created - or initialized for such a virtual table (since the CSV files - already exist on disk) so the xCreate and xConnect methods will be - identical for that module. - - - Another example is a virtual table that implements a full-text - index. The xCreate method must create and initialize data - structures to hold the dictionary and posting lists for that index. - The xConnect method, on the other hand, only has to locate and use - an existing dictionary and posting lists that were created by a - prior xCreate call. - - - The xConnect method must return SQLITE_OK if it is successful in - creating the new virtual table, or SQLITE_ERROR if it is not - successful. If not successful, the sqlite3_vtab structure must not - be allocated. An error message may optionally be returned in *pzErr - if unsuccessful. Space to hold the error message string must be - allocated using an SQLite memory allocation function like - sqlite3_malloc() or sqlite3_mprintf() as the SQLite core will - attempt to free the space using sqlite3_free() after the error has - been reported up to the application. - - - The xConnect method is required for every virtual table - implementation, though the xCreate and xConnect pointers of the - sqlite3_module object may point to the same function the virtual - table does not need to initialize backing store. - - - - The native database connection handle. - - - The original native pointer value that was provided to the - sqlite3_create_module(), sqlite3_create_module_v2() or - sqlite3_create_disposable_module() functions. - - - The number of arguments from the CREATE VIRTUAL TABLE statement. - - - The array of string arguments from the CREATE VIRTUAL TABLE - statement. - - - Upon success, this parameter must be modified to point to the newly - created native sqlite3_vtab derived structure. - - - Upon failure, this parameter must be modified to point to the error - message, with the underlying memory having been obtained from the - sqlite3_malloc() function. - - - A standard SQLite return code. - - - - - - SQLite uses the xBestIndex method of a virtual table module to - determine the best way to access the virtual table. The xBestIndex - method has a prototype like this: - - - int (*xBestIndex)(sqlite3_vtab *pVTab, sqlite3_index_info*); - - - The SQLite core communicates with the xBestIndex method by filling - in certain fields of the sqlite3_index_info structure and passing a - pointer to that structure into xBestIndex as the second parameter. - The xBestIndex method fills out other fields of this structure - which forms the reply. The sqlite3_index_info structure looks like - this: - - - struct sqlite3_index_info { - /* Inputs */ - const int nConstraint; /* Number of entries in aConstraint */ - const struct sqlite3_index_constraint { - int iColumn; /* Column on left-hand side of - * constraint */ - unsigned char op; /* Constraint operator */ - unsigned char usable; /* True if this constraint is usable */ - int iTermOffset; /* Used internally - xBestIndex should - * ignore */ - } *const aConstraint; /* Table of WHERE clause constraints */ - const int nOrderBy; /* Number of terms in the ORDER BY - * clause */ - const struct sqlite3_index_orderby { - int iColumn; /* Column number */ - unsigned char desc; /* True for DESC. False for ASC. */ - } *const aOrderBy; /* The ORDER BY clause */ - /* Outputs */ - struct sqlite3_index_constraint_usage { - int argvIndex; /* if greater than zero, constraint is - * part of argv to xFilter */ - unsigned char omit; /* Do not code a test for this - * constraint */ - } *const aConstraintUsage; - int idxNum; /* Number used to identify the index */ - char *idxStr; /* String, possibly obtained from - * sqlite3_malloc() */ - int needToFreeIdxStr; /* Free idxStr using sqlite3_free() if - * true */ - int orderByConsumed; /* True if output is already ordered */ - double estimatedCost; /* Estimated cost of using this index */ - }; - - - In addition, there are some defined constants: - - - #define SQLITE_INDEX_CONSTRAINT_EQ 2 - #define SQLITE_INDEX_CONSTRAINT_GT 4 - #define SQLITE_INDEX_CONSTRAINT_LE 8 - #define SQLITE_INDEX_CONSTRAINT_LT 16 - #define SQLITE_INDEX_CONSTRAINT_GE 32 - #define SQLITE_INDEX_CONSTRAINT_MATCH 64 - - - The SQLite core calls the xBestIndex method when it is compiling a - query that involves a virtual table. In other words, SQLite calls - this method when it is running sqlite3_prepare() or the equivalent. - By calling this method, the SQLite core is saying to the virtual - table that it needs to access some subset of the rows in the - virtual table and it wants to know the most efficient way to do - that access. The xBestIndex method replies with information that - the SQLite core can then use to conduct an efficient search of the - virtual table. - - - While compiling a single SQL query, the SQLite core might call - xBestIndex multiple times with different settings in - sqlite3_index_info. The SQLite core will then select the - combination that appears to give the best performance. - - - Before calling this method, the SQLite core initializes an instance - of the sqlite3_index_info structure with information about the - query that it is currently trying to process. This information - derives mainly from the WHERE clause and ORDER BY or GROUP BY - clauses of the query, but also from any ON or USING clauses if the - query is a join. The information that the SQLite core provides to - the xBestIndex method is held in the part of the structure that is - marked as "Inputs". The "Outputs" section is initialized to zero. - - - The information in the sqlite3_index_info structure is ephemeral - and may be overwritten or deallocated as soon as the xBestIndex - method returns. If the xBestIndex method needs to remember any part - of the sqlite3_index_info structure, it should make a copy. Care - must be take to store the copy in a place where it will be - deallocated, such as in the idxStr field with needToFreeIdxStr set - to 1. - - - Note that xBestIndex will always be called before xFilter, since - the idxNum and idxStr outputs from xBestIndex are required inputs - to xFilter. However, there is no guarantee that xFilter will be - called following a successful xBestIndex. - - - The xBestIndex method is required for every virtual table - implementation. - - - 2.3.1 Inputs - - - The main thing that the SQLite core is trying to communicate to the - virtual table is the constraints that are available to limit the - number of rows that need to be searched. The aConstraint[] array - contains one entry for each constraint. There will be exactly - nConstraint entries in that array. - - - Each constraint will correspond to a term in the WHERE clause or in - a USING or ON clause that is of the form - - - column OP EXPR - - - Where "column" is a column in the virtual table, OP is an operator - like "=" or "<", and EXPR is an arbitrary expression. So, for - example, if the WHERE clause contained a term like this: - - - a = 5 - - - Then one of the constraints would be on the "a" column with - operator "=" and an expression of "5". Constraints need not have a - literal representation of the WHERE clause. The query optimizer - might make transformations to the WHERE clause in order to extract - as many constraints as it can. So, for example, if the WHERE clause - contained something like this: - - - x BETWEEN 10 AND 100 AND 999>y - - - The query optimizer might translate this into three separate - constraints: - - - x >= 10 - x <= 100 - y < 999 - - - For each constraint, the aConstraint[].iColumn field indicates - which column appears on the left-hand side of the constraint. The - first column of the virtual table is column 0. The rowid of the - virtual table is column -1. The aConstraint[].op field indicates - which operator is used. The SQLITE_INDEX_CONSTRAINT_* constants map - integer constants into operator values. Columns occur in the order - they were defined by the call to sqlite3_declare_vtab() in the - xCreate or xConnect method. Hidden columns are counted when - determining the column index. - - - The aConstraint[] array contains information about all constraints - that apply to the virtual table. But some of the constraints might - not be usable because of the way tables are ordered in a join. The - xBestIndex method must therefore only consider constraints that - have an aConstraint[].usable flag which is true. - - - In addition to WHERE clause constraints, the SQLite core also tells - the xBestIndex method about the ORDER BY clause. (In an aggregate - query, the SQLite core might put in GROUP BY clause information in - place of the ORDER BY clause information, but this fact should not - make any difference to the xBestIndex method.) If all terms of the - ORDER BY clause are columns in the virtual table, then nOrderBy - will be the number of terms in the ORDER BY clause and the - aOrderBy[] array will identify the column for each term in the - order by clause and whether or not that column is ASC or DESC. - - - 2.3.2 Outputs - - - Given all of the information above, the job of the xBestIndex - method it to figure out the best way to search the virtual table. - - - The xBestIndex method fills the idxNum and idxStr fields with - information that communicates an indexing strategy to the xFilter - method. The information in idxNum and idxStr is arbitrary as far as - the SQLite core is concerned. The SQLite core just copies the - information through to the xFilter method. Any desired meaning can - be assigned to idxNum and idxStr as long as xBestIndex and xFilter - agree on what that meaning is. - - - The idxStr value may be a string obtained from an SQLite memory - allocation function such as sqlite3_mprintf(). If this is the case, - then the needToFreeIdxStr flag must be set to true so that the - SQLite core will know to call sqlite3_free() on that string when it - has finished with it, and thus avoid a memory leak. - - - If the virtual table will output rows in the order specified by the - ORDER BY clause, then the orderByConsumed flag may be set to true. - If the output is not automatically in the correct order then - orderByConsumed must be left in its default false setting. This - will indicate to the SQLite core that it will need to do a separate - sorting pass over the data after it comes out of the virtual table. - - - The estimatedCost field should be set to the estimated number of - disk access operations required to execute this query against the - virtual table. The SQLite core will often call xBestIndex multiple - times with different constraints, obtain multiple cost estimates, - then choose the query plan that gives the lowest estimate. - - - The aConstraintUsage[] array contains one element for each of the - nConstraint constraints in the inputs section of the - sqlite3_index_info structure. The aConstraintUsage[] array is used - by xBestIndex to tell the core how it is using the constraints. - - - The xBestIndex method may set aConstraintUsage[].argvIndex entries - to values greater than one. Exactly one entry should be set to 1, - another to 2, another to 3, and so forth up to as many or as few as - the xBestIndex method wants. The EXPR of the corresponding - constraints will then be passed in as the argv[] parameters to - xFilter. - - - For example, if the aConstraint[3].argvIndex is set to 1, then when - xFilter is called, the argv[0] passed to xFilter will have the EXPR - value of the aConstraint[3] constraint. - - - By default, the SQLite core double checks all constraints on each - row of the virtual table that it receives. If such a check is - redundant, the xBestFilter method can suppress that double-check by - setting aConstraintUsage[].omit. - - - - The native pointer to the sqlite3_vtab derived structure. - - - The native pointer to the sqlite3_index_info structure. - - - A standard SQLite return code. - - - - - - This method releases a connection to a virtual table. Only the - sqlite3_vtab object is destroyed. The virtual table is not - destroyed and any backing store associated with the virtual table - persists. This method undoes the work of xConnect. - - - This method is a destructor for a connection to the virtual table. - Contrast this method with xDestroy. The xDestroy is a destructor - for the entire virtual table. - - - The xDisconnect method is required for every virtual table - implementation, though it is acceptable for the xDisconnect and - xDestroy methods to be the same function if that makes sense for - the particular virtual table. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - This method releases a connection to a virtual table, just like the - xDisconnect method, and it also destroys the underlying table - implementation. This method undoes the work of xCreate. - - - The xDisconnect method is called whenever a database connection - that uses a virtual table is closed. The xDestroy method is only - called when a DROP TABLE statement is executed against the virtual - table. - - - The xDestroy method is required for every virtual table - implementation, though it is acceptable for the xDisconnect and - xDestroy methods to be the same function if that makes sense for - the particular virtual table. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - The xOpen method creates a new cursor used for accessing (read - and/or writing) a virtual table. A successful invocation of this - method will allocate the memory for the sqlite3_vtab_cursor (or a - subclass), initialize the new object, and make *ppCursor point to - the new object. The successful call then returns SQLITE_OK. - - - For every successful call to this method, the SQLite core will - later invoke the xClose method to destroy the allocated cursor. - - - The xOpen method need not initialize the pVtab field of the - sqlite3_vtab_cursor structure. The SQLite core will take care of - that chore automatically. - - - A virtual table implementation must be able to support an arbitrary - number of simultaneously open cursors. - - - When initially opened, the cursor is in an undefined state. The - SQLite core will invoke the xFilter method on the cursor prior to - any attempt to position or read from the cursor. - - - The xOpen method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab derived structure. - - - Upon success, this parameter must be modified to point to the newly - created native sqlite3_vtab_cursor derived structure. - - - A standard SQLite return code. - - - - - - The xClose method closes a cursor previously opened by xOpen. The - SQLite core will always call xClose once for each cursor opened - using xOpen. - - - This method must release all resources allocated by the - corresponding xOpen call. The routine will not be called again even - if it returns an error. The SQLite core will not use the - sqlite3_vtab_cursor again after it has been closed. - - - The xClose method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - A standard SQLite return code. - - - - - - This method begins a search of a virtual table. The first argument - is a cursor opened by xOpen. The next two argument define a - particular search index previously chosen by xBestIndex. The - specific meanings of idxNum and idxStr are unimportant as long as - xFilter and xBestIndex agree on what that meaning is. - - - The xBestIndex function may have requested the values of certain - expressions using the aConstraintUsage[].argvIndex values of the - sqlite3_index_info structure. Those values are passed to xFilter - using the argc and argv parameters. - - - If the virtual table contains one or more rows that match the - search criteria, then the cursor must be left point at the first - row. Subsequent calls to xEof must return false (zero). If there - are no rows match, then the cursor must be left in a state that - will cause the xEof to return true (non-zero). The SQLite engine - will use the xColumn and xRowid methods to access that row content. - The xNext method will be used to advance to the next row. - - - This method must return SQLITE_OK if successful, or an sqlite error - code if an error occurs. - - - The xFilter method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - Number used to help identify the selected index. - - - The native pointer to the UTF-8 encoded string containing the - string used to help identify the selected index. - - - The number of native pointers to sqlite3_value structures specified - in . - - - An array of native pointers to sqlite3_value structures containing - filtering criteria for the selected index. - - - A standard SQLite return code. - - - - - - The xNext method advances a virtual table cursor to the next row of - a result set initiated by xFilter. If the cursor is already - pointing at the last row when this routine is called, then the - cursor no longer points to valid data and a subsequent call to the - xEof method must return true (non-zero). If the cursor is - successfully advanced to another row of content, then subsequent - calls to xEof must return false (zero). - - - This method must return SQLITE_OK if successful, or an sqlite error - code if an error occurs. - - - The xNext method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - A standard SQLite return code. - - - - - - The xEof method must return false (zero) if the specified cursor - currently points to a valid row of data, or true (non-zero) - otherwise. This method is called by the SQL engine immediately - after each xFilter and xNext invocation. - - - The xEof method is required for every virtual table implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - Non-zero if no more rows are available; zero otherwise. - - - - - - The SQLite core invokes this method in order to find the value for - the N-th column of the current row. N is zero-based so the first - column is numbered 0. The xColumn method may return its result back - to SQLite using one of the following interface: - - - sqlite3_result_blob() - sqlite3_result_double() - sqlite3_result_int() - sqlite3_result_int64() - sqlite3_result_null() - sqlite3_result_text() - sqlite3_result_text16() - sqlite3_result_text16le() - sqlite3_result_text16be() - sqlite3_result_zeroblob() - - - If the xColumn method implementation calls none of the functions - above, then the value of the column defaults to an SQL NULL. - - - To raise an error, the xColumn method should use one of the - result_text() methods to set the error message text, then return an - appropriate error code. The xColumn method must return SQLITE_OK on - success. - - - The xColumn method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - The native pointer to the sqlite3_context structure to be used - for returning the specified column value to the SQLite core - library. - - - The zero-based index corresponding to the column containing the - value to be returned. - - - A standard SQLite return code. - - - - - - A successful invocation of this method will cause *pRowid to be - filled with the rowid of row that the virtual table cursor pCur is - currently pointing at. This method returns SQLITE_OK on success. It - returns an appropriate error code on failure. - - - The xRowid method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the current row for the specified cursor. - - - A standard SQLite return code. - - - - - - All changes to a virtual table are made using the xUpdate method. - This one method can be used to insert, delete, or update. - - - The argc parameter specifies the number of entries in the argv - array. The value of argc will be 1 for a pure delete operation or - N+2 for an insert or replace or update where N is the number of - columns in the table. In the previous sentence, N includes any - hidden columns. - - - Every argv entry will have a non-NULL value in C but may contain - the SQL value NULL. In other words, it is always true that - argv[i]!=0 for i between 0 and argc-1. However, it might be the - case that sqlite3_value_type(argv[i])==SQLITE_NULL. - - - The argv[0] parameter is the rowid of a row in the virtual table - to be deleted. If argv[0] is an SQL NULL, then no deletion occurs. - - - The argv[1] parameter is the rowid of a new row to be inserted into - the virtual table. If argv[1] is an SQL NULL, then the - implementation must choose a rowid for the newly inserted row. - Subsequent argv[] entries contain values of the columns of the - virtual table, in the order that the columns were declared. The - number of columns will match the table declaration that the - xConnect or xCreate method made using the sqlite3_declare_vtab() - call. All hidden columns are included. - - - When doing an insert without a rowid (argc>1, argv[1] is an SQL - NULL), the implementation must set *pRowid to the rowid of the - newly inserted row; this will become the value returned by the - sqlite3_last_insert_rowid() function. Setting this value in all the - other cases is a harmless no-op; the SQLite engine ignores the - *pRowid return value if argc==1 or argv[1] is not an SQL NULL. - - - Each call to xUpdate will fall into one of cases shown below. Note - that references to argv[i] mean the SQL value held within the - argv[i] object, not the argv[i] object itself. - - - argc = 1 - - - The single row with rowid equal to argv[0] is deleted. No - insert occurs. - - - argc > 1 - argv[0] = NULL - - - A new row is inserted with a rowid argv[1] and column - values in argv[2] and following. If argv[1] is an SQL NULL, - the a new unique rowid is generated automatically. - - - argc > 1 - argv[0] ? NULL - argv[0] = argv[1] - - - The row with rowid argv[0] is updated with new values in - argv[2] and following parameters. - - - argc > 1 - argv[0] ? NULL - argv[0] ? argv[1] - - - The row with rowid argv[0] is updated with rowid argv[1] - and new values in argv[2] and following parameters. This - will occur when an SQL statement updates a rowid, as in - the statement: - - - UPDATE table SET rowid=rowid+1 WHERE ...; - - - The xUpdate method must return SQLITE_OK if and only if it is - successful. If a failure occurs, the xUpdate must return an - appropriate error code. On a failure, the pVTab->zErrMsg element - may optionally be replaced with error message text stored in memory - allocated from SQLite using functions such as sqlite3_mprintf() or - sqlite3_malloc(). - - - If the xUpdate method violates some constraint of the virtual table - (including, but not limited to, attempting to store a value of the - wrong datatype, attempting to store a value that is too large or - too small, or attempting to change a read-only value) then the - xUpdate must fail with an appropriate error code. - - - There might be one or more sqlite3_vtab_cursor objects open and in - use on the virtual table instance and perhaps even on the row of - the virtual table when the xUpdate method is invoked. The - implementation of xUpdate must be prepared for attempts to delete - or modify rows of the table out from other existing cursors. If the - virtual table cannot accommodate such changes, the xUpdate method - must return an error code. - - - The xUpdate method is optional. If the xUpdate pointer in the - sqlite3_module for a virtual table is a NULL pointer, then the - virtual table is read-only. - - - - The native pointer to the sqlite3_vtab derived structure. - - - The number of new or modified column values contained in - . - - - The array of native pointers to sqlite3_value structures containing - the new or modified column values, if any. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the row that was inserted, if any. - - - A standard SQLite return code. - - - - - - This method begins a transaction on a virtual table. This is method - is optional. The xBegin pointer of sqlite3_module may be NULL. - - - This method is always followed by one call to either the xCommit or - xRollback method. Virtual table transactions do not nest, so the - xBegin method will not be invoked more than once on a single - virtual table without an intervening call to either xCommit or - xRollback. Multiple calls to other methods can and likely will - occur in between the xBegin and the corresponding xCommit or - xRollback. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - This method signals the start of a two-phase commit on a virtual - table. This is method is optional. The xSync pointer of - sqlite3_module may be NULL. - - - This method is only invoked after call to the xBegin method and - prior to an xCommit or xRollback. In order to implement two-phase - commit, the xSync method on all virtual tables is invoked prior to - invoking the xCommit method on any virtual table. If any of the - xSync methods fail, the entire transaction is rolled back. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - This method causes a virtual table transaction to commit. This is - method is optional. The xCommit pointer of sqlite3_module may be - NULL. - - - A call to this method always follows a prior call to xBegin and - xSync. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - This method causes a virtual table transaction to rollback. This is - method is optional. The xRollback pointer of sqlite3_module may be - NULL. - - - A call to this method always follows a prior call to xBegin. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - This method provides notification that the virtual table - implementation that the virtual table will be given a new name. If - this method returns SQLITE_OK then SQLite renames the table. If - this method returns an error code then the renaming is prevented. - - - The xRename method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab derived structure. - - - The number of arguments to the function being sought. - - - The name of the function being sought. - - - Upon success, this parameter must be modified to contain the - delegate responsible for implementing the specified function. - - - Upon success, this parameter must be modified to contain the - native user-data pointer associated with - . - - - Non-zero if the specified function was found; zero otherwise. - - - - - - This method provides notification that the virtual table - implementation that the virtual table will be given a new name. If - this method returns SQLITE_OK then SQLite renames the table. If - this method returns an error code then the renaming is prevented. - - - The xRename method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab derived structure. - - - The native pointer to the UTF-8 encoded string containing the new - name for the virtual table. - - - A standard SQLite return code. - - - - - - These methods provide the virtual table implementation an - opportunity to implement nested transactions. They are always - optional and will only be called in SQLite version 3.7.7 and later. - - - When xSavepoint(X,N) is invoked, that is a signal to the virtual - table X that it should save its current state as savepoint N. A - subsequent call to xRollbackTo(X,R) means that the state of the - virtual table should return to what it was when xSavepoint(X,R) was - last called. The call to xRollbackTo(X,R) will invalidate all - savepoints with N>R; none of the invalided savepoints will be - rolled back or released without first being reinitialized by a call - to xSavepoint(). A call to xRelease(X,M) invalidates all savepoints - where N>=M. - - - None of the xSavepoint(), xRelease(), or xRollbackTo() methods will - ever be called except in between calls to xBegin() and either - xCommit() or xRollback(). - - - - The native pointer to the sqlite3_vtab derived structure. - - - This is an integer identifier under which the the current state of - the virtual table should be saved. - - - A standard SQLite return code. - - - - - - These methods provide the virtual table implementation an - opportunity to implement nested transactions. They are always - optional and will only be called in SQLite version 3.7.7 and later. - - - When xSavepoint(X,N) is invoked, that is a signal to the virtual - table X that it should save its current state as savepoint N. A - subsequent call to xRollbackTo(X,R) means that the state of the - virtual table should return to what it was when xSavepoint(X,R) was - last called. The call to xRollbackTo(X,R) will invalidate all - savepoints with N>R; none of the invalided savepoints will be - rolled back or released without first being reinitialized by a call - to xSavepoint(). A call to xRelease(X,M) invalidates all savepoints - where N>=M. - - - None of the xSavepoint(), xRelease(), or xRollbackTo() methods will - ever be called except in between calls to xBegin() and either - xCommit() or xRollback(). - - - - The native pointer to the sqlite3_vtab derived structure. - - - This is an integer used to indicate that any saved states with an - identifier greater than or equal to this should be deleted by the - virtual table. - - - A standard SQLite return code. - - - - - - These methods provide the virtual table implementation an - opportunity to implement nested transactions. They are always - optional and will only be called in SQLite version 3.7.7 and later. - - - When xSavepoint(X,N) is invoked, that is a signal to the virtual - table X that it should save its current state as savepoint N. A - subsequent call to xRollbackTo(X,R) means that the state of the - virtual table should return to what it was when xSavepoint(X,R) was - last called. The call to xRollbackTo(X,R) will invalidate all - savepoints with N>R; none of the invalided savepoints will be - rolled back or released without first being reinitialized by a call - to xSavepoint(). A call to xRelease(X,M) invalidates all savepoints - where N>=M. - - - None of the xSavepoint(), xRelease(), or xRollbackTo() methods will - ever be called except in between calls to xBegin() and either - xCommit() or xRollback(). - - - - The native pointer to the sqlite3_vtab derived structure. - - - This is an integer identifier used to specify a specific saved - state for the virtual table for it to restore itself back to, which - should also have the effect of deleting all saved states with an - integer identifier greater than this one. - - - A standard SQLite return code. - - - - - This interface represents a virtual table implementation written in - managed code. - - - - - This method is called in response to the - method. - - - The object instance associated with - the virtual table. - - - The native user-data pointer associated with this module, as it was - provided to the SQLite core library when the native module instance - was created. - - - The module name, database name, virtual table name, and all other - arguments passed to the CREATE VIRTUAL TABLE statement. - - - Upon success, this parameter must be modified to contain the - object instance associated with - the virtual table. - - - Upon failure, this parameter must be modified to contain an error - message. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated with - the virtual table. - - - The native user-data pointer associated with this module, as it was - provided to the SQLite core library when the native module instance - was created. - - - The module name, database name, virtual table name, and all other - arguments passed to the CREATE VIRTUAL TABLE statement. - - - Upon success, this parameter must be modified to contain the - object instance associated with - the virtual table. - - - Upon failure, this parameter must be modified to contain an error - message. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The object instance containing all the - data for the inputs and outputs relating to index selection. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - Upon success, this parameter must be modified to contain the - object instance associated - with the newly opened virtual table cursor. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Number used to help identify the selected index. - - - String used to help identify the selected index. - - - The values corresponding to each column in the selected index. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Non-zero if no more rows are available; zero otherwise. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - The object instance to be used for - returning the specified column value to the SQLite core library. - - - The zero-based index corresponding to the column containing the - value to be returned. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the current row for the specified cursor. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The array of object instances containing - the new or modified column values, if any. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the row that was inserted, if any. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The number of arguments to the function being sought. - - - The name of the function being sought. - - - Upon success, this parameter must be modified to contain the - object instance responsible for - implementing the specified function. - - - Upon success, this parameter must be modified to contain the - native user-data pointer associated with - . - - - Non-zero if the specified function was found; zero otherwise. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The new name for the virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer identifier under which the the current state of - the virtual table should be saved. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer used to indicate that any saved states with an - identifier greater than or equal to this should be deleted by the - virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer identifier used to specify a specific saved - state for the virtual table for it to restore itself back to, which - should also have the effect of deleting all saved states with an - integer identifier greater than this one. - - - A standard SQLite return code. - - - - - Returns non-zero if the schema for the virtual table has been - declared. - - - - - Returns the name of the module as it was registered with the SQLite - core library. - - - - - This class contains static methods that are used to allocate, - manipulate, and free native memory provided by the SQLite core library. - - - - - Allocates at least the specified number of bytes of native memory - via the SQLite core library sqlite3_malloc() function and returns - the resulting native pointer. - - - The number of bytes to allocate. - - - The native pointer that points to a block of memory of at least the - specified size -OR- if the memory could - not be allocated. - - - - - Gets and returns the actual size of the specified memory block that - was previously obtained from the method. - - - The native pointer to the memory block previously obtained from the - method. - - - The actual size, in bytes, of the memory block specified via the - native pointer. - - - - - Frees a memory block previously obtained from the - method. - - - The native pointer to the memory block previously obtained from the - method. - - - - - This class contains static methods that are used to deal with native - UTF-8 string pointers to be used with the SQLite core library. - - - - - This is the maximum possible length for the native UTF-8 encoded - strings used with the SQLite core library. - - - - - This is the object instance used to handle - conversions from/to UTF-8. - - - - - Converts the specified managed string into the UTF-8 encoding and - returns the array of bytes containing its representation in that - encoding. - - - The managed string to convert. - - - The array of bytes containing the representation of the managed - string in the UTF-8 encoding or null upon failure. - - - - - Converts the specified array of bytes representing a string in the - UTF-8 encoding and returns a managed string. - - - The array of bytes to convert. - - - The managed string or null upon failure. - - - - - Probes a native pointer to a string in the UTF-8 encoding for its - terminating NUL character, within the specified length limit. - - - The native NUL-terminated string pointer. - - - The maximum length of the native string, in bytes. - - - The length of the native string, in bytes -OR- zero if the length - could not be determined. - - - - - Converts the specified native NUL-terminated UTF-8 string pointer - into a managed string. - - - The native NUL-terminated UTF-8 string pointer. - - - The managed string or null upon failure. - - - - - Converts the specified native UTF-8 string pointer of the specified - length into a managed string. - - - The native UTF-8 string pointer. - - - The length of the native string, in bytes. - - - The managed string or null upon failure. - - - - - Converts the specified managed string into a native NUL-terminated - UTF-8 string pointer using memory obtained from the SQLite core - library. - - - The managed string to convert. - - - The native NUL-terminated UTF-8 string pointer or - upon failure. - - - - - Converts a logical array of native NUL-terminated UTF-8 string - pointers into an array of managed strings. - - - The number of elements in the logical array of native - NUL-terminated UTF-8 string pointers. - - - The native pointer to the logical array of native NUL-terminated - UTF-8 string pointers to convert. - - - The array of managed strings or null upon failure. - - - - - Converts an array of managed strings into an array of native - NUL-terminated UTF-8 string pointers. - - - The array of managed strings to convert. - - - The array of native NUL-terminated UTF-8 string pointers or null - upon failure. - - - - - This class contains static methods that are used to deal with native - pointers to memory blocks that logically contain arrays of bytes to be - used with the SQLite core library. - - - - - Converts a native pointer to a logical array of bytes of the - specified length into a managed byte array. - - - The native pointer to the logical array of bytes to convert. - - - The length, in bytes, of the logical array of bytes to convert. - - - The managed byte array or null upon failure. - - - - - Converts a managed byte array into a native pointer to a logical - array of bytes. - - - The managed byte array to convert. - - - The native pointer to a logical byte array or null upon failure. - - - - - This class contains static methods that are used to perform several - low-level data marshalling tasks between native and managed code. - - - - - Returns a new object instance based on the - specified object instance and an integer - offset. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location that the new - object instance should point to. - - - The new object instance. - - - - - Rounds up an integer size to the next multiple of the alignment. - - - The size, in bytes, to be rounded up. - - - The required alignment for the return value. - - - The size, in bytes, rounded up to the next multiple of the - alignment. This value may end up being the same as the original - size. - - - - - Determines the offset, in bytes, of the next structure member. - - - The offset, in bytes, of the current structure member. - - - The size, in bytes, of the current structure member. - - - The alignment, in bytes, of the next structure member. - - - The offset, in bytes, of the next structure member. - - - - - Reads a value from the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be read is located. - - - The value at the specified memory location. - - - - - Reads a value from the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - to be read is located. - - - The value at the specified memory location. - - - - - Reads an value from the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be read is located. - - - The value at the specified memory location. - - - - - Writes an value to the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be written is located. - - - The value to write. - - - - - Writes an value to the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be written is located. - - - The value to write. - - - - - Writes a value to the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be written is located. - - - The value to write. - - - - - Writes a value to the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be written is located. - - - The value to write. - - - - - Generates a hash code value for the object. - - - The object instance used to calculate the hash code. - - - Non-zero if different object instances with the same value should - generate different hash codes, where applicable. This parameter - has no effect on the .NET Compact Framework. - - - The hash code value -OR- zero if the object is null. - - - - - This class represents a managed virtual table module implementation. - It is not sealed and must be used as the base class for any - user-defined virtual table module classes implemented in managed code. - - - - - The default version of the native sqlite3_module structure in use. - - - - - This field is used to store the native sqlite3_module structure - associated with this object instance. - - - - - This field is used to store the destructor delegate to be passed to - the SQLite core library via the sqlite3_create_disposable_module() - function. - - - - - This field is used to store a pointer to the native sqlite3_module - structure returned by the sqlite3_create_disposable_module - function. - - - - - This field is used to store the virtual table instances associated - with this module. The native pointer to the sqlite3_vtab derived - structure is used to key into this collection. - - - - - This field is used to store the virtual table cursor instances - associated with this module. The native pointer to the - sqlite3_vtab_cursor derived structure is used to key into this - collection. - - - - - This field is used to store the virtual table function instances - associated with this module. The case-insensitive function name - and the number of arguments (with -1 meaning "any") are used to - construct the string that is used to key into this collection. - - - - - Constructs an instance of this class. - - - The name of the module. This parameter cannot be null. - - - - - Calls the native SQLite core library in order to create a new - disposable module containing the implementation of a virtual table. - - - The native database connection pointer to use. - - - Non-zero upon success. - - - - - This method is called by the SQLite core library when the native - module associated with this object instance is being destroyed due - to its parent connection being closed. It may also be called by - the "vtshim" module if/when the sqlite3_dispose_module() function - is called. - - - The native user-data pointer associated with this module, as it was - provided to the SQLite core library when the native module instance - was created. - - - - - Creates and returns the native sqlite_module structure using the - configured (or default) - interface implementation. - - - The native sqlite_module structure using the configured (or - default) interface - implementation. - - - - - Creates and returns the native sqlite_module structure using the - specified interface - implementation. - - - The interface implementation to - use. - - - The native sqlite_module structure using the specified - interface implementation. - - - - - Creates a copy of the specified - object instance, - using default implementations for the contained delegates when - necessary. - - - The object - instance to copy. - - - The new object - instance. - - - - - Calls one of the virtual table initialization methods. - - - Non-zero to call the - method; otherwise, the - method will be called. - - - The native database connection handle. - - - The original native pointer value that was provided to the - sqlite3_create_module(), sqlite3_create_module_v2() or - sqlite3_create_disposable_module() functions. - - - The number of arguments from the CREATE VIRTUAL TABLE statement. - - - The array of string arguments from the CREATE VIRTUAL TABLE - statement. - - - Upon success, this parameter must be modified to point to the newly - created native sqlite3_vtab derived structure. - - - Upon failure, this parameter must be modified to point to the error - message, with the underlying memory having been obtained from the - sqlite3_malloc() function. - - - A standard SQLite return code. - - - - - Calls one of the virtual table finalization methods. - - - Non-zero to call the - method; otherwise, the - method will be - called. - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance to be used. - - - The native pointer to the sqlite3_vtab derived structure. - - - Non-zero if this error message should also be logged using the - class. - - - Non-zero if caught exceptions should be logged using the - class. - - - The error message. - - - Non-zero upon success. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance to be used. - - - The object instance used to - lookup the native pointer to the sqlite3_vtab derived structure. - - - Non-zero if this error message should also be logged using the - class. - - - Non-zero if caught exceptions should be logged using the - class. - - - The error message. - - - Non-zero upon success. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance to be used. - - - The native pointer to the sqlite3_vtab_cursor derived structure - used to get the native pointer to the sqlite3_vtab derived - structure. - - - Non-zero if this error message should also be logged using the - class. - - - Non-zero if caught exceptions should be logged using the - class. - - - The error message. - - - Non-zero upon success. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance to be used. - - - The object instance used to - lookup the native pointer to the sqlite3_vtab derived structure. - - - Non-zero if this error message should also be logged using the - class. - - - Non-zero if caught exceptions should be logged using the - class. - - - The error message. - - - Non-zero upon success. - - - - - Gets and returns the interface - implementation to be used when creating the native sqlite3_module - structure. Derived classes may override this method to supply an - alternate implementation for the - interface. - - - The interface implementation to - be used when populating the native sqlite3_module structure. If - the returned value is null, the private methods provided by the - class and relating to the - interface will be used to - create the necessary delegates. - - - - - Creates and returns the - interface implementation corresponding to the current - object instance. - - - The interface implementation - corresponding to the current object - instance. - - - - - Allocates a native sqlite3_vtab derived structure and returns a - native pointer to it. - - - A native pointer to a native sqlite3_vtab derived structure. - - - - - Zeros out the fields of a native sqlite3_vtab derived structure. - - - The native pointer to the native sqlite3_vtab derived structure to - zero. - - - - - Frees a native sqlite3_vtab structure using the provided native - pointer to it. - - - A native pointer to a native sqlite3_vtab derived structure. - - - - - Allocates a native sqlite3_vtab_cursor derived structure and - returns a native pointer to it. - - - A native pointer to a native sqlite3_vtab_cursor derived structure. - - - - - Frees a native sqlite3_vtab_cursor structure using the provided - native pointer to it. - - - A native pointer to a native sqlite3_vtab_cursor derived structure. - - - - - Reads and returns the native pointer to the sqlite3_vtab derived - structure based on the native pointer to the sqlite3_vtab_cursor - derived structure. - - - The object instance to be used. - - - The native pointer to the sqlite3_vtab_cursor derived structure - from which to read the native pointer to the sqlite3_vtab derived - structure. - - - The native pointer to the sqlite3_vtab derived structure -OR- - if it cannot be determined. - - - - - Reads and returns the native pointer to the sqlite3_vtab derived - structure based on the native pointer to the sqlite3_vtab_cursor - derived structure. - - - The native pointer to the sqlite3_vtab_cursor derived structure - from which to read the native pointer to the sqlite3_vtab derived - structure. - - - The native pointer to the sqlite3_vtab derived structure -OR- - if it cannot be determined. - - - - - Looks up and returns the object - instance based on the native pointer to the sqlite3_vtab derived - structure. - - - The native pointer to the sqlite3_vtab derived structure. - - - The object instance or null if - the corresponding one cannot be found. - - - - - Allocates and returns a native pointer to a sqlite3_vtab derived - structure and creates an association between it and the specified - object instance. - - - The object instance to be used - when creating the association. - - - The native pointer to a sqlite3_vtab derived structure or - if the method fails for any reason. - - - - - Looks up and returns the - object instance based on the native pointer to the - sqlite3_vtab_cursor derived structure. - - - The native pointer to the sqlite3_vtab derived structure. - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - The object instance or null - if the corresponding one cannot be found. - - - - - Allocates and returns a native pointer to a sqlite3_vtab_cursor - derived structure and creates an association between it and the - specified object instance. - - - The object instance to be - used when creating the association. - - - The native pointer to a sqlite3_vtab_cursor derived structure or - if the method fails for any reason. - - - - - Deterimines the key that should be used to identify and store the - object instance for the virtual table - (i.e. to be returned via the - method). - - - The number of arguments to the virtual table function. - - - The name of the virtual table function. - - - The object instance associated with - this virtual table function. - - - The string that should be used to identify and store the virtual - table function instance. This method cannot return null. If null - is returned from this method, the behavior is undefined. - - - - - Attempts to declare the schema for the virtual table using the - specified database connection. - - - The object instance to use when - declaring the schema of the virtual table. This parameter may not - be null. - - - The string containing the CREATE TABLE statement that completely - describes the schema for the virtual table. This parameter may not - be null. - - - Upon failure, this parameter must be modified to contain an error - message. - - - A standard SQLite return code. - - - - - Calls the native SQLite core library in order to declare a virtual - table function in response to a call into the - - or virtual table - methods. - - - The object instance to use when - declaring the schema of the virtual table. - - - The number of arguments to the function being declared. - - - The name of the function being declared. - - - Upon success, the contents of this parameter are undefined. Upon - failure, it should contain an appropriate error message. - - - A standard SQLite return code. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The native pointer to the sqlite3_vtab derived structure. - - - The error message. - - - Non-zero upon success. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance used to - lookup the native pointer to the sqlite3_vtab derived structure. - - - The error message. - - - Non-zero upon success. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance used to - lookup the native pointer to the sqlite3_vtab derived structure. - - - The error message. - - - Non-zero upon success. - - - - - Modifies the specified object instance - to contain the specified estimated cost. - - - The object instance to modify. - - - The estimated cost value to use. Using a null value means that the - default value provided by the SQLite core library should be used. - - - Non-zero upon success. - - - - - Modifies the specified object instance - to contain the default estimated cost. - - - The object instance to modify. - - - Non-zero upon success. - - - - - Modifies the specified object instance - to contain the specified estimated rows. - - - The object instance to modify. - - - The estimated rows value to use. Using a null value means that the - default value provided by the SQLite core library should be used. - - - Non-zero upon success. - - - - - Modifies the specified object instance - to contain the default estimated rows. - - - The object instance to modify. - - - Non-zero upon success. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - This method is called in response to the - method. - - - The object instance associated with - the virtual table. - - - The native user-data pointer associated with this module, as it was - provided to the SQLite core library when the native module instance - was created. - - - The module name, database name, virtual table name, and all other - arguments passed to the CREATE VIRTUAL TABLE statement. - - - Upon success, this parameter must be modified to contain the - object instance associated with - the virtual table. - - - Upon failure, this parameter must be modified to contain an error - message. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated with - the virtual table. - - - The native user-data pointer associated with this module, as it was - provided to the SQLite core library when the native module instance - was created. - - - The module name, database name, virtual table name, and all other - arguments passed to the CREATE VIRTUAL TABLE statement. - - - Upon success, this parameter must be modified to contain the - object instance associated with - the virtual table. - - - Upon failure, this parameter must be modified to contain an error - message. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The object instance containing all the - data for the inputs and outputs relating to index selection. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - Upon success, this parameter must be modified to contain the - object instance associated - with the newly opened virtual table cursor. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Number used to help identify the selected index. - - - String used to help identify the selected index. - - - The values corresponding to each column in the selected index. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Non-zero if no more rows are available; zero otherwise. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - The object instance to be used for - returning the specified column value to the SQLite core library. - - - The zero-based index corresponding to the column containing the - value to be returned. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the current row for the specified cursor. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The array of object instances containing - the new or modified column values, if any. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the row that was inserted, if any. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The number of arguments to the function being sought. - - - The name of the function being sought. - - - Upon success, this parameter must be modified to contain the - object instance responsible for - implementing the specified function. - - - Upon success, this parameter must be modified to contain the - native user-data pointer associated with - . - - - Non-zero if the specified function was found; zero otherwise. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The new name for the virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer identifier under which the the current state of - the virtual table should be saved. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer used to indicate that any saved states with an - identifier greater than or equal to this should be deleted by the - virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer identifier used to specify a specific saved - state for the virtual table for it to restore itself back to, which - should also have the effect of deleting all saved states with an - integer identifier greater than this one. - - - A standard SQLite return code. - - - - - Disposes of this object instance. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is being - called from the finalizer. - - - - - Finalizes this object instance. - - - - - Returns or sets a boolean value indicating whether virtual table - errors should be logged using the class. - - - - - Returns or sets a boolean value indicating whether exceptions - caught in the - method, - the method, - the method, - the method, - and the method should be logged using the - class. - - - - - Returns or sets a boolean value indicating whether virtual table - errors should be logged using the class. - - - - - Returns or sets a boolean value indicating whether exceptions - caught in the - method, - method, and the - method should be logged using the - class. - - - - - Returns non-zero if the schema for the virtual table has been - declared. - - - - - Returns the name of the module as it was registered with the SQLite - core library. - - - - - This class implements the - interface by forwarding those method calls to the - object instance it contains. If the - contained object instance is null, all - the methods simply generate an - error. - - - - - This is the value that is always used for the "logErrors" - parameter to the various static error handling methods provided - by the class. - - - - - This is the value that is always used for the "logExceptions" - parameter to the various static error handling methods provided - by the class. - - - - - This is the error message text used when the contained - object instance is not available - for any reason. - - - - - The object instance used to provide - an implementation of the - interface. - - - - - Constructs an instance of this class. - - - The object instance used to provide - an implementation of the - interface. - - - - - Sets the table error message to one that indicates the native - module implementation is not available. - - - The native pointer to the sqlite3_vtab derived structure. - - - The value of . - - - - - Sets the table error message to one that indicates the native - module implementation is not available. - - - The native pointer to the sqlite3_vtab_cursor derived - structure. - - - The value of . - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - Disposes of this object instance. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is being - called from the finalizer. - - - - - Finalizes this object instance. - - - - - This class represents a virtual table cursor to be used with the - class. It is not sealed and may - be used as the base class for any user-defined virtual table cursor - class that wraps an object instance. - - - - - The instance provided when this cursor - was created. - - - - - This value will be non-zero if false has been returned from the - method. - - - - - Constructs an instance of this class. - - - The object instance associated - with this object instance. - - - The instance to expose as a virtual - table cursor. - - - - - Advances to the next row of the virtual table cursor using the - method of the - object instance. - - - Non-zero if the current row is valid; zero otherwise. If zero is - returned, no further rows are available. - - - - - Resets the virtual table cursor position, also invalidating the - current row, using the method of - the object instance. - - - - - Closes the virtual table cursor. This method must not throw any - exceptions. - - - - - Throws an if the virtual - table cursor has been closed. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is - being called from the finalizer. - - - - - Returns the value for the current row of the virtual table cursor - using the property of the - object instance. - - - - - Returns non-zero if the end of the virtual table cursor has been - seen (i.e. no more rows are available, including the current one). - - - - - Returns non-zero if the virtual table cursor is open. - - - - - This class implements a virtual table module that exposes an - object instance as a read-only virtual - table. It is not sealed and may be used as the base class for any - user-defined virtual table class that wraps an - object instance. The following short - example shows it being used to treat an array of strings as a table - data source: - - public static class Sample - { - public static void Main() - { - using (SQLiteConnection connection = new SQLiteConnection( - "Data Source=:memory:;")) - { - connection.Open(); - - connection.CreateModule(new SQLiteModuleEnumerable( - "sampleModule", new string[] { "one", "two", "three" })); - - using (SQLiteCommand command = connection.CreateCommand()) - { - command.CommandText = - "CREATE VIRTUAL TABLE t1 USING sampleModule;"; - - command.ExecuteNonQuery(); - } - - using (SQLiteCommand command = connection.CreateCommand()) - { - command.CommandText = "SELECT * FROM t1;"; - - using (SQLiteDataReader dataReader = command.ExecuteReader()) - { - while (dataReader.Read()) - Console.WriteLine(dataReader[0].ToString()); - } - } - - connection.Close(); - } - } - } - - - - - - This class implements a virtual table module that does nothing by - providing "empty" implementations for all of the - interface methods. The result - codes returned by these "empty" method implementations may be - controlled on a per-method basis by using and/or overriding the - , - , - , - , and - methods from within derived classes. - - - - - This field is used to store the - values to return, on a per-method basis, for all methods that are - part of the interface. - - - - - Constructs an instance of this class. - - - The name of the module. This parameter cannot be null. - - - - - Determines the default value to be - returned by methods of the - interface that lack an overridden implementation in all classes - derived from the class. - - - The value that should be returned - by all interface methods unless - a more specific result code has been set for that interface method. - - - - - Converts a value into a boolean - return value for use with the - method. - - - The value to convert. - - - The value. - - - - - Converts a value into a boolean - return value for use with the - method. - - - The value to convert. - - - The value. - - - - - Determines the value that should be - returned by the specified - interface method if it lack an overridden implementation. If no - specific value is available (or set) - for the specified method, the value - returned by the method will be - returned instead. - - - The name of the method. Currently, this method must be part of - the interface. - - - The value that should be returned - by the interface method. - - - - - Sets the value that should be - returned by the specified - interface method if it lack an overridden implementation. - - - The name of the method. Currently, this method must be part of - the interface. - - - The value that should be returned - by the interface method. - - - Non-zero upon success. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is - being called from the finalizer. - - - - - The CREATE TABLE statement used to declare the schema for the - virtual table. - - - - - The instance containing the backing data - for the virtual table. - - - - - Non-zero if different object instances with the same value should - generate different row identifiers, where applicable. This has no - effect on the .NET Compact Framework. - - - - - Constructs an instance of this class. - - - The name of the module. This parameter cannot be null. - - - The instance to expose as a virtual - table. This parameter cannot be null. - - - - - Constructs an instance of this class. - - - The name of the module. This parameter cannot be null. - - - The instance to expose as a virtual - table. This parameter cannot be null. - - - Non-zero if different object instances with the same value should - generate different row identifiers, where applicable. This - parameter has no effect on the .NET Compact Framework. - - - - - Determines the SQL statement used to declare the virtual table. - This method should be overridden in derived classes if they require - a custom virtual table schema. - - - The SQL statement used to declare the virtual table -OR- null if it - cannot be determined. - - - - - Sets the table error message to one that indicates the virtual - table cursor is of the wrong type. - - - The object instance. - - - The value of . - - - - - Sets the table error message to one that indicates the virtual - table cursor has no current row. - - - The object instance. - - - The value of . - - - - - Determines the string to return as the column value for the object - instance value. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - The object instance to return a string representation for. - - - The string representation of the specified object instance or null - upon failure. - - - - - Constructs an unique row identifier from two - values. The first value - must contain the row sequence number for the current row and the - second value must contain the hash code of the enumerator value - for the current row. - - - The integer row sequence number for the current row. - - - The hash code of the enumerator value for the current row. - - - The unique row identifier or zero upon failure. - - - - - Determines the unique row identifier for the current row. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - The object instance to return a unique row identifier for. - - - The unique row identifier or zero upon failure. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is - being called from the finalizer. - - - - - This class represents a virtual table cursor to be used with the - class. It is not sealed and may - be used as the base class for any user-defined virtual table cursor - class that wraps an object instance. - - - - - The instance provided when this - cursor was created. - - - - - Constructs an instance of this class. - - - The object instance associated - with this object instance. - - - The instance to expose as a virtual - table cursor. - - - - - Closes the virtual table cursor. This method must not throw any - exceptions. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is - being called from the finalizer. - - - - - Returns the value for the current row of the virtual table cursor - using the property of the - object instance. - - - - - This class implements a virtual table module that exposes an - object instance as a read-only virtual - table. It is not sealed and may be used as the base class for any - user-defined virtual table class that wraps an - object instance. - - - - - The instance containing the backing - data for the virtual table. - - - - - Constructs an instance of this class. - - - The name of the module. This parameter cannot be null. - - - The instance to expose as a virtual - table. This parameter cannot be null. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is - being called from the finalizer. - - -
-
diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.0/x64/SQLite.Interop.dll b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.0/x64/SQLite.Interop.dll deleted file mode 100644 index f6f75504..00000000 Binary files a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.0/x64/SQLite.Interop.dll and /dev/null differ diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.0/x86/SQLite.Interop.dll b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.0/x86/SQLite.Interop.dll deleted file mode 100644 index 2163d419..00000000 Binary files a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.0/x86/SQLite.Interop.dll and /dev/null differ diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.5/System.Data.SQLite.dll b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.5/System.Data.SQLite.dll deleted file mode 100644 index c5af32eb..00000000 Binary files a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.5/System.Data.SQLite.dll and /dev/null differ diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.5/System.Data.SQLite.xml b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.5/System.Data.SQLite.xml deleted file mode 100644 index 6df7eb75..00000000 --- a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.5/System.Data.SQLite.xml +++ /dev/null @@ -1,13100 +0,0 @@ - - - - System.Data.SQLite - - - - - Defines a source code identifier custom attribute for an assembly - manifest. - - - - - Constructs an instance of this attribute class using the specified - source code identifier value. - - - The source code identifier value to use. - - - - - Gets the source code identifier value. - - - - - Defines a source code time-stamp custom attribute for an assembly - manifest. - - - - - Constructs an instance of this attribute class using the specified - source code time-stamp value. - - - The source code time-stamp value to use. - - - - - Gets the source code time-stamp value. - - - - - This is the method signature for the SQLite core library logging callback - function for use with sqlite3_log() and the SQLITE_CONFIG_LOG. - - WARNING: This delegate is used more-or-less directly by native code, do - not modify its type signature. - - - The extra data associated with this message, if any. - - - The error code associated with this message. - - - The message string to be logged. - - - - - This class implements SQLiteBase completely, and is the guts of the code that interop's SQLite with .NET - - - - - This internal class provides the foundation of SQLite support. It defines all the abstract members needed to implement - a SQLite data provider, and inherits from SQLiteConvert which allows for simple translations of string to and from SQLite. - - - - - This base class provides datatype conversion services for the SQLite provider. - - - - - The format string for DateTime values when using the InvariantCulture or CurrentCulture formats. - - - - - The value for the Unix epoch (e.g. January 1, 1970 at midnight, in UTC). - - - - - The value of the OLE Automation epoch represented as a Julian day. - - - - - An array of ISO-8601 DateTime formats that we support parsing. - - - - - The internal default format for UTC DateTime values when converting - to a string. - - - - - The internal default format for local DateTime values when converting - to a string. - - - - - An UTF-8 Encoding instance, so we can convert strings to and from UTF-8 - - - - - The default DateTime format for this instance. - - - - - The default DateTimeKind for this instance. - - - - - The default DateTime format string for this instance. - - - - - Initializes the conversion class - - The default date/time format to use for this instance - The DateTimeKind to use. - The DateTime format string to use. - - - - Converts a string to a UTF-8 encoded byte array sized to include a null-terminating character. - - The string to convert to UTF-8 - A byte array containing the converted string plus an extra 0 terminating byte at the end of the array. - - - - Convert a DateTime to a UTF-8 encoded, zero-terminated byte array. - - - This function is a convenience function, which first calls ToString() on the DateTime, and then calls ToUTF8() with the - string result. - - The DateTime to convert. - The UTF-8 encoded string, including a 0 terminating byte at the end of the array. - - - - Converts a UTF-8 encoded IntPtr of the specified length into a .NET string - - The pointer to the memory where the UTF-8 string is encoded - The number of bytes to decode - A string containing the translated character(s) - - - - Converts a UTF-8 encoded IntPtr of the specified length into a .NET string - - The pointer to the memory where the UTF-8 string is encoded - The number of bytes to decode - A string containing the translated character(s) - - - - Converts a string into a DateTime, using the DateTimeFormat, DateTimeKind, - and DateTimeFormatString specified for the connection when it was opened. - - - Acceptable ISO8601 DateTime formats are: - - THHmmssK - THHmmK - HH:mm:ss.FFFFFFFK - HH:mm:ssK - HH:mmK - yyyy-MM-dd HH:mm:ss.FFFFFFFK - yyyy-MM-dd HH:mm:ssK - yyyy-MM-dd HH:mmK - yyyy-MM-ddTHH:mm:ss.FFFFFFFK - yyyy-MM-ddTHH:mmK - yyyy-MM-ddTHH:mm:ssK - yyyyMMddHHmmssK - yyyyMMddHHmmK - yyyyMMddTHHmmssFFFFFFFK - THHmmss - THHmm - HH:mm:ss.FFFFFFF - HH:mm:ss - HH:mm - yyyy-MM-dd HH:mm:ss.FFFFFFF - yyyy-MM-dd HH:mm:ss - yyyy-MM-dd HH:mm - yyyy-MM-ddTHH:mm:ss.FFFFFFF - yyyy-MM-ddTHH:mm - yyyy-MM-ddTHH:mm:ss - yyyyMMddHHmmss - yyyyMMddHHmm - yyyyMMddTHHmmssFFFFFFF - yyyy-MM-dd - yyyyMMdd - yy-MM-dd - - If the string cannot be matched to one of the above formats -OR- - the DateTimeFormatString if one was provided, an exception will - be thrown. - - The string containing either a long integer number of 100-nanosecond units since - System.DateTime.MinValue, a Julian day double, an integer number of seconds since the Unix epoch, a - culture-independent formatted date and time string, a formatted date and time string in the current - culture, or an ISO8601-format string. - A DateTime value - - - - Converts a string into a DateTime, using the specified DateTimeFormat, - DateTimeKind and DateTimeFormatString. - - - Acceptable ISO8601 DateTime formats are: - - THHmmssK - THHmmK - HH:mm:ss.FFFFFFFK - HH:mm:ssK - HH:mmK - yyyy-MM-dd HH:mm:ss.FFFFFFFK - yyyy-MM-dd HH:mm:ssK - yyyy-MM-dd HH:mmK - yyyy-MM-ddTHH:mm:ss.FFFFFFFK - yyyy-MM-ddTHH:mmK - yyyy-MM-ddTHH:mm:ssK - yyyyMMddHHmmssK - yyyyMMddHHmmK - yyyyMMddTHHmmssFFFFFFFK - THHmmss - THHmm - HH:mm:ss.FFFFFFF - HH:mm:ss - HH:mm - yyyy-MM-dd HH:mm:ss.FFFFFFF - yyyy-MM-dd HH:mm:ss - yyyy-MM-dd HH:mm - yyyy-MM-ddTHH:mm:ss.FFFFFFF - yyyy-MM-ddTHH:mm - yyyy-MM-ddTHH:mm:ss - yyyyMMddHHmmss - yyyyMMddHHmm - yyyyMMddTHHmmssFFFFFFF - yyyy-MM-dd - yyyyMMdd - yy-MM-dd - - If the string cannot be matched to one of the above formats -OR- - the DateTimeFormatString if one was provided, an exception will - be thrown. - - The string containing either a long integer number of 100-nanosecond units since - System.DateTime.MinValue, a Julian day double, an integer number of seconds since the Unix epoch, a - culture-independent formatted date and time string, a formatted date and time string in the current - culture, or an ISO8601-format string. - The SQLiteDateFormats to use. - The DateTimeKind to use. - The DateTime format string to use. - A DateTime value - - - - Converts a julianday value into a DateTime - - The value to convert - A .NET DateTime - - - - Converts a julianday value into a DateTime - - The value to convert - The DateTimeKind to use. - A .NET DateTime - - - - Converts the specified number of seconds from the Unix epoch into a - value. - - - The number of whole seconds since the Unix epoch. - - - Either Utc or Local time. - - - The new value. - - - - - Converts the specified number of ticks since the epoch into a - value. - - - The number of whole ticks since the epoch. - - - Either Utc or Local time. - - - The new value. - - - - - Converts a DateTime struct to a JulianDay double - - The DateTime to convert - The JulianDay value the Datetime represents - - - - Converts a DateTime struct to the whole number of seconds since the - Unix epoch. - - The DateTime to convert - The whole number of seconds since the Unix epoch - - - - Returns the DateTime format string to use for the specified DateTimeKind. - If is not null, it will be returned verbatim. - - The DateTimeKind to use. - The DateTime format string to use. - - The DateTime format string to use for the specified DateTimeKind. - - - - - Converts a string into a DateTime, using the DateTimeFormat, DateTimeKind, - and DateTimeFormatString specified for the connection when it was opened. - - The DateTime value to convert - Either a string containing the long integer number of 100-nanosecond units since System.DateTime.MinValue, a - Julian day double, an integer number of seconds since the Unix epoch, a culture-independent formatted date and time - string, a formatted date and time string in the current culture, or an ISO8601-format date/time string. - - - - Internal function to convert a UTF-8 encoded IntPtr of the specified length to a DateTime. - - - This is a convenience function, which first calls ToString() on the IntPtr to convert it to a string, then calls - ToDateTime() on the string to return a DateTime. - - A pointer to the UTF-8 encoded string - The length in bytes of the string - The parsed DateTime value - - - - Smart method of splitting a string. Skips quoted elements, removes the quotes. - - - This split function works somewhat like the String.Split() function in that it breaks apart a string into - pieces and returns the pieces as an array. The primary differences are: - - Only one character can be provided as a separator character - Quoted text inside the string is skipped over when searching for the separator, and the quotes are removed. - - Thus, if splitting the following string looking for a comma:
- One,Two, "Three, Four", Five
-
- The resulting array would contain
- [0] One
- [1] Two
- [2] Three, Four
- [3] Five
-
- Note that the leading and trailing spaces were removed from each item during the split. -
- Source string to split apart - Separator character - A string array of the split up elements -
- - - Splits the specified string into multiple strings based on a separator - and returns the result as an array of strings. - - - The string to split into pieces based on the separator character. If - this string is null, null will always be returned. If this string is - empty, an array of zero strings will always be returned. - - - The character used to divide the original string into sub-strings. - This character cannot be a backslash or a double-quote; otherwise, no - work will be performed and null will be returned. - - - If this parameter is non-zero, all double-quote characters will be - retained in the returned list of strings; otherwise, they will be - dropped. - - - Upon failure, this parameter will be modified to contain an appropriate - error message. - - - The new array of strings or null if the input string is null -OR- the - separator character is a backslash or a double-quote -OR- the string - contains an unbalanced backslash or double-quote character. - - - - - Queries and returns the string representation for an object, using the - specified (or current) format provider. - - - The object instance to return the string representation for. - - - The format provider to use -OR- null if the current format provider for - the thread should be used instead. - - - The string representation for the object instance -OR- null if the - object instance is also null. - - - - - Convert a value to true or false. - - A string or number representing true or false - - - - - Convert a string to true or false. - - A string representing true or false - - - "yes", "no", "y", "n", "0", "1", "on", "off" as well as Boolean.FalseString and Boolean.TrueString will all be - converted to a proper boolean value. - - - - - Converts a SQLiteType to a .NET Type object - - The SQLiteType to convert - Returns a .NET Type object - - - - For a given intrinsic type, return a DbType - - The native type to convert - The corresponding (closest match) DbType - - - - Returns the ColumnSize for the given DbType - - The DbType to get the size of - - - - - Determines the type name for the given database value type. - - The connection context for custom type mappings, if any. - The database value type. - The flags associated with the parent connection object. - The type name or an empty string if it cannot be determined. - - - - Convert a DbType to a Type - - The DbType to convert from - The closest-match .NET type - - - - For a given type, return the closest-match SQLite TypeAffinity, which only understands a very limited subset of types. - - The type to evaluate - The SQLite type affinity for that type. - - - - Builds and returns a map containing the database column types - recognized by this provider. - - - A map containing the database column types recognized by this - provider. - - - - - For a given type name, return a closest-match .NET type - - The connection context for custom type mappings, if any. - The name of the type to match - The flags associated with the parent connection object. - The .NET DBType the text evaluates to. - - - - The error code used for logging exceptions caught in user-provided - code. - - - - - Sets the status of the memory usage tracking subsystem in the SQLite core library. By default, this is enabled. - If this is disabled, memory usage tracking will not be performed. This is not really a per-connection value, it is - global to the process. - - Non-zero to enable memory usage tracking, zero otherwise. - A standard SQLite return code (i.e. zero for success and non-zero for failure). - - - - Attempts to free as much heap memory as possible for the database connection. - - A standard SQLite return code (i.e. zero for success and non-zero for failure). - - - - Shutdown the SQLite engine so that it can be restarted with different config options. - We depend on auto initialization to recover. - - - - - Determines if the associated native connection handle is open. - - - Non-zero if a database connection is open. - - - - - Opens a database. - - - Implementers should call SQLiteFunction.BindFunctions() and save the array after opening a connection - to bind all attributed user-defined functions and collating sequences to the new connection. - - The filename of the database to open. SQLite automatically creates it if it doesn't exist. - The flags associated with the parent connection object - The open flags to use when creating the connection - The maximum size of the pool for the given filename - If true, the connection can be pulled from the connection pool - - - - Closes the currently-open database. - - - After the database has been closed implemeters should call SQLiteFunction.UnbindFunctions() to deallocate all interop allocated - memory associated with the user-defined functions and collating sequences tied to the closed connection. - - Non-zero if the operation is allowed to throw exceptions, zero otherwise. - - - - Sets the busy timeout on the connection. SQLiteCommand will call this before executing any command. - - The number of milliseconds to wait before returning SQLITE_BUSY - - - - Returns the text of the last error issued by SQLite - - - - - - Returns the text of the last error issued by SQLite -OR- the specified default error text if - none is available from the SQLite core library. - - - The error text to return in the event that one is not available from the SQLite core library. - - - The error text. - - - - - When pooling is enabled, force this connection to be disposed rather than returned to the pool - - - - - When pooling is enabled, returns the number of pool entries matching the current file name. - - The number of pool entries matching the current file name. - - - - Prepares a SQL statement for execution. - - The source connection preparing the command. Can be null for any caller except LINQ - The SQL command text to prepare - The previous statement in a multi-statement command, or null if no previous statement exists - The timeout to wait before aborting the prepare - The remainder of the statement that was not processed. Each call to prepare parses the - SQL up to to either the end of the text or to the first semi-colon delimiter. The remaining text is returned - here for a subsequent call to Prepare() until all the text has been processed. - Returns an initialized SQLiteStatement. - - - - Steps through a prepared statement. - - The SQLiteStatement to step through - True if a row was returned, False if not. - - - - Resets a prepared statement so it can be executed again. If the error returned is SQLITE_SCHEMA, - transparently attempt to rebuild the SQL statement and throw an error if that was not possible. - - The statement to reset - Returns -1 if the schema changed while resetting, 0 if the reset was sucessful or 6 (SQLITE_LOCKED) if the reset failed due to a lock - - - - Attempts to interrupt the query currently executing on the associated - native database connection. - - - - - This function binds a user-defined functions to the connection. - - - The object instance containing - the metadata for the function to be bound. - - - The object instance that implements the - function to be bound. - - - The flags associated with the parent connection object. - - - - - Calls the native SQLite core library in order to create a disposable - module containing the implementation of a virtual table. - - - The module object to be used when creating the native disposable module. - - - The flags for the associated object instance. - - - - - Calls the native SQLite core library in order to cleanup the resources - associated with a module containing the implementation of a virtual table. - - - The module object previously passed to the - method. - - - The flags for the associated object instance. - - - - - Calls the native SQLite core library in order to declare a virtual table - in response to a call into the - or virtual table methods. - - - The virtual table module that is to be responsible for the virtual table - being declared. - - - The string containing the SQL statement describing the virtual table to - be declared. - - - Upon success, the contents of this parameter are undefined. Upon failure, - it should contain an appropriate error message. - - - A standard SQLite return code. - - - - - Calls the native SQLite core library in order to declare a virtual table - function in response to a call into the - or virtual table methods. - - - The virtual table module that is to be responsible for the virtual table - function being declared. - - - The number of arguments to the function being declared. - - - The name of the function being declared. - - - Upon success, the contents of this parameter are undefined. Upon failure, - it should contain an appropriate error message. - - - A standard SQLite return code. - - - - - Enables or disabled extension loading by SQLite. - - - True to enable loading of extensions, false to disable. - - - - - Loads a SQLite extension library from the named file. - - - The name of the dynamic link library file containing the extension. - - - The name of the exported function used to initialize the extension. - If null, the default "sqlite3_extension_init" will be used. - - - - - Enables or disabled extened result codes returned by SQLite - - true to enable extended result codes, false to disable. - - - - - Returns the numeric result code for the most recent failed SQLite API call - associated with the database connection. - - Result code - - - - Returns the extended numeric result code for the most recent failed SQLite API call - associated with the database connection. - - Extended result code - - - - Add a log message via the SQLite sqlite3_log interface. - - Error code to be logged with the message. - String to be logged. Unlike the SQLite sqlite3_log() - interface, this should be pre-formatted. Consider using the - String.Format() function. - - - - - Checks if the SQLite core library has been initialized in the current process. - - - Non-zero if the SQLite core library has been initialized in the current process, - zero otherwise. - - - - - Creates a new SQLite backup object based on the provided destination - database connection. The source database connection is the one - associated with this object. The source and destination database - connections cannot be the same. - - The destination database connection. - The destination database name. - The source database name. - The newly created backup object. - - - - Copies up to N pages from the source database to the destination - database associated with the specified backup object. - - The backup object to use. - - The number of pages to copy or negative to copy all remaining pages. - - - Set to true if the operation needs to be retried due to database - locking issues. - - - True if there are more pages to be copied, false otherwise. - - - - - Returns the number of pages remaining to be copied from the source - database to the destination database associated with the specified - backup object. - - The backup object to check. - The number of pages remaining to be copied. - - - - Returns the total number of pages in the source database associated - with the specified backup object. - - The backup object to check. - The total number of pages in the source database. - - - - Destroys the backup object, rolling back any backup that may be in - progess. - - The backup object to destroy. - - - - Returns the error message for the specified SQLite return code using - the internal static lookup table. - - The SQLite return code. - The error message or null if it cannot be found. - - - - Returns the error message for the specified SQLite return code using - the sqlite3_errstr() function, falling back to the internal lookup - table if necessary. - - The SQLite return code. - The error message or null if it cannot be found. - - - - Returns a string representing the active version of SQLite - - - - - Returns an integer representing the active version of SQLite - - - - - Returns the rowid of the most recent successful INSERT into the database from this connection. - - - - - Returns the number of changes the last executing insert/update caused. - - - - - Returns the amount of memory (in bytes) currently in use by the SQLite core library. This is not really a per-connection - value, it is global to the process. - - - - - Returns the maximum amount of memory (in bytes) used by the SQLite core library since the high-water mark was last reset. - This is not really a per-connection value, it is global to the process. - - - - - Returns non-zero if the underlying native connection handle is owned by this instance. - - - - - Returns non-zero if the given database connection is in autocommit mode. - Autocommit mode is on by default. Autocommit mode is disabled by a BEGIN - statement. Autocommit mode is re-enabled by a COMMIT or ROLLBACK. - - - - - The opaque pointer returned to us by the sqlite provider - - - - - The user-defined functions registered on this connection - - - - - The modules created using this connection. - - - - - Constructs the object used to interact with the SQLite core library - using the UTF-8 text encoding. - - - The DateTime format to be used when converting string values to a - DateTime and binding DateTime parameters. - - - The to be used when creating DateTime - values. - - - The format string to be used when parsing and formatting DateTime - values. - - - The native handle to be associated with the database connection. - - - The fully qualified file name associated with . - - - Non-zero if the newly created object instance will need to dispose - of when it is no longer needed. - - - - - This method attempts to dispose of all the derived - object instances currently associated with the native database connection. - - - - - Attempts to interrupt the query currently executing on the associated - native database connection. - - - - - This function binds a user-defined function to the connection. - - - The object instance containing - the metadata for the function to be bound. - - - The object instance that implements the - function to be bound. - - - The flags associated with the parent connection object. - - - - - Attempts to free as much heap memory as possible for the database connection. - - A standard SQLite return code (i.e. zero for success and non-zero for failure). - - - - Attempts to free N bytes of heap memory by deallocating non-essential memory - allocations held by the database library. Memory used to cache database pages - to improve performance is an example of non-essential memory. This is a no-op - returning zero if the SQLite core library was not compiled with the compile-time - option SQLITE_ENABLE_MEMORY_MANAGEMENT. Optionally, attempts to reset and/or - compact the Win32 native heap, if applicable. - - - The requested number of bytes to free. - - - Non-zero to attempt a heap reset. - - - Non-zero to attempt heap compaction. - - - The number of bytes actually freed. This value may be zero. - - - This value will be non-zero if the heap reset was successful. - - - The size of the largest committed free block in the heap, in bytes. - This value will be zero unless heap compaction is enabled. - - - A standard SQLite return code (i.e. zero for success and non-zero - for failure). - - - - - Shutdown the SQLite engine so that it can be restarted with different - configuration options. We depend on auto initialization to recover. - - Returns a standard SQLite result code. - - - - Shutdown the SQLite engine so that it can be restarted with different - configuration options. We depend on auto initialization to recover. - - - Non-zero to reset the database and temporary directories to their - default values, which should be null for both. This parameter has no - effect on non-Windows operating systems. - - Returns a standard SQLite result code. - - - - Determines if the associated native connection handle is open. - - - Non-zero if the associated native connection handle is open. - - - - - Calls the native SQLite core library in order to create a disposable - module containing the implementation of a virtual table. - - - The module object to be used when creating the native disposable module. - - - The flags for the associated object instance. - - - - - Calls the native SQLite core library in order to cleanup the resources - associated with a module containing the implementation of a virtual table. - - - The module object previously passed to the - method. - - - The flags for the associated object instance. - - - - - Calls the native SQLite core library in order to declare a virtual table - in response to a call into the - or virtual table methods. - - - The virtual table module that is to be responsible for the virtual table - being declared. - - - The string containing the SQL statement describing the virtual table to - be declared. - - - Upon success, the contents of this parameter are undefined. Upon failure, - it should contain an appropriate error message. - - - A standard SQLite return code. - - - - - Calls the native SQLite core library in order to declare a virtual table - function in response to a call into the - or virtual table methods. - - - The virtual table module that is to be responsible for the virtual table - function being declared. - - - The number of arguments to the function being declared. - - - The name of the function being declared. - - - Upon success, the contents of this parameter are undefined. Upon failure, - it should contain an appropriate error message. - - - A standard SQLite return code. - - - - - Enables or disabled extension loading by SQLite. - - - True to enable loading of extensions, false to disable. - - - - - Loads a SQLite extension library from the named file. - - - The name of the dynamic link library file containing the extension. - - - The name of the exported function used to initialize the extension. - If null, the default "sqlite3_extension_init" will be used. - - - - Enables or disabled extended result codes returned by SQLite - - - Gets the last SQLite error code - - - Gets the last SQLite extended error code - - - Add a log message via the SQLite sqlite3_log interface. - - - Add a log message via the SQLite sqlite3_log interface. - - - - Allows the setting of a logging callback invoked by SQLite when a - log event occurs. Only one callback may be set. If NULL is passed, - the logging callback is unregistered. - - The callback function to invoke. - Returns a result code - - - - Creates a new SQLite backup object based on the provided destination - database connection. The source database connection is the one - associated with this object. The source and destination database - connections cannot be the same. - - The destination database connection. - The destination database name. - The source database name. - The newly created backup object. - - - - Copies up to N pages from the source database to the destination - database associated with the specified backup object. - - The backup object to use. - - The number of pages to copy, negative to copy all remaining pages. - - - Set to true if the operation needs to be retried due to database - locking issues; otherwise, set to false. - - - True if there are more pages to be copied, false otherwise. - - - - - Returns the number of pages remaining to be copied from the source - database to the destination database associated with the specified - backup object. - - The backup object to check. - The number of pages remaining to be copied. - - - - Returns the total number of pages in the source database associated - with the specified backup object. - - The backup object to check. - The total number of pages in the source database. - - - - Destroys the backup object, rolling back any backup that may be in - progess. - - The backup object to destroy. - - - - Determines if the SQLite core library has been initialized for the - current process. - - - A boolean indicating whether or not the SQLite core library has been - initialized for the current process. - - - - - Determines if the SQLite core library has been initialized for the - current process. - - - A boolean indicating whether or not the SQLite core library has been - initialized for the current process. - - - - - Helper function to retrieve a column of data from an active statement. - - The statement being step()'d through - The flags associated with the connection. - The column index to retrieve - The type of data contained in the column. If Uninitialized, this function will retrieve the datatype information. - Returns the data in the column - - - - Returns non-zero if the underlying native connection handle is owned - by this instance. - - - - - Alternate SQLite3 object, overriding many text behaviors to support UTF-16 (Unicode) - - - - - Constructs the object used to interact with the SQLite core library - using the UTF-8 text encoding. - - - The DateTime format to be used when converting string values to a - DateTime and binding DateTime parameters. - - - The to be used when creating DateTime - values. - - - The format string to be used when parsing and formatting DateTime - values. - - - The native handle to be associated with the database connection. - - - The fully qualified file name associated with . - - - Non-zero if the newly created object instance will need to dispose - of when it is no longer needed. - - - - - Overrides SQLiteConvert.ToString() to marshal UTF-16 strings instead of UTF-8 - - A pointer to a UTF-16 string - The length (IN BYTES) of the string - A .NET string - - - - Represents a single SQL backup in SQLite. - - - - - The underlying SQLite object this backup is bound to. - - - - - The actual backup handle. - - - - - The destination database for the backup. - - - - - The destination database name for the backup. - - - - - The source database for the backup. - - - - - The source database name for the backup. - - - - - The last result from the StepBackup method of the SQLite3 class. - This is used to determine if the call to the FinishBackup method of - the SQLite3 class should throw an exception when it receives a non-Ok - return code from the core SQLite library. - - - - - Initializes the backup. - - The base SQLite object. - The backup handle. - The destination database for the backup. - The destination database name for the backup. - The source database for the backup. - The source database name for the backup. - - - - Disposes and finalizes the backup. - - - - - The extra behavioral flags that can be applied to a connection. - - - - - No extra flags. - - - - - Enable logging of all SQL statements to be prepared. - - - - - Enable logging of all bound parameter types and raw values. - - - - - Enable logging of all bound parameter strongly typed values. - - - - - Enable logging of all exceptions caught from user-provided - managed code called from native code via delegates. - - - - - Enable logging of backup API errors. - - - - - Skip adding the extension functions provided by the native - interop assembly. - - - - - When binding parameter values with the - type, use the interop method that accepts an - value. - - - - - When binding parameter values, always bind them as though they were - plain text (i.e. no numeric, date/time, or other conversions should - be attempted). - - - - - When returning column values, always return them as though they were - plain text (i.e. no numeric, date/time, or other conversions should - be attempted). - - - - - Prevent this object instance from - loading extensions. - - - - - Prevent this object instance from - creating virtual table modules. - - - - - Skip binding any functions provided by other managed assemblies when - opening the connection. - - - - - Skip setting the logging related properties of the - object instance that was passed to - the method. - - - - - Enable logging of all virtual table module errors seen by the - method. - - - - - Enable logging of certain virtual table module exceptions that cannot - be easily discovered via other means. - - - - - Enable tracing of potentially important [non-fatal] error conditions - that cannot be easily reported through other means. - - - - - When binding parameter values, always use the invariant culture when - converting their values from strings. - - - - - When binding parameter values, always use the invariant culture when - converting their values to strings. - - - - - Disable using the connection pool by default. If the "Pooling" - connection string property is specified, its value will override - this flag. The precise outcome of combining this flag with the - flag is unspecified; however, - one of the flags will be in effect. - - - - - Enable using the connection pool by default. If the "Pooling" - connection string property is specified, its value will override - this flag. The precise outcome of combining this flag with the - flag is unspecified; however, - one of the flags will be in effect. - - - - - Enable using per-connection mappings between type names and - values. Also see the - , - , and - methods. These - per-connection mappings, when present, override the corresponding - global mappings. - - - - - Disable using global mappings between type names and - values. This may be useful in some very narrow - cases; however, if there are no per-connection type mappings, the - fallback defaults will be used for both type names and their - associated values. Therefore, use of this flag - is not recommended. - - - - - When binding parameter values or returning column values, always - treat them as though they were plain text (i.e. no numeric, - date/time, or other conversions should be attempted). - - - - - When binding parameter values, always use the invariant culture when - converting their values to strings or from strings. - - - - - When binding parameter values or returning column values, always - treat them as though they were plain text (i.e. no numeric, - date/time, or other conversions should be attempted) and always - use the invariant culture when converting their values to strings. - - - - - When binding parameter values or returning column values, always - treat them as though they were plain text (i.e. no numeric, - date/time, or other conversions should be attempted) and always - use the invariant culture when converting their values to strings - or from strings. - - - - - Enable all logging. - - - - - The default extra flags for new connections. - - - - - SQLite implementation of DbCommand. - - - - - The default connection string to be used when creating a temporary - connection to execute a command via the static - or - - methods. - - - - - The command text this command is based on - - - - - The connection the command is associated with - - - - - The version of the connection the command is associated with - - - - - Indicates whether or not a DataReader is active on the command. - - - - - The timeout for the command, kludged because SQLite doesn't support per-command timeout values - - - - - Designer support - - - - - Used by DbDataAdapter to determine updating behavior - - - - - The collection of parameters for the command - - - - - The SQL command text, broken into individual SQL statements as they are executed - - - - - Unprocessed SQL text that has not been executed - - - - - Transaction associated with this command - - - - - Constructs a new SQLiteCommand - - - Default constructor - - - - - Initializes the command with the given command text - - The SQL command text - - - - Initializes the command with the given SQL command text and attach the command to the specified - connection. - - The SQL command text - The connection to associate with the command - - - - Initializes the command and associates it with the specified connection. - - The connection to associate with the command - - - - Initializes a command with the given SQL, connection and transaction - - The SQL command text - The connection to associate with the command - The transaction the command should be associated with - - - - Disposes of the command and clears all member variables - - Whether or not the class is being explicitly or implicitly disposed - - - - This method attempts to query the flags associated with the database - connection in use. If the database connection is disposed, the default - flags will be returned. - - - The command containing the databse connection to query the flags from. - - - The connection flags value. - - - - - Clears and destroys all statements currently prepared - - - - - Builds an array of prepared statements for each complete SQL statement in the command text - - - - - Not implemented - - - - - Forwards to the local CreateParameter() function - - - - - - Create a new parameter - - - - - - This function ensures there are no active readers, that we have a valid connection, - that the connection is open, that all statements are prepared and all parameters are assigned - in preparation for allocating a data reader. - - - - - Creates a new SQLiteDataReader to execute/iterate the array of SQLite prepared statements - - The behavior the data reader should adopt - Returns a SQLiteDataReader object - - - - This method creates a new connection, executes the query using the given - execution type, closes the connection, and returns the results. If the - connection string is null, a temporary in-memory database connection will - be used. - - - The text of the command to be executed. - - - The execution type for the command. This is used to determine which method - of the command object to call, which then determines the type of results - returned, if any. - - - The connection string to the database to be opened, used, and closed. If - this parameter is null, a temporary in-memory databse will be used. - - - The SQL parameter values to be used when building the command object to be - executed, if any. - - - The results of the query -OR- null if no results were produced from the - given execution type. - - - - - This method creates a new connection, executes the query using the given - execution type and command behavior, closes the connection, and returns - the results. If the connection string is null, a temporary in-memory - database connection will be used. - - - The text of the command to be executed. - - - The execution type for the command. This is used to determine which method - of the command object to call, which then determines the type of results - returned, if any. - - - The command behavior flags for the command. - - - The connection string to the database to be opened, used, and closed. If - this parameter is null, a temporary in-memory databse will be used. - - - The SQL parameter values to be used when building the command object to be - executed, if any. - - - The results of the query -OR- null if no results were produced from the - given execution type. - - - - - Overrides the default behavior to return a SQLiteDataReader specialization class - - The flags to be associated with the reader. - A SQLiteDataReader - - - - Overrides the default behavior of DbDataReader to return a specialized SQLiteDataReader class - - A SQLiteDataReader - - - - Called by the SQLiteDataReader when the data reader is closed. - - - - - Execute the command and return the number of rows inserted/updated affected by it. - - The number of rows inserted/updated affected by it. - - - - Execute the command and return the number of rows inserted/updated affected by it. - - The flags to be associated with the reader. - The number of rows inserted/updated affected by it. - - - - Execute the command and return the first column of the first row of the resultset - (if present), or null if no resultset was returned. - - The first column of the first row of the first resultset from the query. - - - - Execute the command and return the first column of the first row of the resultset - (if present), or null if no resultset was returned. - - The flags to be associated with the reader. - The first column of the first row of the first resultset from the query. - - - - Does nothing. Commands are prepared as they are executed the first time, and kept in prepared state afterwards. - - - - - Clones a command, including all its parameters - - A new SQLiteCommand with the same commandtext, connection and parameters - - - - The SQL command text associated with the command - - - - - The amount of time to wait for the connection to become available before erroring out - - - - - The type of the command. SQLite only supports CommandType.Text - - - - - The connection associated with this command - - - - - Forwards to the local Connection property - - - - - Returns the SQLiteParameterCollection for the given command - - - - - Forwards to the local Parameters property - - - - - The transaction associated with this command. SQLite only supports one transaction per connection, so this property forwards to the - command's underlying connection. - - - - - Forwards to the local Transaction property - - - - - Sets the method the SQLiteCommandBuilder uses to determine how to update inserted or updated rows in a DataTable. - - - - - Determines if the command is visible at design time. Defaults to True. - - - - - SQLite implementation of DbCommandBuilder. - - - - - Default constructor - - - - - Initializes the command builder and associates it with the specified data adapter. - - - - - - Minimal amount of parameter processing. Primarily sets the DbType for the parameter equal to the provider type in the schema - - The parameter to use in applying custom behaviors to a row - The row to apply the parameter to - The type of statement - Whether the application of the parameter is part of a WHERE clause - - - - Returns a valid named parameter - - The name of the parameter - Error - - - - Returns a named parameter for the given ordinal - - The i of the parameter - Error - - - - Returns a placeholder character for the specified parameter i. - - The index of the parameter to provide a placeholder for - Returns a named parameter - - - - Sets the handler for receiving row updating events. Used by the DbCommandBuilder to autogenerate SQL - statements that may not have previously been generated. - - A data adapter to receive events on. - - - - Returns the automatically-generated SQLite command to delete rows from the database - - - - - - Returns the automatically-generated SQLite command to delete rows from the database - - - - - - - Returns the automatically-generated SQLite command to update rows in the database - - - - - - Returns the automatically-generated SQLite command to update rows in the database - - - - - - - Returns the automatically-generated SQLite command to insert rows into the database - - - - - - Returns the automatically-generated SQLite command to insert rows into the database - - - - - - - Places brackets around an identifier - - The identifier to quote - The bracketed identifier - - - - Removes brackets around an identifier - - The quoted (bracketed) identifier - The undecorated identifier - - - - Override helper, which can help the base command builder choose the right keys for the given query - - - - - - - Gets/sets the DataAdapter for this CommandBuilder - - - - - Overridden to hide its property from the designer - - - - - Overridden to hide its property from the designer - - - - - Overridden to hide its property from the designer - - - - - Overridden to hide its property from the designer - - - - - Overridden to hide its property from the designer - - - - - Event data for connection event handlers. - - - - - The type of event being raised. - - - - - The associated with this event, if any. - - - - - The transaction associated with this event, if any. - - - - - The command associated with this event, if any. - - - - - The data reader associated with this event, if any. - - - - - The critical handle associated with this event, if any. - - - - - Command or message text associated with this event, if any. - - - - - Extra data associated with this event, if any. - - - - - Constructs the object. - - The type of event being raised. - The base associated - with this event, if any. - The transaction associated with this event, if any. - The command associated with this event, if any. - The data reader associated with this event, if any. - The critical handle associated with this event, if any. - The command or message text, if any. - The extra data, if any. - - - - Raised when an event pertaining to a connection occurs. - - The connection involved. - Extra information about the event. - - - - SQLite implentation of DbConnection. - - - The property can contain the following parameter(s), delimited with a semi-colon: - - - Parameter - Values - Required - Default - - - Data Source - - This may be a file name, the string ":memory:", or any supported URI (starting with SQLite 3.7.7). - Starting with release 1.0.86.0, in order to use more than one consecutive backslash (e.g. for a - UNC path), each of the adjoining backslash characters must be doubled (e.g. "\\Network\Share\test.db" - would become "\\\\Network\Share\test.db"). - - Y - - - - Version - 3 - N - 3 - - - UseUTF16Encoding - True
False
- N - False -
- - DateTimeFormat - - Ticks - Use the value of DateTime.Ticks.
- ISO8601 - Use the ISO-8601 format. Uses the "yyyy-MM-dd HH:mm:ss.FFFFFFFK" format for UTC - DateTime values and "yyyy-MM-dd HH:mm:ss.FFFFFFF" format for local DateTime values).
- JulianDay - The interval of time in days and fractions of a day since January 1, 4713 BC.
- UnixEpoch - The whole number of seconds since the Unix epoch (January 1, 1970).
- InvariantCulture - Any culture-independent string value that the .NET Framework can interpret as a valid DateTime.
- CurrentCulture - Any string value that the .NET Framework can interpret as a valid DateTime using the current culture.
- N - ISO8601 -
- - DateTimeKind - Unspecified - Not specified as either UTC or local time.
Utc - The time represented is UTC.
Local - The time represented is local time.
- N - Unspecified -
- - DateTimeFormatString - The exact DateTime format string to use for all formatting and parsing of all DateTime - values for this connection. - N - null - - - BaseSchemaName - Some base data classes in the framework (e.g. those that build SQL queries dynamically) - assume that an ADO.NET provider cannot support an alternate catalog (i.e. database) without supporting - alternate schemas as well; however, SQLite does not fit into this model. Therefore, this value is used - as a placeholder and removed prior to preparing any SQL statements that may contain it. - N - sqlite_default_schema - - - BinaryGUID - True - Store GUID columns in binary form
False - Store GUID columns as text
- N - True -
- - Cache Size - {size in bytes} - N - 2000 - - - Synchronous - Normal - Normal file flushing behavior
Full - Full flushing after all writes
Off - Underlying OS flushes I/O's
- N - Full -
- - Page Size - {size in bytes} - N - 1024 - - - Password - {password} - Using this parameter requires that the CryptoAPI based codec be enabled at compile-time for both the native interop assembly and the core managed assemblies; otherwise, using this parameter may result in an exception being thrown when attempting to open the connection. - N - - - - HexPassword - {hexPassword} - Must contain a sequence of zero or more hexadecimal encoded byte values without a leading "0x" prefix. Using this parameter requires that the CryptoAPI based codec be enabled at compile-time for both the native interop assembly and the core managed assemblies; otherwise, using this parameter may result in an exception being thrown when attempting to open the connection. - N - - - - Enlist - Y - Automatically enlist in distributed transactions
N - No automatic enlistment
- N - Y -
- - Pooling - - True - Use connection pooling.
- False - Do not use connection pooling.

- WARNING: When using the default connection pool implementation, - setting this property to True should be avoided by applications that make - use of COM (either directly or indirectly) due to possible deadlocks that - can occur during the finalization of some COM objects. -
- N - False -
- - FailIfMissing - True - Don't create the database if it does not exist, throw an error instead
False - Automatically create the database if it does not exist
- N - False -
- - Max Page Count - {size in pages} - Limits the maximum number of pages (limits the size) of the database - N - 0 - - - Legacy Format - True - Use the more compatible legacy 3.x database format
False - Use the newer 3.3x database format which compresses numbers more effectively
- N - False -
- - Default Timeout - {time in seconds}
The default command timeout
- N - 30 -
- - Journal Mode - Delete - Delete the journal file after a commit
Persist - Zero out and leave the journal file on disk after a commit
Off - Disable the rollback journal entirely
- N - Delete -
- - Read Only - True - Open the database for read only access
False - Open the database for normal read/write access
- N - False -
- - Max Pool Size - The maximum number of connections for the given connection string that can be in the connection pool - N - 100 - - - Default IsolationLevel - The default transaciton isolation level - N - Serializable - - - Foreign Keys - Enable foreign key constraints - N - False - - - Flags - Extra behavioral flags for the connection. See the enumeration for possible values. - N - Default - - - SetDefaults - - True - Apply the default connection settings to the opened database.
- False - Skip applying the default connection settings to the opened database. -
- N - True -
- - ToFullPath - - True - Attempt to expand the data source file name to a fully qualified path before opening.
- False - Skip attempting to expand the data source file name to a fully qualified path before opening. -
- N - True -
-
-
-
- - - The default "stub" (i.e. placeholder) base schema name to use when - returning column schema information. Used as the initial value of - the BaseSchemaName property. This should start with "sqlite_*" - because those names are reserved for use by SQLite (i.e. they cannot - be confused with the names of user objects). - - - - - The managed assembly containing this type. - - - - - Object used to synchronize access to the static instance data - for this class. - - - - - State of the current connection - - - - - The connection string - - - - - Nesting level of the transactions open on the connection - - - - - If set, then the connection is currently being disposed. - - - - - The default isolation level for new transactions - - - - - Whether or not the connection is enlisted in a distrubuted transaction - - - - - The per-connection mappings between type names and - values. These mappings override the corresponding global mappings. - - - - - The base SQLite object to interop with - - - - - The database filename minus path and extension - - - - - Temporary password storage, emptied after the database has been opened - - - - - The "stub" (i.e. placeholder) base schema name to use when returning - column schema information. - - - - - The extra behavioral flags for this connection, if any. See the - enumeration for a list of - possible values. - - - - - Default command timeout - - - - - Non-zero if the built-in (i.e. framework provided) connection string - parser should be used when opening the connection. - - - - - Constructs a new SQLiteConnection object - - - Default constructor - - - - - Initializes the connection with the specified connection string. - - The connection string to use. - - - - Initializes the connection with a pre-existing native connection handle. - This constructor overload is intended to be used only by the private - method. - - - The native connection handle to use. - - - The file name corresponding to the native connection handle. - - - Non-zero if this instance owns the native connection handle and - should dispose of it when it is no longer needed. - - - - - Initializes the connection with the specified connection string. - - - The connection string to use. - - - Non-zero to parse the connection string using the built-in (i.e. - framework provided) parser when opening the connection. - - - - - Clones the settings and connection string from an existing connection. If the existing connection is already open, this - function will open its own connection, enumerate any attached databases of the original connection, and automatically - attach to them. - - The connection to copy the settings from. - - - - Raises the event. - - - The connection associated with this event. If this parameter is not - null and the specified connection cannot raise events, then the - registered event handlers will not be invoked. - - - A that contains the event data. - - - - - Creates and returns a new managed database connection handle. This - method is intended to be used by implementations of the - interface only. In theory, it - could be used by other classes; however, that usage is not supported. - - - This must be a native database connection handle returned by the - SQLite core library and it must remain valid and open during the - entire duration of the calling method. - - - The new managed database connection handle or null if it cannot be - created. - - - - - Backs up the database, using the specified database connection as the - destination. - - The destination database connection. - The destination database name. - The source database name. - - The number of pages to copy or negative to copy all remaining pages. - - - The method to invoke between each step of the backup process. This - parameter may be null (i.e. no callbacks will be performed). - - - The number of milliseconds to sleep after encountering a locking error - during the backup process. A value less than zero means that no sleep - should be performed. - - - - - Clears the per-connection type mappings. - - - The total number of per-connection type mappings cleared. - - - - - Returns the per-connection type mappings. - - - The per-connection type mappings -OR- null if they are unavailable. - - - - - Adds a per-connection type mapping, possibly replacing one or more - that already exist. - - - The case-insensitive database type name (e.g. "MYDATE"). The value - of this parameter cannot be null. Using an empty string value (or - a string value consisting entirely of whitespace) for this parameter - is not recommended. - - - The value that should be associated with the - specified type name. - - - Non-zero if this mapping should be considered to be the primary one - for the specified . - - - A negative value if nothing was done. Zero if no per-connection type - mappings were replaced (i.e. it was a pure add operation). More than - zero if some per-connection type mappings were replaced. - - - - - Attempts to bind the specified object - instance to this connection. - - - The object instance containing - the metadata for the function to be bound. - - - The object instance that implements the - function to be bound. - - - - - Creates a clone of the connection. All attached databases and user-defined functions are cloned. If the existing connection is open, the cloned connection - will also be opened. - - - - - - Creates a database file. This just creates a zero-byte file which SQLite - will turn into a database when the file is opened properly. - - The file to create - - - - Raises the state change event when the state of the connection changes - - The new connection state. If this is different - from the previous state, the event is - raised. - The event data created for the raised event, if - it was actually raised. - - - - Determines and returns the fallback default isolation level when one cannot be - obtained from an existing connection instance. - - - The fallback default isolation level for this connection instance -OR- - if it cannot be determined. - - - - - Determines and returns the default isolation level for this connection instance. - - - The default isolation level for this connection instance -OR- - if it cannot be determined. - - - - - OBSOLETE. Creates a new SQLiteTransaction if one isn't already active on the connection. - - This parameter is ignored. - When TRUE, SQLite defers obtaining a write lock until a write operation is requested. - When FALSE, a writelock is obtained immediately. The default is TRUE, but in a multi-threaded multi-writer - environment, one may instead choose to lock the database immediately to avoid any possible writer deadlock. - Returns a SQLiteTransaction object. - - - - OBSOLETE. Creates a new SQLiteTransaction if one isn't already active on the connection. - - When TRUE, SQLite defers obtaining a write lock until a write operation is requested. - When FALSE, a writelock is obtained immediately. The default is false, but in a multi-threaded multi-writer - environment, one may instead choose to lock the database immediately to avoid any possible writer deadlock. - Returns a SQLiteTransaction object. - - - - Creates a new if one isn't already active on the connection. - - Supported isolation levels are Serializable, ReadCommitted and Unspecified. - - Unspecified will use the default isolation level specified in the connection string. If no isolation level is specified in the - connection string, Serializable is used. - Serializable transactions are the default. In this mode, the engine gets an immediate lock on the database, and no other threads - may begin a transaction. Other threads may read from the database, but not write. - With a ReadCommitted isolation level, locks are deferred and elevated as needed. It is possible for multiple threads to start - a transaction in ReadCommitted mode, but if a thread attempts to commit a transaction while another thread - has a ReadCommitted lock, it may timeout or cause a deadlock on both threads until both threads' CommandTimeout's are reached. - - Returns a SQLiteTransaction object. - - - - Creates a new if one isn't already - active on the connection. - - Returns the new transaction object. - - - - Forwards to the local function - - Supported isolation levels are Unspecified, Serializable, and ReadCommitted - - - - - This method is not implemented; however, the - event will still be raised. - - - - - - When the database connection is closed, all commands linked to this connection are automatically reset. - - - - - Clears the connection pool associated with the connection. Any other active connections using the same database file - will be discarded instead of returned to the pool when they are closed. - - - - - - Clears all connection pools. Any active connections will be discarded instead of sent to the pool when they are closed. - - - - - Create a new and associate it with this connection. - - Returns a new command object already assigned to this connection. - - - - Forwards to the local function. - - - - - - Parses the connection string into component parts using the custom - connection string parser. - - The connection string to parse - An array of key-value pairs representing each parameter of the connection string - - - - Parses a connection string using the built-in (i.e. framework provided) - connection string parser class and returns the key/value pairs. An - exception may be thrown if the connection string is invalid or cannot be - parsed. When compiled for the .NET Compact Framework, the custom - connection string parser is always used instead because the framework - provided one is unavailable there. - - - The connection string to parse. - - - Non-zero to throw an exception if any connection string values are not of - the type. - - The list of key/value pairs. - - - - Manual distributed transaction enlistment support - - The distributed transaction to enlist in - - - - Looks for a key in the array of key/values of the parameter string. If not found, return the specified default value - - The list to look in - The key to find - The default value to return if the key is not found - The value corresponding to the specified key, or the default value if not found. - - - - Attempts to convert the string value to an enumerated value of the specified type. - - The enumerated type to convert the string value to. - The string value to be converted. - Non-zero to make the conversion case-insensitive. - The enumerated value upon success or null upon error. - - - - Attempts to convert an input string into a byte value. - - - The string value to be converted. - - - The number styles to use for the conversion. - - - Upon sucess, this will contain the parsed byte value. - Upon failure, the value of this parameter is undefined. - - - Non-zero upon success; zero on failure. - - - - - Enables or disabled extension loading. - - - True to enable loading of extensions, false to disable. - - - - - Loads a SQLite extension library from the named dynamic link library file. - - - The name of the dynamic link library file containing the extension. - - - - - Loads a SQLite extension library from the named dynamic link library file. - - - The name of the dynamic link library file containing the extension. - - - The name of the exported function used to initialize the extension. - If null, the default "sqlite3_extension_init" will be used. - - - - - Creates a disposable module containing the implementation of a virtual - table. - - - The module object to be used when creating the disposable module. - - - - - Parses a string containing a sequence of zero or more hexadecimal - encoded byte values and returns the resulting byte array. The - "0x" prefix is not allowed on the input string. - - - The input string containing zero or more hexadecimal encoded byte - values. - - - A byte array containing the parsed byte values or null if an error - was encountered. - - - - - Creates and returns a string containing the hexadecimal encoded byte - values from the input array. - - - The input array of bytes. - - - The resulting string or null upon failure. - - - - - Parses a string containing a sequence of zero or more hexadecimal - encoded byte values and returns the resulting byte array. The - "0x" prefix is not allowed on the input string. - - - The input string containing zero or more hexadecimal encoded byte - values. - - - Upon failure, this will contain an appropriate error message. - - - A byte array containing the parsed byte values or null if an error - was encountered. - - - - - This method figures out what the default connection pool setting should - be based on the connection flags. When present, the "Pooling" connection - string property value always overrides the value returned by this method. - - - Non-zero if the connection pool should be enabled by default; otherwise, - zero. - - - - - Opens the connection using the parameters found in the . - - - - - Opens the connection using the parameters found in the and then returns it. - - The current connection object. - - - - This method causes any pending database operation to abort and return at - its earliest opportunity. This routine is typically called in response - to a user action such as pressing "Cancel" or Ctrl-C where the user wants - a long query operation to halt immediately. It is safe to call this - routine from any thread. However, it is not safe to call this routine - with a database connection that is closed or might close before this method - returns. - - - - - Returns various global memory statistics for the SQLite core library via - a dictionary of key/value pairs. Currently, only the "MemoryUsed" and - "MemoryHighwater" keys are returned and they have values that correspond - to the values that could be obtained via the - and connection properties. - - - This dictionary will be populated with the global memory statistics. It - will be created if necessary. - - - - - Attempts to free as much heap memory as possible for this database connection. - - - - - Attempts to free N bytes of heap memory by deallocating non-essential memory - allocations held by the database library. Memory used to cache database pages - to improve performance is an example of non-essential memory. This is a no-op - returning zero if the SQLite core library was not compiled with the compile-time - option SQLITE_ENABLE_MEMORY_MANAGEMENT. Optionally, attempts to reset and/or - compact the Win32 native heap, if applicable. - - - The requested number of bytes to free. - - - Non-zero to attempt a heap reset. - - - Non-zero to attempt heap compaction. - - - The number of bytes actually freed. This value may be zero. - - - This value will be non-zero if the heap reset was successful. - - - The size of the largest committed free block in the heap, in bytes. - This value will be zero unless heap compaction is enabled. - - - A standard SQLite return code (i.e. zero for success and non-zero - for failure). - - - - - Sets the status of the memory usage tracking subsystem in the SQLite core library. By default, this is enabled. - If this is disabled, memory usage tracking will not be performed. This is not really a per-connection value, it is - global to the process. - - Non-zero to enable memory usage tracking, zero otherwise. - A standard SQLite return code (i.e. zero for success and non-zero for failure). - - - - Passes a shutdown request to the SQLite core library. Does not throw - an exception if the shutdown request fails. - - - A standard SQLite return code (i.e. zero for success and non-zero for - failure). - - - - - Passes a shutdown request to the SQLite core library. Throws an - exception if the shutdown request fails and the no-throw parameter - is non-zero. - - - Non-zero to reset the database and temporary directories to their - default values, which should be null for both. - - - When non-zero, throw an exception if the shutdown request fails. - - - - Enables or disabled extended result codes returned by SQLite - - - Enables or disabled extended result codes returned by SQLite - - - Enables or disabled extended result codes returned by SQLite - - - Add a log message via the SQLite sqlite3_log interface. - - - Add a log message via the SQLite sqlite3_log interface. - - - - Change the password (or assign a password) to an open database. - - - No readers or writers may be active for this process. The database must already be open - and if it already was password protected, the existing password must already have been supplied. - - The new password to assign to the database - - - - Change the password (or assign a password) to an open database. - - - No readers or writers may be active for this process. The database must already be open - and if it already was password protected, the existing password must already have been supplied. - - The new password to assign to the database - - - - Sets the password for a password-protected database. A password-protected database is - unusable for any operation until the password has been set. - - The password for the database - - - - Sets the password for a password-protected database. A password-protected database is - unusable for any operation until the password has been set. - - The password for the database - - - - Queries or modifies the number of retries or the retry interval (in milliseconds) for - certain I/O operations that may fail due to anti-virus software. - - The number of times to retry the I/O operation. A negative value - will cause the current count to be queried and replace that negative value. - The number of milliseconds to wait before retrying the I/O - operation. This number is multiplied by the number of retry attempts so far to come - up with the final number of milliseconds to wait. A negative value will cause the - current interval to be queried and replace that negative value. - Zero for success, non-zero for error. - - - - Removes one set of surrounding single -OR- double quotes from the string - value and returns the resulting string value. If the string is null, empty, - or contains quotes that are not balanced, nothing is done and the original - string value will be returned. - - The string value to process. - - The string value, modified to remove one set of surrounding single -OR- - double quotes, if applicable. - - - - - Expand the filename of the data source, resolving the |DataDirectory| - macro as appropriate. - - The database filename to expand - - Non-zero if the returned file name should be converted to a full path - (except when using the .NET Compact Framework). - - The expanded path and filename of the filename - - - - The following commands are used to extract schema information out of the database. Valid schema types are: - - - MetaDataCollections - - - DataSourceInformation - - - Catalogs - - - Columns - - - ForeignKeys - - - Indexes - - - IndexColumns - - - Tables - - - Views - - - ViewColumns - - - - - Returns the MetaDataCollections schema - - A DataTable of the MetaDataCollections schema - - - - Returns schema information of the specified collection - - The schema collection to retrieve - A DataTable of the specified collection - - - - Retrieves schema information using the specified constraint(s) for the specified collection - - The collection to retrieve - The restrictions to impose - A DataTable of the specified collection - - - - Builds a MetaDataCollections schema datatable - - DataTable - - - - Builds a DataSourceInformation datatable - - DataTable - - - - Build a Columns schema - - The catalog (attached database) to query, can be null - The table to retrieve schema information for, must not be null - The column to retrieve schema information for, can be null - DataTable - - - - Returns index information for the given database and catalog - - The catalog (attached database) to query, can be null - The name of the index to retrieve information for, can be null - The table to retrieve index information for, can be null - DataTable - - - - Retrieves table schema information for the database and catalog - - The catalog (attached database) to retrieve tables on - The table to retrieve, can be null - The table type, can be null - DataTable - - - - Retrieves view schema information for the database - - The catalog (attached database) to retrieve views on - The view name, can be null - DataTable - - - - Retrieves catalog (attached databases) schema information for the database - - The catalog to retrieve, can be null - DataTable - - - - Returns the base column information for indexes in a database - - The catalog to retrieve indexes for (can be null) - The table to restrict index information by (can be null) - The index to restrict index information by (can be null) - The source column to restrict index information by (can be null) - A DataTable containing the results - - - - Returns detailed column information for a specified view - - The catalog to retrieve columns for (can be null) - The view to restrict column information by (can be null) - The source column to restrict column information by (can be null) - A DataTable containing the results - - - - Retrieves foreign key information from the specified set of filters - - An optional catalog to restrict results on - An optional table to restrict results on - An optional foreign key name to restrict results on - A DataTable with the results of the query - - - - Static variable to store the connection event handlers to call. - - - - - This event is raised whenever the database is opened or closed. - - - - - This event is raised when events related to the lifecycle of a - SQLiteConnection object occur. - - - - - This property is used to obtain or set the custom connection pool - implementation to use, if any. Setting this property to null will - cause the default connection pool implementation to be used. - - - - - Returns the number of pool entries for the file name associated with this connection. - - - - - The connection string containing the parameters for the connection - - - - - Parameter - Values - Required - Default - - - Data Source - - This may be a file name, the string ":memory:", or any supported URI (starting with SQLite 3.7.7). - Starting with release 1.0.86.0, in order to use more than one consecutive backslash (e.g. for a - UNC path), each of the adjoining backslash characters must be doubled (e.g. "\\Network\Share\test.db" - would become "\\\\Network\Share\test.db"). - - Y - - - - Version - 3 - N - 3 - - - UseUTF16Encoding - True
False
- N - False -
- - DateTimeFormat - - Ticks - Use the value of DateTime.Ticks.
- ISO8601 - Use the ISO-8601 format. Uses the "yyyy-MM-dd HH:mm:ss.FFFFFFFK" format for UTC - DateTime values and "yyyy-MM-dd HH:mm:ss.FFFFFFF" format for local DateTime values).
- JulianDay - The interval of time in days and fractions of a day since January 1, 4713 BC.
- UnixEpoch - The whole number of seconds since the Unix epoch (January 1, 1970).
- InvariantCulture - Any culture-independent string value that the .NET Framework can interpret as a valid DateTime.
- CurrentCulture - Any string value that the .NET Framework can interpret as a valid DateTime using the current culture.
- N - ISO8601 -
- - DateTimeKind - Unspecified - Not specified as either UTC or local time.
Utc - The time represented is UTC.
Local - The time represented is local time.
- N - Unspecified -
- - DateTimeFormatString - The exact DateTime format string to use for all formatting and parsing of all DateTime - values for this connection. - N - null - - - BaseSchemaName - Some base data classes in the framework (e.g. those that build SQL queries dynamically) - assume that an ADO.NET provider cannot support an alternate catalog (i.e. database) without supporting - alternate schemas as well; however, SQLite does not fit into this model. Therefore, this value is used - as a placeholder and removed prior to preparing any SQL statements that may contain it. - N - sqlite_default_schema - - - BinaryGUID - True - Store GUID columns in binary form
False - Store GUID columns as text
- N - True -
- - Cache Size - {size in bytes} - N - 2000 - - - Synchronous - Normal - Normal file flushing behavior
Full - Full flushing after all writes
Off - Underlying OS flushes I/O's
- N - Full -
- - Page Size - {size in bytes} - N - 1024 - - - Password - {password} - Using this parameter requires that the CryptoAPI based codec be enabled at compile-time for both the native interop assembly and the core managed assemblies; otherwise, using this parameter may result in an exception being thrown when attempting to open the connection. - N - - - - HexPassword - {hexPassword} - Must contain a sequence of zero or more hexadecimal encoded byte values without a leading "0x" prefix. Using this parameter requires that the CryptoAPI based codec be enabled at compile-time for both the native interop assembly and the core managed assemblies; otherwise, using this parameter may result in an exception being thrown when attempting to open the connection. - N - - - - Enlist - Y - Automatically enlist in distributed transactions
N - No automatic enlistment
- N - Y -
- - Pooling - - True - Use connection pooling.
- False - Do not use connection pooling.

- WARNING: When using the default connection pool implementation, - setting this property to True should be avoided by applications that - make use of COM (either directly or indirectly) due to possible - deadlocks that can occur during the finalization of some COM objects. -
- N - False -
- - FailIfMissing - True - Don't create the database if it does not exist, throw an error instead
False - Automatically create the database if it does not exist
- N - False -
- - Max Page Count - {size in pages} - Limits the maximum number of pages (limits the size) of the database - N - 0 - - - Legacy Format - True - Use the more compatible legacy 3.x database format
False - Use the newer 3.3x database format which compresses numbers more effectively
- N - False -
- - Default Timeout - {time in seconds}
The default command timeout
- N - 30 -
- - Journal Mode - Delete - Delete the journal file after a commit
Persist - Zero out and leave the journal file on disk after a commit
Off - Disable the rollback journal entirely
- N - Delete -
- - Read Only - True - Open the database for read only access
False - Open the database for normal read/write access
- N - False -
- - Max Pool Size - The maximum number of connections for the given connection string that can be in the connection pool - N - 100 - - - Default IsolationLevel - The default transaciton isolation level - N - Serializable - - - Foreign Keys - Enable foreign key constraints - N - False - - - Flags - Extra behavioral flags for the connection. See the enumeration for possible values. - N - Default - - - SetDefaults - - True - Apply the default connection settings to the opened database.
- False - Skip applying the default connection settings to the opened database. -
- N - True -
- - ToFullPath - - True - Attempt to expand the data source file name to a fully qualified path before opening.
- False - Skip attempting to expand the data source file name to a fully qualified path before opening. -
- N - True -
-
-
-
- - - Returns the data source file name without extension or path. - - - - - Returns the string "main". - - - - - Gets/sets the default command timeout for newly-created commands. This is especially useful for - commands used internally such as inside a SQLiteTransaction, where setting the timeout is not possible. - This can also be set in the ConnectionString with "Default Timeout" - - - - - Non-zero if the built-in (i.e. framework provided) connection string - parser should be used when opening the connection. - - - - - Gets/sets the extra behavioral flags for this connection. See the - enumeration for a list of - possible values. - - - - - Returns non-zero if the underlying native connection handle is - owned by this instance. - - - - - Returns the version of the underlying SQLite database engine - - - - - Returns the rowid of the most recent successful INSERT into the database from this connection. - - - - - Returns the number of rows changed by the last INSERT, UPDATE, or DELETE statement executed on - this connection. - - - - - Returns non-zero if the given database connection is in autocommit mode. - Autocommit mode is on by default. Autocommit mode is disabled by a BEGIN - statement. Autocommit mode is re-enabled by a COMMIT or ROLLBACK. - - - - - Returns the amount of memory (in bytes) currently in use by the SQLite core library. - - - - - Returns the maximum amount of memory (in bytes) used by the SQLite core library since the high-water mark was last reset. - - - - - Returns a string containing the define constants (i.e. compile-time - options) used to compile the core managed assembly, delimited with - spaces. - - - - - Returns the version of the underlying SQLite core library. - - - - - This method returns the string whose value is the same as the - SQLITE_SOURCE_ID C preprocessor macro used when compiling the - SQLite core library. - - - - - Returns a string containing the compile-time options used to - compile the SQLite core native library, delimited with spaces. - - - - - This method returns the version of the interop SQLite assembly - used. If the SQLite interop assembly is not in use or the - necessary information cannot be obtained for any reason, a null - value may be returned. - - - - - This method returns the string whose value contains the unique - identifier for the source checkout used to build the interop - assembly. If the SQLite interop assembly is not in use or the - necessary information cannot be obtained for any reason, a null - value may be returned. - - - - - Returns a string containing the compile-time options used to - compile the SQLite interop assembly, delimited with spaces. - - - - - This method returns the version of the managed components used - to interact with the SQLite core library. If the necessary - information cannot be obtained for any reason, a null value may - be returned. - - - - - This method returns the string whose value contains the unique - identifier for the source checkout used to build the managed - components currently executing. If the necessary information - cannot be obtained for any reason, a null value may be returned. - - - - - Returns the state of the connection. - - - - - This event is raised whenever SQLite encounters an action covered by the - authorizer during query preparation. Changing the value of the - property will determine if - the specific action will be allowed, ignored, or denied. For the entire - duration of the event, the associated connection and statement objects - must not be modified, either directly or indirectly, by the called code. - - - - - This event is raised whenever SQLite makes an update/delete/insert into the database on - this connection. It only applies to the given connection. - - - - - This event is raised whenever SQLite is committing a transaction. - Return non-zero to trigger a rollback. - - - - - This event is raised whenever SQLite statement first begins executing on - this connection. It only applies to the given connection. - - - - - This event is raised whenever SQLite is rolling back a transaction. - - - - - Returns the instance. - - - - - The I/O file cache flushing behavior for the connection - - - - - Normal file flushing at critical sections of the code - - - - - Full file flushing after every write operation - - - - - Use the default operating system's file flushing, SQLite does not explicitly flush the file buffers after writing - - - - - Raised when authorization is required to perform an action contained - within a SQL query. - - The connection performing the action. - A that contains the - event data. - - - - Raised when a transaction is about to be committed. To roll back a transaction, set the - rollbackTrans boolean value to true. - - The connection committing the transaction - Event arguments on the transaction - - - - Raised when data is inserted, updated and deleted on a given connection - - The connection committing the transaction - The event parameters which triggered the event - - - - Raised when a statement first begins executing on a given connection - - The connection executing the statement - Event arguments of the trace - - - - Raised between each backup step. - - - The source database connection. - - - The source database name. - - - The destination database connection. - - - The destination database name. - - - The number of pages copied with each step. - - - The number of pages remaining to be copied. - - - The total number of pages in the source database. - - - Set to true if the operation needs to be retried due to database - locking issues; otherwise, set to false. - - - True to continue with the backup process or false to halt the backup - process, rolling back any changes that have been made so far. - - - - - The data associated with a call into the authorizer. - - - - - The user-defined native data associated with this event. Currently, - this will always contain the value of . - - - - - The action code responsible for the current call into the authorizer. - - - - - The first string argument for the current call into the authorizer. - The exact value will vary based on the action code, see the - enumeration for possible - values. - - - - - The second string argument for the current call into the authorizer. - The exact value will vary based on the action code, see the - enumeration for possible - values. - - - - - The database name for the current call into the authorizer, if - applicable. - - - - - The name of the inner-most trigger or view that is responsible for - the access attempt or a null value if this access attempt is directly - from top-level SQL code. - - - - - The return code for the current call into the authorizer. - - - - - Constructs an instance of this class with default property values. - - - - - Constructs an instance of this class with specific property values. - - - The user-defined native data associated with this event. - - - The authorizer action code. - - - The first authorizer argument. - - - The second authorizer argument. - - - The database name, if applicable. - - - The name of the inner-most trigger or view that is responsible for - the access attempt or a null value if this access attempt is directly - from top-level SQL code. - - - The authorizer return code. - - - - - Whenever an update event is triggered on a connection, this enum will indicate - exactly what type of operation is being performed. - - - - - A row is being deleted from the given database and table - - - - - A row is being inserted into the table. - - - - - A row is being updated in the table. - - - - - Passed during an Update callback, these event arguments detail the type of update operation being performed - on the given connection. - - - - - The name of the database being updated (usually "main" but can be any attached or temporary database) - - - - - The name of the table being updated - - - - - The type of update being performed (insert/update/delete) - - - - - The RowId affected by this update. - - - - - Event arguments raised when a transaction is being committed - - - - - Set to true to abort the transaction and trigger a rollback - - - - - Passed during an Trace callback, these event arguments contain the UTF-8 rendering of the SQL statement text - - - - - SQL statement text as the statement first begins executing - - - - - This interface represents a custom connection pool implementation - usable by System.Data.SQLite. - - - - - Counts the number of pool entries matching the specified file name. - - - The file name to match or null to match all files. - - - The pool entry counts for each matching file. - - - The total number of connections successfully opened from any pool. - - - The total number of connections successfully closed from any pool. - - - The total number of pool entries for all matching files. - - - - - Disposes of all pooled connections associated with the specified - database file name. - - - The database file name. - - - - - Disposes of all pooled connections. - - - - - Adds a connection to the pool of those associated with the - specified database file name. - - - The database file name. - - - The database connection handle. - - - The connection pool version at the point the database connection - handle was received from the connection pool. This is also the - connection pool version that the database connection handle was - created under. - - - - - Removes a connection from the pool of those associated with the - specified database file name with the intent of using it to - interact with the database. - - - The database file name. - - - The new maximum size of the connection pool for the specified - database file name. - - - The connection pool version associated with the returned database - connection handle, if any. - - - The database connection handle associated with the specified - database file name or null if it cannot be obtained. - - - - - This default method implementations in this class should not be used by - applications that make use of COM (either directly or indirectly) due - to possible deadlocks that can occur during finalization of some COM - objects. - - - - - This field is used to synchronize access to the private static data - in this class. - - - - - When this field is non-null, it will be used to provide the - implementation of all the connection pool methods; otherwise, - the default method implementations will be used. - - - - - The dictionary of connection pools, based on the normalized file - name of the SQLite database. - - - - - The default version number new pools will get. - - - - - The number of connections successfully opened from any pool. - This value is incremented by the Remove method. - - - - - The number of connections successfully closed from any pool. - This value is incremented by the Add method. - - - - - Counts the number of pool entries matching the specified file name. - - - The file name to match or null to match all files. - - - The pool entry counts for each matching file. - - - The total number of connections successfully opened from any pool. - - - The total number of connections successfully closed from any pool. - - - The total number of pool entries for all matching files. - - - - - Disposes of all pooled connections associated with the specified - database file name. - - - The database file name. - - - - - Disposes of all pooled connections. - - - - - Adds a connection to the pool of those associated with the - specified database file name. - - - The database file name. - - - The database connection handle. - - - The connection pool version at the point the database connection - handle was received from the connection pool. This is also the - connection pool version that the database connection handle was - created under. - - - - - Removes a connection from the pool of those associated with the - specified database file name with the intent of using it to - interact with the database. - - - The database file name. - - - The new maximum size of the connection pool for the specified - database file name. - - - The connection pool version associated with the returned database - connection handle, if any. - - - The database connection handle associated with the specified - database file name or null if it cannot be obtained. - - - - - This method is used to obtain a reference to the custom connection - pool implementation currently in use, if any. - - - The custom connection pool implementation or null if the default - connection pool implementation should be used. - - - - - This method is used to set the reference to the custom connection - pool implementation to use, if any. - - - The custom connection pool implementation to use or null if the - default connection pool implementation should be used. - - - - - We do not have to thread-lock anything in this function, because it - is only called by other functions above which already take the lock. - - - The pool queue to resize. - - - If a function intends to add to the pool, this is true, which - forces the resize to take one more than it needs from the pool. - - - - - Keeps track of connections made on a specified file. The PoolVersion - dictates whether old objects get returned to the pool or discarded - when no longer in use. - - - - - The queue of weak references to the actual database connection - handles. - - - - - This pool version associated with the database connection - handles in this pool queue. - - - - - The maximum size of this pool queue. - - - - - Constructs a connection pool queue using the specified version - and maximum size. Normally, all the database connection - handles in this pool are associated with a single database file - name. - - - The initial pool version for this connection pool queue. - - - The initial maximum size for this connection pool queue. - - - - - SQLite implementation of DbConnectionStringBuilder. - - - - - Properties of this class - - - - - Constructs a new instance of the class - - - Default constructor - - - - - Constructs a new instance of the class using the specified connection string. - - The connection string to parse - - - - Private initializer, which assigns the connection string and resets the builder - - The connection string to assign - - - - Helper function for retrieving values from the connectionstring - - The keyword to retrieve settings for - The resulting parameter value - Returns true if the value was found and returned - - - - Fallback method for MONO, which doesn't implement DbConnectionStringBuilder.GetProperties() - - The hashtable to fill with property descriptors - - - - Gets/Sets the default version of the SQLite engine to instantiate. Currently the only valid value is 3, indicating version 3 of the sqlite library. - - - - - Gets/Sets the synchronization mode (file flushing) of the connection string. Default is "Normal". - - - - - Gets/Sets the encoding for the connection string. The default is "False" which indicates UTF-8 encoding. - - - - - Gets/Sets whether or not to use connection pooling. The default is "False" - - - - - Gets/Sets whethor not to store GUID's in binary format. The default is True - which saves space in the database. - - - - - Gets/Sets the filename to open on the connection string. - - - - - An alternate to the data source property - - - - - An alternate to the data source property that uses the SQLite URI syntax. - - - - - Gets/sets the default command timeout for newly-created commands. This is especially useful for - commands used internally such as inside a SQLiteTransaction, where setting the timeout is not possible. - - - - - Determines whether or not the connection will automatically participate - in the current distributed transaction (if one exists) - - - - - If set to true, will throw an exception if the database specified in the connection - string does not exist. If false, the database will be created automatically. - - - - - If enabled, uses the legacy 3.xx format for maximum compatibility, but results in larger - database sizes. - - - - - When enabled, the database will be opened for read-only access and writing will be disabled. - - - - - Gets/sets the database encryption password - - - - - Gets/sets the database encryption hexadecimal password - - - - - Gets/Sets the page size for the connection. - - - - - Gets/Sets the maximum number of pages the database may hold - - - - - Gets/Sets the cache size for the connection. - - - - - Gets/Sets the DateTime format for the connection. - - - - - Gets/Sets the DateTime kind for the connection. - - - - - Gets/sets the DateTime format string used for formatting - and parsing purposes. - - - - - Gets/Sets the placeholder base schema name used for - .NET Framework compatibility purposes. - - - - - Determines how SQLite handles the transaction journal file. - - - - - Sets the default isolation level for transactions on the connection. - - - - - If enabled, use foreign key constraints - - - - - Gets/Sets the extra behavioral flags. - - - - - If enabled, apply the default connection settings to opened databases. - - - - - If enabled, attempt to resolve the provided data source file name to a - full path before opening. - - - - - SQLite has very limited types, and is inherently text-based. The first 5 types below represent the sum of all types SQLite - understands. The DateTime extension to the spec is for internal use only. - - - - - Not used - - - - - All integers in SQLite default to Int64 - - - - - All floating point numbers in SQLite default to double - - - - - The default data type of SQLite is text - - - - - Typically blob types are only seen when returned from a function - - - - - Null types can be returned from functions - - - - - Used internally by this provider - - - - - Used internally by this provider - - - - - These are the event types associated with the - - delegate (and its corresponding event) and the - class. - - - - - Not used. - - - - - Not used. - - - - - The connection is being opened. - - - - - The connection string has been parsed. - - - - - The connection was opened. - - - - - The method was called on the - connection. - - - - - A transaction was created using the connection. - - - - - The connection was enlisted into a transaction. - - - - - A command was created using the connection. - - - - - A data reader was created using the connection. - - - - - An instance of a derived class has - been created to wrap a native resource. - - - - - The connection is being closed. - - - - - The connection was closed. - - - - - This implementation of SQLite for ADO.NET can process date/time fields in - databases in one of six formats. - - - ISO8601 format is more compatible, readable, fully-processable, but less - accurate as it does not provide time down to fractions of a second. - JulianDay is the numeric format the SQLite uses internally and is arguably - the most compatible with 3rd party tools. It is not readable as text - without post-processing. Ticks less compatible with 3rd party tools that - query the database, and renders the DateTime field unreadable as text - without post-processing. UnixEpoch is more compatible with Unix systems. - InvariantCulture allows the configured format for the invariant culture - format to be used and is human readable. CurrentCulture allows the - configured format for the current culture to be used and is also human - readable. - - The preferred order of choosing a DateTime format is JulianDay, ISO8601, - and then Ticks. Ticks is mainly present for legacy code support. - - - - - Use the value of DateTime.Ticks. This value is not recommended and is not well supported with LINQ. - - - - - Use the ISO-8601 format. Uses the "yyyy-MM-dd HH:mm:ss.FFFFFFFK" format for UTC DateTime values and - "yyyy-MM-dd HH:mm:ss.FFFFFFF" format for local DateTime values). - - - - - The interval of time in days and fractions of a day since January 1, 4713 BC. - - - - - The whole number of seconds since the Unix epoch (January 1, 1970). - - - - - Any culture-independent string value that the .NET Framework can interpret as a valid DateTime. - - - - - Any string value that the .NET Framework can interpret as a valid DateTime using the current culture. - - - - - The default format for this provider. - - - - - This enum determines how SQLite treats its journal file. - - - By default SQLite will create and delete the journal file when needed during a transaction. - However, for some computers running certain filesystem monitoring tools, the rapid - creation and deletion of the journal file can cause those programs to fail, or to interfere with SQLite. - - If a program or virus scanner is interfering with SQLite's journal file, you may receive errors like "unable to open database file" - when starting a transaction. If this is happening, you may want to change the default journal mode to Persist. - - - - - The default mode, this causes SQLite to use the existing journaling mode for the database. - - - - - SQLite will create and destroy the journal file as-needed. - - - - - When this is set, SQLite will keep the journal file even after a transaction has completed. It's contents will be erased, - and the journal re-used as often as needed. If it is deleted, it will be recreated the next time it is needed. - - - - - This option disables the rollback journal entirely. Interrupted transactions or a program crash can cause database - corruption in this mode! - - - - - SQLite will truncate the journal file to zero-length instead of deleting it. - - - - - SQLite will store the journal in volatile RAM. This saves disk I/O but at the expense of database safety and integrity. - If the application using SQLite crashes in the middle of a transaction when the MEMORY journaling mode is set, then the - database file will very likely go corrupt. - - - - - SQLite uses a write-ahead log instead of a rollback journal to implement transactions. The WAL journaling mode is persistent; - after being set it stays in effect across multiple database connections and after closing and reopening the database. A database - in WAL journaling mode can only be accessed by SQLite version 3.7.0 or later. - - - - - Possible values for the "synchronous" database setting. This setting determines - how often the database engine calls the xSync method of the VFS. - - - - - Use the default "synchronous" database setting. Currently, this should be - the same as using the FULL mode. - - - - - The database engine continues without syncing as soon as it has handed - data off to the operating system. If the application running SQLite - crashes, the data will be safe, but the database might become corrupted - if the operating system crashes or the computer loses power before that - data has been written to the disk surface. - - - - - The database engine will still sync at the most critical moments, but - less often than in FULL mode. There is a very small (though non-zero) - chance that a power failure at just the wrong time could corrupt the - database in NORMAL mode. - - - - - The database engine will use the xSync method of the VFS to ensure that - all content is safely written to the disk surface prior to continuing. - This ensures that an operating system crash or power failure will not - corrupt the database. FULL synchronous is very safe, but it is also - slower. - - - - - The requested command execution type. This controls which method of the - object will be called. - - - - - Do nothing. No method will be called. - - - - - The command is not expected to return a result -OR- the result is not - needed. The or - method - will be called. - - - - - The command is expected to return a scalar result -OR- the result should - be limited to a scalar result. The - or method will - be called. - - - - - The command is expected to return result. - The or - method will - be called. - - - - - Use the default command execution type. Using this value is the same - as using the value. - - - - - The action code responsible for the current call into the authorizer. - - - - - No action is being performed. This value should not be used from - external code. - - - - - No longer used. - - - - - An index will be created. The action-specific arguments are the - index name and the table name. - - - - - - A table will be created. The action-specific arguments are the - table name and a null value. - - - - - A temporary index will be created. The action-specific arguments - are the index name and the table name. - - - - - A temporary table will be created. The action-specific arguments - are the table name and a null value. - - - - - A temporary trigger will be created. The action-specific arguments - are the trigger name and the table name. - - - - - A temporary view will be created. The action-specific arguments are - the view name and a null value. - - - - - A trigger will be created. The action-specific arguments are the - trigger name and the table name. - - - - - A view will be created. The action-specific arguments are the view - name and a null value. - - - - - A DELETE statement will be executed. The action-specific arguments - are the table name and a null value. - - - - - An index will be dropped. The action-specific arguments are the - index name and the table name. - - - - - A table will be dropped. The action-specific arguments are the tables - name and a null value. - - - - - A temporary index will be dropped. The action-specific arguments are - the index name and the table name. - - - - - A temporary table will be dropped. The action-specific arguments are - the table name and a null value. - - - - - A temporary trigger will be dropped. The action-specific arguments - are the trigger name and the table name. - - - - - A temporary view will be dropped. The action-specific arguments are - the view name and a null value. - - - - - A trigger will be dropped. The action-specific arguments are the - trigger name and the table name. - - - - - A view will be dropped. The action-specific arguments are the view - name and a null value. - - - - - An INSERT statement will be executed. The action-specific arguments - are the table name and a null value. - - - - - A PRAGMA statement will be executed. The action-specific arguments - are the name of the PRAGMA and the new value or a null value. - - - - - A table column will be read. The action-specific arguments are the - table name and the column name. - - - - - A SELECT statement will be executed. The action-specific arguments - are both null values. - - - - - A transaction will be started, committed, or rolled back. The - action-specific arguments are the name of the operation (BEGIN, - COMMIT, or ROLLBACK) and a null value. - - - - - An UPDATE statement will be executed. The action-specific arguments - are the table name and the column name. - - - - - A database will be attached to the connection. The action-specific - arguments are the database file name and a null value. - - - - - A database will be detached from the connection. The action-specific - arguments are the database name and a null value. - - - - - The schema of a table will be altered. The action-specific arguments - are the database name and the table name. - - - - - An index will be deleted and then recreated. The action-specific - arguments are the index name and a null value. - - - - - A table will be analyzed to gathers statistics about it. The - action-specific arguments are the table name and a null value. - - - - - A virtual table will be created. The action-specific arguments are - the table name and the module name. - - - - - A virtual table will be dropped. The action-specific arguments are - the table name and the module name. - - - - - A SQL function will be called. The action-specific arguments are a - null value and the function name. - - - - - A savepoint will be created, released, or rolled back. The - action-specific arguments are the name of the operation (BEGIN, - RELEASE, or ROLLBACK) and the savepoint name. - - - - - A recursive query will be executed. The action-specific arguments - are two null values. - - - - - The return code for the current call into the authorizer. - - - - - The action will be allowed. - - - - - The overall action will be disallowed and an error message will be - returned from the query preparation method. - - - - - The specific action will be disallowed; however, the overall action - will continue. The exact effects of this return code vary depending - on the specific action, please refer to the SQLite core library - documentation for futher details. - - - - - Class used internally to determine the datatype of a column in a resultset - - - - - The DbType of the column, or DbType.Object if it cannot be determined - - - - - The affinity of a column, used for expressions or when Type is DbType.Object - - - - - SQLite implementation of DbDataAdapter. - - - - - This class is just a shell around the DbDataAdapter. Nothing from - DbDataAdapter is overridden here, just a few constructors are defined. - - - Default constructor. - - - - - Constructs a data adapter using the specified select command. - - - The select command to associate with the adapter. - - - - - Constructs a data adapter with the supplied select command text and - associated with the specified connection. - - - The select command text to associate with the data adapter. - - - The connection to associate with the select command. - - - - - Constructs a data adapter with the specified select command text, - and using the specified database connection string. - - - The select command text to use to construct a select command. - - - A connection string suitable for passing to a new SQLiteConnection, - which is associated with the select command. - - - - - Constructs a data adapter with the specified select command text, - and using the specified database connection string. - - - The select command text to use to construct a select command. - - - A connection string suitable for passing to a new SQLiteConnection, - which is associated with the select command. - - - Non-zero to parse the connection string using the built-in (i.e. - framework provided) parser when opening the connection. - - - - - Raised by the underlying DbDataAdapter when a row is being updated - - The event's specifics - - - - Raised by DbDataAdapter after a row is updated - - The event's specifics - - - - Row updating event handler - - - - - Row updated event handler - - - - - Gets/sets the select command for this DataAdapter - - - - - Gets/sets the insert command for this DataAdapter - - - - - Gets/sets the update command for this DataAdapter - - - - - Gets/sets the delete command for this DataAdapter - - - - - SQLite implementation of DbDataReader. - - - - - Underlying command this reader is attached to - - - - - Index of the current statement in the command being processed - - - - - Current statement being Read() - - - - - State of the current statement being processed. - -1 = First Step() executed, so the first Read() will be ignored - 0 = Actively reading - 1 = Finished reading - 2 = Non-row-returning statement, no records - - - - - Number of records affected by the insert/update statements executed on the command - - - - - Count of fields (columns) in the row-returning statement currently being processed - - - - - Maps the field (column) names to their corresponding indexes within the results. - - - - - Datatypes of active fields (columns) in the current statement, used for type-restricting data - - - - - The behavior of the datareader - - - - - If set, then dispose of the command object when the reader is finished - - - - - If set, then raise an exception when the object is accessed after being disposed. - - - - - An array of rowid's for the active statement if CommandBehavior.KeyInfo is specified - - - - - Matches the version of the connection. - - - - - The "stub" (i.e. placeholder) base schema name to use when returning - column schema information. Matches the base schema name used by the - associated connection. - - - - - Internal constructor, initializes the datareader and sets up to begin executing statements - - The SQLiteCommand this data reader is for - The expected behavior of the data reader - - - - Dispose of all resources used by this datareader. - - - - - - Closes the datareader, potentially closing the connection as well if CommandBehavior.CloseConnection was specified. - - - - - Throw an error if the datareader is closed - - - - - Throw an error if a row is not loaded - - - - - Enumerator support - - Returns a DbEnumerator object. - - - - SQLite is inherently un-typed. All datatypes in SQLite are natively strings. The definition of the columns of a table - and the affinity of returned types are all we have to go on to type-restrict data in the reader. - - This function attempts to verify that the type of data being requested of a column matches the datatype of the column. In - the case of columns that are not backed into a table definition, we attempt to match up the affinity of a column (int, double, string or blob) - to a set of known types that closely match that affinity. It's not an exact science, but its the best we can do. - - - This function throws an InvalidTypeCast() exception if the requested type doesn't match the column's definition or affinity. - - The index of the column to type-check - The type we want to get out of the column - - - - Retrieves the column as a boolean value - - The index of the column to retrieve - bool - - - - Retrieves the column as a single byte value - - The index of the column to retrieve - byte - - - - Retrieves a column as an array of bytes (blob) - - The index of the column to retrieve - The zero-based index of where to begin reading the data - The buffer to write the bytes into - The zero-based index of where to begin writing into the array - The number of bytes to retrieve - The actual number of bytes written into the array - - To determine the number of bytes in the column, pass a null value for the buffer. The total length will be returned. - - - - - Returns the column as a single character - - The index of the column to retrieve - char - - - - Retrieves a column as an array of chars (blob) - - The index of the column to retrieve - The zero-based index of where to begin reading the data - The buffer to write the characters into - The zero-based index of where to begin writing into the array - The number of bytes to retrieve - The actual number of characters written into the array - - To determine the number of characters in the column, pass a null value for the buffer. The total length will be returned. - - - - - Retrieves the name of the back-end datatype of the column - - The index of the column to retrieve - string - - - - Retrieve the column as a date/time value - - The index of the column to retrieve - DateTime - - - - Retrieve the column as a decimal value - - The index of the column to retrieve - decimal - - - - Returns the column as a double - - The index of the column to retrieve - double - - - - Returns the .NET type of a given column - - The index of the column to retrieve - Type - - - - Returns a column as a float value - - The index of the column to retrieve - float - - - - Returns the column as a Guid - - The index of the column to retrieve - Guid - - - - Returns the column as a short - - The index of the column to retrieve - Int16 - - - - Retrieves the column as an int - - The index of the column to retrieve - Int32 - - - - Retrieves the column as a long - - The index of the column to retrieve - Int64 - - - - Retrieves the name of the column - - The index of the column to retrieve - string - - - - Retrieves the i of a column, given its name - - The name of the column to retrieve - The int i of the column - - - - Schema information in SQLite is difficult to map into .NET conventions, so a lot of work must be done - to gather the necessary information so it can be represented in an ADO.NET manner. - - Returns a DataTable containing the schema information for the active SELECT statement being processed. - - - - Retrieves the column as a string - - The index of the column to retrieve - string - - - - Retrieves the column as an object corresponding to the underlying datatype of the column - - The index of the column to retrieve - object - - - - Retreives the values of multiple columns, up to the size of the supplied array - - The array to fill with values from the columns in the current resultset - The number of columns retrieved - - - - Returns a collection containing all the column names and values for the - current row of data in the current resultset, if any. If there is no - current row or no current resultset, an exception may be thrown. - - - The collection containing the column name and value information for the - current row of data in the current resultset or null if this information - cannot be obtained. - - - - - Returns True if the specified column is null - - The index of the column to retrieve - True or False - - - - Moves to the next resultset in multiple row-returning SQL command. - - True if the command was successful and a new resultset is available, False otherwise. - - - - This method attempts to query the database connection associated with - the data reader in use. If the underlying command or connection is - unavailable, a null value will be returned. - - - The connection object -OR- null if it is unavailable. - - - - - This method attempts to query the flags associated with the database - connection in use. If the database connection is disposed, the default - flags will be returned. - - - The data reader containing the databse connection to query the flags from. - - - The connection flags value. - - - - - Retrieves the SQLiteType for a given column, and caches it to avoid repetetive interop calls. - - The index of the column to retrieve - A SQLiteType structure - - - - Reads the next row from the resultset - - True if a new row was successfully loaded and is ready for processing - - - - Not implemented. Returns 0 - - - - - Returns the number of columns in the current resultset - - - - - Returns the number of visible fields in the current resultset - - - - - Returns True if the resultset has rows that can be fetched - - - - - Returns True if the data reader is closed - - - - - Retrieve the count of records affected by an update/insert command. Only valid once the data reader is closed! - - - - - Indexer to retrieve data from a column given its name - - The name of the column to retrieve data for - The value contained in the column - - - - Indexer to retrieve data from a column given its i - - The index of the column to retrieve - The value contained in the column - - - - SQLite exception class. - - - - - Private constructor for use with serialization. - - - Holds the serialized object data about the exception being thrown. - - - Contains contextual information about the source or destination. - - - - - Public constructor for generating a SQLite exception given the error - code and message. - - - The SQLite return code to report. - - - Message text to go along with the return code message text. - - - - - Public constructor that uses the base class constructor for the error - message. - - Error message text. - - - - Public constructor that uses the default base class constructor. - - - - - Public constructor that uses the base class constructor for the error - message and inner exception. - - Error message text. - The original (inner) exception. - - - - Adds extra information to the serialized object data specific to this - class type. This is only used for serialization. - - - Holds the serialized object data about the exception being thrown. - - - Contains contextual information about the source or destination. - - - - - Returns the error message for the specified SQLite return code. - - The SQLite return code. - The error message or null if it cannot be found. - - - - Returns the composite error message based on the SQLite return code - and the optional detailed error message. - - The SQLite return code. - Optional detailed error message. - Error message text for the return code. - - - - Gets the associated SQLite result code for this exception as a - . This property returns the same - underlying value as the property. - - - - - Gets the associated SQLite return code for this exception as an - . For desktop versions of the .NET Framework, - this property overrides the property of the same name within the - - class. This property returns the same underlying value as the - property. - - - - - SQLite error codes. Actually, this enumeration represents a return code, - which may also indicate success in one of several ways (e.g. SQLITE_OK, - SQLITE_ROW, and SQLITE_DONE). Therefore, the name of this enumeration is - something of a misnomer. - - - - - The error code is unknown. This error code - is only used by the managed wrapper itself. - - - - - Successful result - - - - - SQL error or missing database - - - - - Internal logic error in SQLite - - - - - Access permission denied - - - - - Callback routine requested an abort - - - - - The database file is locked - - - - - A table in the database is locked - - - - - A malloc() failed - - - - - Attempt to write a readonly database - - - - - Operation terminated by sqlite3_interrupt() - - - - - Some kind of disk I/O error occurred - - - - - The database disk image is malformed - - - - - Unknown opcode in sqlite3_file_control() - - - - - Insertion failed because database is full - - - - - Unable to open the database file - - - - - Database lock protocol error - - - - - Database is empty - - - - - The database schema changed - - - - - String or BLOB exceeds size limit - - - - - Abort due to constraint violation - - - - - Data type mismatch - - - - - Library used incorrectly - - - - - Uses OS features not supported on host - - - - - Authorization denied - - - - - Auxiliary database format error - - - - - 2nd parameter to sqlite3_bind out of range - - - - - File opened that is not a database file - - - - - Notifications from sqlite3_log() - - - - - Warnings from sqlite3_log() - - - - - sqlite3_step() has another row ready - - - - - sqlite3_step() has finished executing - - - - - Used to mask off extended result codes - - - - - SQLite implementation of . - - - SQLite implementation of . - - - - - Constructs a new instance. - - - - - Static instance member which returns an instanced class. - - - - - Creates and returns a new object. - - The new object. - - - - Creates and returns a new object. - - The new object. - - - - Creates and returns a new object. - - The new object. - - - - Creates and returns a new object. - - The new object. - - - - Creates and returns a new object. - - The new object. - - - - Creates and returns a new object. - - The new object. - - - - Will provide a object in .NET 3.5. - - The class or interface type to query for. - - - - - This event is raised whenever SQLite raises a logging event. - Note that this should be set as one of the first things in the - application. This event is provided for backward compatibility only. - New code should use the class instead. - - - - - This abstract class is designed to handle user-defined functions easily. An instance of the derived class is made for each - connection to the database. - - - Although there is one instance of a class derived from SQLiteFunction per database connection, the derived class has no access - to the underlying connection. This is necessary to deter implementers from thinking it would be a good idea to make database - calls during processing. - - It is important to distinguish between a per-connection instance, and a per-SQL statement context. One instance of this class - services all SQL statements being stepped through on that connection, and there can be many. One should never store per-statement - information in member variables of user-defined function classes. - - For aggregate functions, always create and store your per-statement data in the contextData object on the 1st step. This data will - be automatically freed for you (and Dispose() called if the item supports IDisposable) when the statement completes. - - - - - The base connection this function is attached to - - - - - Internal array used to keep track of aggregate function context data - - - - - The connection flags associated with this object (this should be the - same value as the flags associated with the parent connection object). - - - - - Holds a reference to the callback function for user functions - - - - - Holds a reference to the callbakc function for stepping in an aggregate function - - - - - Holds a reference to the callback function for finalizing an aggregate function - - - - - Holds a reference to the callback function for collation sequences - - - - - Current context of the current callback. Only valid during a callback - - - - - This static list contains all the user-defined functions declared using the proper attributes. - - - - - Internal constructor, initializes the function's internal variables. - - - - - Constructs an instance of this class using the specified data-type - conversion parameters. - - - The DateTime format to be used when converting string values to a - DateTime and binding DateTime parameters. - - - The to be used when creating DateTime - values. - - - The format string to be used when parsing and formatting DateTime - values. - - - Non-zero to create a UTF-16 data-type conversion context; otherwise, - a UTF-8 data-type conversion context will be created. - - - - - Disposes of any active contextData variables that were not automatically cleaned up. Sometimes this can happen if - someone closes the connection while a DataReader is open. - - - - - Placeholder for a user-defined disposal routine - - True if the object is being disposed explicitly - - - - Scalar functions override this method to do their magic. - - - Parameters passed to functions have only an affinity for a certain data type, there is no underlying schema available - to force them into a certain type. Therefore the only types you will ever see as parameters are - DBNull.Value, Int64, Double, String or byte[] array. - - The arguments for the command to process - You may return most simple types as a return value, null or DBNull.Value to return null, DateTime, or - you may return an Exception-derived class if you wish to return an error to SQLite. Do not actually throw the error, - just return it! - - - - Aggregate functions override this method to do their magic. - - - Typically you'll be updating whatever you've placed in the contextData field and returning as quickly as possible. - - The arguments for the command to process - The 1-based step number. This is incrememted each time the step method is called. - A placeholder for implementers to store contextual data pertaining to the current context. - - - - Aggregate functions override this method to finish their aggregate processing. - - - If you implemented your aggregate function properly, - you've been recording and keeping track of your data in the contextData object provided, and now at this stage you should have - all the information you need in there to figure out what to return. - NOTE: It is possible to arrive here without receiving a previous call to Step(), in which case the contextData will - be null. This can happen when no rows were returned. You can either return null, or 0 or some other custom return value - if that is the case. - - Your own assigned contextData, provided for you so you can return your final results. - You may return most simple types as a return value, null or DBNull.Value to return null, DateTime, or - you may return an Exception-derived class if you wish to return an error to SQLite. Do not actually throw the error, - just return it! - - - - - User-defined collation sequences override this method to provide a custom string sorting algorithm. - - The first string to compare - The second strnig to compare - 1 if param1 is greater than param2, 0 if they are equal, or -1 if param1 is less than param2 - - - - Converts an IntPtr array of context arguments to an object array containing the resolved parameters the pointers point to. - - - Parameters passed to functions have only an affinity for a certain data type, there is no underlying schema available - to force them into a certain type. Therefore the only types you will ever see as parameters are - DBNull.Value, Int64, Double, String or byte[] array. - - The number of arguments - A pointer to the array of arguments - An object array of the arguments once they've been converted to .NET values - - - - Takes the return value from Invoke() and Final() and figures out how to return it to SQLite's context. - - The context the return value applies to - The parameter to return to SQLite - - - - Internal scalar callback function, which wraps the raw context pointer and calls the virtual Invoke() method. - WARNING: Must not throw exceptions. - - A raw context pointer - Number of arguments passed in - A pointer to the array of arguments - - - - Internal collation sequence function, which wraps up the raw string pointers and executes the Compare() virtual function. - WARNING: Must not throw exceptions. - - Not used - Length of the string pv1 - Pointer to the first string to compare - Length of the string pv2 - Pointer to the second string to compare - Returns -1 if the first string is less than the second. 0 if they are equal, or 1 if the first string is greater - than the second. Returns 0 if an exception is caught. - - - - Internal collation sequence function, which wraps up the raw string pointers and executes the Compare() virtual function. - WARNING: Must not throw exceptions. - - Not used - Length of the string pv1 - Pointer to the first string to compare - Length of the string pv2 - Pointer to the second string to compare - Returns -1 if the first string is less than the second. 0 if they are equal, or 1 if the first string is greater - than the second. Returns 0 if an exception is caught. - - - - The internal aggregate Step function callback, which wraps the raw context pointer and calls the virtual Step() method. - WARNING: Must not throw exceptions. - - - This function takes care of doing the lookups and getting the important information put together to call the Step() function. - That includes pulling out the user's contextData and updating it after the call is made. We use a sorted list for this so - binary searches can be done to find the data. - - A raw context pointer - Number of arguments passed in - A pointer to the array of arguments - - - - An internal aggregate Final function callback, which wraps the context pointer and calls the virtual Final() method. - WARNING: Must not throw exceptions. - - A raw context pointer - - - - Using reflection, enumerate all assemblies in the current appdomain looking for classes that - have a SQLiteFunctionAttribute attribute, and registering them accordingly. - - - - - Manual method of registering a function. The type must still have the SQLiteFunctionAttributes in order to work - properly, but this is a workaround for the Compact Framework where enumerating assemblies is not currently supported. - - The type of the function to register - - - - Called by SQLiteBase derived classes, this function binds all user-defined functions to a connection. - It is done this way so that all user-defined functions will access the database using the same encoding scheme - as the connection (UTF-8 or UTF-16). - - - The wrapper functions that interop with SQLite will create a unique cookie value, which internally is a pointer to - all the wrapped callback functions. The interop function uses it to map CDecl callbacks to StdCall callbacks. - - The base object on which the functions are to bind - The flags associated with the parent connection object - Returns a logical list of functions which the connection should retain until it is closed. - - - - This function binds a user-defined functions to a connection. - - - The object instance associated with the - that the function should be bound to. - - - The object instance containing - the metadata for the function to be bound. - - - The object instance that implements the - function to be bound. - - - The flags associated with the parent connection object. - - - - - Returns a reference to the underlying connection's SQLiteConvert class, which can be used to convert - strings and DateTime's into the current connection's encoding schema. - - - - - Extends SQLiteFunction and allows an inherited class to obtain the collating sequence associated with a function call. - - - User-defined functions can call the GetCollationSequence() method in this class and use it to compare strings and char arrays. - - - - - Obtains the collating sequence in effect for the given function. - - - - - - The type of user-defined function to declare - - - - - Scalar functions are designed to be called and return a result immediately. Examples include ABS(), Upper(), Lower(), etc. - - - - - Aggregate functions are designed to accumulate data until the end of a call and then return a result gleaned from the accumulated data. - Examples include SUM(), COUNT(), AVG(), etc. - - - - - Collation sequences are used to sort textual data in a custom manner, and appear in an ORDER BY clause. Typically text in an ORDER BY is - sorted using a straight case-insensitive comparison function. Custom collating sequences can be used to alter the behavior of text sorting - in a user-defined manner. - - - - - An internal callback delegate declaration. - - Raw native context pointer for the user function. - Total number of arguments to the user function. - Raw native pointer to the array of raw native argument pointers. - - - - An internal final callback delegate declaration. - - Raw context pointer for the user function - - - - Internal callback delegate for implementing collation sequences - - Not used - Length of the string pv1 - Pointer to the first string to compare - Length of the string pv2 - Pointer to the second string to compare - Returns -1 if the first string is less than the second. 0 if they are equal, or 1 if the first string is greater - than the second. - - - - The type of collating sequence - - - - - The built-in BINARY collating sequence - - - - - The built-in NOCASE collating sequence - - - - - The built-in REVERSE collating sequence - - - - - A custom user-defined collating sequence - - - - - The encoding type the collation sequence uses - - - - - The collation sequence is UTF8 - - - - - The collation sequence is UTF16 little-endian - - - - - The collation sequence is UTF16 big-endian - - - - - A struct describing the collating sequence a function is executing in - - - - - The name of the collating sequence - - - - - The type of collating sequence - - - - - The text encoding of the collation sequence - - - - - Context of the function that requested the collating sequence - - - - - Calls the base collating sequence to compare two strings - - The first string to compare - The second string to compare - -1 if s1 is less than s2, 0 if s1 is equal to s2, and 1 if s1 is greater than s2 - - - - Calls the base collating sequence to compare two character arrays - - The first array to compare - The second array to compare - -1 if c1 is less than c2, 0 if c1 is equal to c2, and 1 if c1 is greater than c2 - - - - A simple custom attribute to enable us to easily find user-defined functions in - the loaded assemblies and initialize them in SQLite as connections are made. - - - - - Default constructor, initializes the internal variables for the function. - - - - - Constructs an instance of this class. - - - The name of the function, as seen by the SQLite core library. - - - The number of arguments that the function will accept. - - - The type of function being declared. This will either be Scalar, - Aggregate, or Collation. - - - - - The function's name as it will be used in SQLite command text. - - - - - The number of arguments this function expects. -1 if the number of arguments is variable. - - - - - The type of function this implementation will be. - - - - - The object instance that describes the class - containing the implementation for the associated function. - - - - - This class provides key info for a given SQLite statement. - - Providing key information for a given statement is non-trivial :( - - - - - - This function does all the nasty work at determining what keys need to be returned for - a given statement. - - - - - - - - Make sure all the subqueries are open and ready and sync'd with the current rowid - of the table they're supporting - - - - - Release any readers on any subqueries - - - - - Append all the columns we've added to the original query to the schema - - - - - - How many additional columns of keyinfo we're holding - - - - - Used to support CommandBehavior.KeyInfo - - - - - A single sub-query for a given table/database. - - - - - Event data for logging event handlers. - - - - - The error code. The type of this object value should be - or . - - - - - SQL statement text as the statement first begins executing - - - - - Extra data associated with this event, if any. - - - - - Constructs the object. - - Should be null. - - The error code. The type of this object value should be - or . - - The error message, if any. - The extra data, if any. - - - - Raised when a log event occurs. - - The current connection - Event arguments of the trace - - - - Manages the SQLite custom logging functionality and the associated - callback for the whole process. - - - - - Object used to synchronize access to the static instance data - for this class. - - - - - Member variable to store the AppDomain.DomainUnload event handler. - - - - - The default log event handler. - - - - - The log callback passed to native SQLite engine. This must live - as long as the SQLite library has a pointer to it. - - - - - The base SQLite object to interop with. - - - - - This will be non-zero if logging is currently enabled. - - - - - Initializes the SQLite logging facilities. - - - - - Handles the AppDomain being unloaded. - - Should be null. - The data associated with this event. - - - - Log a message to all the registered log event handlers without going - through the SQLite library. - - The message to be logged. - - - - Log a message to all the registered log event handlers without going - through the SQLite library. - - The SQLite error code. - The message to be logged. - - - - Log a message to all the registered log event handlers without going - through the SQLite library. - - The integer error code. - The message to be logged. - - - - Log a message to all the registered log event handlers without going - through the SQLite library. - - - The error code. The type of this object value should be - System.Int32 or SQLiteErrorCode. - - The message to be logged. - - - - Creates and initializes the default log event handler. - - - - - Adds the default log event handler to the list of handlers. - - - - - Removes the default log event handler from the list of handlers. - - - - - Internal proxy function that calls any registered application log - event handlers. - - WARNING: This method is used more-or-less directly by native code, - do not modify its type signature. - - - The extra data associated with this message, if any. - - - The error code associated with this message. - - - The message string to be logged. - - - - - Default logger. Currently, uses the Trace class (i.e. sends events - to the current trace listeners, if any). - - Should be null. - The data associated with this event. - - - - Member variable to store the application log handler to call. - - - - - This event is raised whenever SQLite raises a logging event. - Note that this should be set as one of the first things in the - application. - - - - - If this property is true, logging is enabled; otherwise, logging is - disabled. When logging is disabled, no logging events will fire. - - - - - MetaDataCollections specific to SQLite - - - - - Returns a list of databases attached to the connection - - - - - Returns column information for the specified table - - - - - Returns index information for the optionally-specified table - - - - - Returns base columns for the given index - - - - - Returns the tables in the given catalog - - - - - Returns user-defined views in the given catalog - - - - - Returns underlying column information on the given view - - - - - Returns foreign key information for the given catalog - - - - - Returns the triggers on the database - - - - - SQLite implementation of DbParameter. - - - - - The data type of the parameter - - - - - The version information for mapping the parameter - - - - - The value of the data in the parameter - - - - - The source column for the parameter - - - - - The column name - - - - - The data size, unused by SQLite - - - - - Default constructor - - - - - Constructs a named parameter given the specified parameter name - - The parameter name - - - - Constructs a named parameter given the specified parameter name and initial value - - The parameter name - The initial value of the parameter - - - - Constructs a named parameter of the specified type - - The parameter name - The datatype of the parameter - - - - Constructs a named parameter of the specified type and source column reference - - The parameter name - The data type - The source column - - - - Constructs a named parameter of the specified type, source column and row version - - The parameter name - The data type - The source column - The row version information - - - - Constructs an unnamed parameter of the specified data type - - The datatype of the parameter - - - - Constructs an unnamed parameter of the specified data type and sets the initial value - - The datatype of the parameter - The initial value of the parameter - - - - Constructs an unnamed parameter of the specified data type and source column - - The datatype of the parameter - The source column - - - - Constructs an unnamed parameter of the specified data type, source column and row version - - The data type - The source column - The row version information - - - - Constructs a named parameter of the specified type and size - - The parameter name - The data type - The size of the parameter - - - - Constructs a named parameter of the specified type, size and source column - - The name of the parameter - The data type - The size of the parameter - The source column - - - - Constructs a named parameter of the specified type, size, source column and row version - - The name of the parameter - The data type - The size of the parameter - The source column - The row version information - - - - Constructs a named parameter of the specified type, size, source column and row version - - The name of the parameter - The data type - The size of the parameter - Only input parameters are supported in SQLite - Ignored - Ignored - Ignored - The source column - The row version information - The initial value to assign the parameter - - - - Constructs a named parameter, yet another flavor - - The name of the parameter - The data type - The size of the parameter - Only input parameters are supported in SQLite - Ignored - Ignored - The source column - The row version information - Whether or not this parameter is for comparing NULL's - The intial value to assign the parameter - - - - Constructs an unnamed parameter of the specified type and size - - The data type - The size of the parameter - - - - Constructs an unnamed parameter of the specified type, size, and source column - - The data type - The size of the parameter - The source column - - - - Constructs an unnamed parameter of the specified type, size, source column and row version - - The data type - The size of the parameter - The source column - The row version information - - - - Resets the DbType of the parameter so it can be inferred from the value - - - - - Clones a parameter - - A new, unassociated SQLiteParameter - - - - Whether or not the parameter can contain a null value - - - - - Returns the datatype of the parameter - - - - - Supports only input parameters - - - - - Returns the parameter name - - - - - Returns the size of the parameter - - - - - Gets/sets the source column - - - - - Used by DbCommandBuilder to determine the mapping for nullable fields - - - - - Gets and sets the row version - - - - - Gets and sets the parameter value. If no datatype was specified, the datatype will assume the type from the value given. - - - - - SQLite implementation of DbParameterCollection. - - - - - The underlying command to which this collection belongs - - - - - The internal array of parameters in this collection - - - - - Determines whether or not all parameters have been bound to their statement(s) - - - - - Initializes the collection - - The command to which the collection belongs - - - - Retrieves an enumerator for the collection - - An enumerator for the underlying array - - - - Adds a parameter to the collection - - The parameter name - The data type - The size of the value - The source column - A SQLiteParameter object - - - - Adds a parameter to the collection - - The parameter name - The data type - The size of the value - A SQLiteParameter object - - - - Adds a parameter to the collection - - The parameter name - The data type - A SQLiteParameter object - - - - Adds a parameter to the collection - - The parameter to add - A zero-based index of where the parameter is located in the array - - - - Adds a parameter to the collection - - The parameter to add - A zero-based index of where the parameter is located in the array - - - - Adds a named/unnamed parameter and its value to the parameter collection. - - Name of the parameter, or null to indicate an unnamed parameter - The initial value of the parameter - Returns the SQLiteParameter object created during the call. - - - - Adds an array of parameters to the collection - - The array of parameters to add - - - - Adds an array of parameters to the collection - - The array of parameters to add - - - - Clears the array and resets the collection - - - - - Determines if the named parameter exists in the collection - - The name of the parameter to check - True if the parameter is in the collection - - - - Determines if the parameter exists in the collection - - The SQLiteParameter to check - True if the parameter is in the collection - - - - Not implemented - - - - - - - Retrieve a parameter by name from the collection - - The name of the parameter to fetch - A DbParameter object - - - - Retrieves a parameter by its index in the collection - - The index of the parameter to retrieve - A DbParameter object - - - - Returns the index of a parameter given its name - - The name of the parameter to find - -1 if not found, otherwise a zero-based index of the parameter - - - - Returns the index of a parameter - - The parameter to find - -1 if not found, otherwise a zero-based index of the parameter - - - - Inserts a parameter into the array at the specified location - - The zero-based index to insert the parameter at - The parameter to insert - - - - Removes a parameter from the collection - - The parameter to remove - - - - Removes a parameter from the collection given its name - - The name of the parameter to remove - - - - Removes a parameter from the collection given its index - - The zero-based parameter index to remove - - - - Re-assign the named parameter to a new parameter object - - The name of the parameter to replace - The new parameter - - - - Re-assign a parameter at the specified index - - The zero-based index of the parameter to replace - The new parameter - - - - Un-binds all parameters from their statements - - - - - This function attempts to map all parameters in the collection to all statements in a Command. - Since named parameters may span multiple statements, this function makes sure all statements are bound - to the same named parameter. Unnamed parameters are bound in sequence. - - - - - Returns false - - - - - Returns false - - - - - Returns false - - - - - Returns null - - - - - Returns a count of parameters in the collection - - - - - Overloaded to specialize the return value of the default indexer - - Name of the parameter to get/set - The specified named SQLite parameter - - - - Overloaded to specialize the return value of the default indexer - - The index of the parameter to get/set - The specified SQLite parameter - - - - Represents a single SQL statement in SQLite. - - - - - The underlying SQLite object this statement is bound to - - - - - The command text of this SQL statement - - - - - The actual statement pointer - - - - - An index from which unnamed parameters begin - - - - - Names of the parameters as SQLite understands them to be - - - - - Parameters for this statement - - - - - Command this statement belongs to (if any) - - - - - The flags associated with the parent connection object. - - - - - Initializes the statement and attempts to get all information about parameters in the statement - - The base SQLite object - The flags associated with the parent connection object - The statement - The command text for this statement - The previous command in a multi-statement command - - - - Disposes and finalizes the statement - - - - - If the underlying database connection is open, fetches the number of changed rows - resulting from the most recent query; otherwise, does nothing. - - - The number of changes when true is returned. - Undefined if false is returned. - - Non-zero if the number of changed rows was fetched. - - - - Called by SQLiteParameterCollection, this function determines if the specified parameter name belongs to - this statement, and if so, keeps a reference to the parameter so it can be bound later. - - The parameter name to map - The parameter to assign it - - - - Bind all parameters, making sure the caller didn't miss any - - - - - Attempts to convert an arbitrary object to the Boolean data type. - Null object values are converted to false. Throws a SQLiteException - upon failure. - - The object value to convert. - The format provider to use. - The converted boolean value. - - - - Perform the bind operation for an individual parameter - - The index of the parameter to bind - The parameter we're binding - - - - SQLite implementation of DbTransaction. - - - - - The connection to which this transaction is bound - - - - - Constructs the transaction object, binding it to the supplied connection - - The connection to open a transaction on - TRUE to defer the writelock, or FALSE to lock immediately - - - - Disposes the transaction. If it is currently active, any changes are rolled back. - - - - - Commits the current transaction. - - - - - Rolls back the active transaction. - - - - - Returns the underlying connection to which this transaction applies. - - - - - Forwards to the local Connection property - - - - - Gets the isolation level of the transaction. SQLite only supports Serializable transactions. - - - - - A strongly-typed resource class, for looking up localized strings, etc. - - - - - Returns the cached ResourceManager instance used by this class. - - - - - Overrides the current thread's CurrentUICulture property for all - resource lookups using this strongly typed resource class. - - - - - Looks up a localized string similar to <?xml version="1.0" standalone="yes"?> - <DocumentElement> - <DataTypes> - <TypeName>smallint</TypeName> - <ProviderDbType>10</ProviderDbType> - <ColumnSize>5</ColumnSize> - <DataType>System.Int16</DataType> - <CreateFormat>smallint</CreateFormat> - <IsAutoIncrementable>false</IsAutoIncrementable> - <IsCaseSensitive>false</IsCaseSensitive> - <IsFixedLength>true</IsFixedLength> - <IsFixedPrecisionScale>true</IsFixedPrecisionScale> - <IsLong>false</IsLong> - <IsNullable>true</ [rest of string was truncated]";. - - - - - Looks up a localized string similar to ALL,ALTER,AND,AS,AUTOINCREMENT,BETWEEN,BY,CASE,CHECK,COLLATE,COMMIT,CONSTRAINT,CREATE,CROSS,DEFAULT,DEFERRABLE,DELETE,DISTINCT,DROP,ELSE,ESCAPE,EXCEPT,FOREIGN,FROM,FULL,GROUP,HAVING,IN,INDEX,INNER,INSERT,INTERSECT,INTO,IS,ISNULL,JOIN,LEFT,LIMIT,NATURAL,NOT,NOTNULL,NULL,ON,OR,ORDER,OUTER,PRIMARY,REFERENCES,RIGHT,ROLLBACK,SELECT,SET,TABLE,THEN,TO,TRANSACTION,UNION,UNIQUE,UPDATE,USING,VALUES,WHEN,WHERE. - - - - - Looks up a localized string similar to <?xml version="1.0" encoding="utf-8" ?> - <DocumentElement> - <MetaDataCollections> - <CollectionName>MetaDataCollections</CollectionName> - <NumberOfRestrictions>0</NumberOfRestrictions> - <NumberOfIdentifierParts>0</NumberOfIdentifierParts> - </MetaDataCollections> - <MetaDataCollections> - <CollectionName>DataSourceInformation</CollectionName> - <NumberOfRestrictions>0</NumberOfRestrictions> - <NumberOfIdentifierParts>0</NumberOfIdentifierParts> - </MetaDataCollections> - <MetaDataC [rest of string was truncated]";. - - - - - The file extension used for dynamic link libraries. - - - - - The file extension used for the XML configuration file. - - - - - This is the name of the XML configuration file specific to the - System.Data.SQLite assembly. - - - - - This lock is used to protect the static _SQLiteNativeModuleFileName, - _SQLiteNativeModuleHandle, and processorArchitecturePlatforms fields. - - - - - This dictionary stores the mappings between processor architecture - names and platform names. These mappings are now used for two - purposes. First, they are used to determine if the assembly code - base should be used instead of the location, based upon whether one - or more of the named sub-directories exist within the assembly code - base. Second, they are used to assist in loading the appropriate - SQLite interop assembly into the current process. - - - - - For now, this method simply calls the Initialize method. - - - - - Attempts to initialize this class by pre-loading the native SQLite - library for the processor architecture of the current process. - - - - - Queries and returns the XML configuration file name for the assembly - containing the managed System.Data.SQLite components. - - - The XML configuration file name -OR- null if it cannot be determined - or does not exist. - - - - - Queries and returns the value of the specified setting, using the XML - configuration file and/or the environment variables for the current - process and/or the current system, when available. - - - The name of the setting. - - - The value to be returned if the setting has not been set explicitly - or cannot be determined. - - - The value of the setting -OR- the default value specified by - if it has not been set explicitly or - cannot be determined. By default, all references to existing - environment variables will be expanded to their corresponding values - within the value to be returned unless either the "No_Expand" or - "No_Expand_" environment variable is set [to - anything]. - - - - - Queries and returns the directory for the assembly currently being - executed. - - - The directory for the assembly currently being executed -OR- null if - it cannot be determined. - - - - - The name of the environment variable containing the processor - architecture of the current process. - - - - - This is the P/Invoke method that wraps the native Win32 LoadLibrary - function. See the MSDN documentation for full details on what it - does. - - - The name of the executable library. - - - The native module handle upon success -OR- IntPtr.Zero on failure. - - - - - The native module file name for the native SQLite library or null. - - - - - The native module handle for the native SQLite library or the value - IntPtr.Zero. - - - - - Searches for the native SQLite library in the directory containing - the assembly currently being executed as well as the base directory - for the current application domain. - - - Upon success, this parameter will be modified to refer to the base - directory containing the native SQLite library. - - - Upon success, this parameter will be modified to refer to the name - of the immediate directory (i.e. the offset from the base directory) - containing the native SQLite library. - - - Non-zero (success) if the native SQLite library was found; otherwise, - zero (failure). - - - - - Queries and returns the base directory of the current application - domain. - - - The base directory for the current application domain -OR- null if it - cannot be determined. - - - - - Determines if the dynamic link library file name requires a suffix - and adds it if necessary. - - - The original dynamic link library file name to inspect. - - - The dynamic link library file name, possibly modified to include an - extension. - - - - - Queries and returns the processor architecture of the current - process. - - - The processor architecture of the current process -OR- null if it - cannot be determined. - - - - - Given the processor architecture, returns the name of the platform. - - - The processor architecture to be translated to a platform name. - - - The platform name for the specified processor architecture -OR- null - if it cannot be determined. - - - - - Attempts to load the native SQLite library based on the specified - directory and processor architecture. - - - The base directory to use, null for default (the base directory of - the current application domain). This directory should contain the - processor architecture specific sub-directories. - - - The requested processor architecture, null for default (the - processor architecture of the current process). This caller should - almost always specify null for this parameter. - - - The candidate native module file name to load will be stored here, - if necessary. - - - The native module handle as returned by LoadLibrary will be stored - here, if necessary. This value will be IntPtr.Zero if the call to - LoadLibrary fails. - - - Non-zero if the native module was loaded successfully; otherwise, - zero. - - - - - This class represents a context from the SQLite core library that can - be passed to the sqlite3_result_*() and associated functions. - - - - - This interface represents a native handle provided by the SQLite core - library. - - - - - The native handle value. - - - - - The native context handle. - - - - - Constructs an instance of this class using the specified native - context handle. - - - The native context handle to use. - - - - - Sets the context result to NULL. - - - - - Sets the context result to the specified - value. - - - The value to use. - - - - - Sets the context result to the specified - value. - - - The value to use. - - - - - Sets the context result to the specified - value. - - - The value to use. - - - - - Sets the context result to the specified - value. - - - The value to use. This value will be - converted to the UTF-8 encoding prior to being used. - - - - - Sets the context result to the specified - value containing an error message. - - - The value containing the error message text. - This value will be converted to the UTF-8 encoding prior to being - used. - - - - - Sets the context result to the specified - value. - - - The value to use. - - - - - Sets the context result to contain the error code SQLITE_TOOBIG. - - - - - Sets the context result to contain the error code SQLITE_NOMEM. - - - - - Sets the context result to the specified array - value. - - - The array value to use. - - - - - Sets the context result to a BLOB of zeros of the specified size. - - - The number of zero bytes to use for the BLOB context result. - - - - - Sets the context result to the specified . - - - The to use. - - - - - Returns the underlying SQLite native handle associated with this - object instance. - - - - - This class represents a value from the SQLite core library that can be - passed to the sqlite3_value_*() and associated functions. - - - - - The native value handle. - - - - - Constructs an instance of this class using the specified native - value handle. - - - The native value handle to use. - - - - - Invalidates the native value handle, thereby preventing further - access to it from this object instance. - - - - - Converts a logical array of native pointers to native sqlite3_value - structures into a managed array of - object instances. - - - The number of elements in the logical array of native sqlite3_value - structures. - - - The native pointer to the logical array of native sqlite3_value - structures to convert. - - - The managed array of object instances or - null upon failure. - - - - - Gets and returns the type affinity associated with this value. - - - The type affinity associated with this value. - - - - - Gets and returns the number of bytes associated with this value, if - it refers to a UTF-8 encoded string. - - - The number of bytes associated with this value. The returned value - may be zero. - - - - - Gets and returns the associated with this - value. - - - The associated with this value. - - - - - Gets and returns the associated with - this value. - - - The associated with this value. - - - - - Gets and returns the associated with this - value. - - - The associated with this value. - - - - - Gets and returns the associated with this - value. - - - The associated with this value. The value is - converted from the UTF-8 encoding prior to being returned. - - - - - Gets and returns the array associated with this - value. - - - The array associated with this value. - - - - - Uses the native value handle to obtain and store the managed value - for this object instance, thus saving it for later use. The type - of the managed value is determined by the type affinity of the - native value. If the type affinity is not recognized by this - method, no work is done and false is returned. - - - Non-zero if the native value was persisted successfully. - - - - - Returns the underlying SQLite native handle associated with this - object instance. - - - - - Returns non-zero if the native SQLite value has been successfully - persisted as a managed value within this object instance (i.e. the - property may then be read successfully). - - - - - If the managed value for this object instance is available (i.e. it - has been previously persisted via the ) method, - that value is returned; otherwise, an exception is thrown. The - returned value may be null. - - - - - These are the allowed values for the operators that are part of a - constraint term in the WHERE clause of a query that uses a virtual - table. - - - - - This value represents the equality operator. - - - - - This value represents the greater than operator. - - - - - This value represents the less than or equal to operator. - - - - - This value represents the less than operator. - - - - - This value represents the greater than or equal to operator. - - - - - This value represents the MATCH operator. - - - - - This class represents the native sqlite3_index_constraint structure - from the SQLite core library. - - - - - Constructs an instance of this class using the specified native - sqlite3_index_constraint structure. - - - The native sqlite3_index_constraint structure to use. - - - - - Constructs an instance of this class using the specified field - values. - - - Column on left-hand side of constraint. - - - Constraint operator (). - - - True if this constraint is usable. - - - Used internally - - should ignore. - - - - - Column on left-hand side of constraint. - - - - - Constraint operator (). - - - - - True if this constraint is usable. - - - - - Used internally - - should ignore. - - - - - This class represents the native sqlite3_index_orderby structure from - the SQLite core library. - - - - - Constructs an instance of this class using the specified native - sqlite3_index_orderby structure. - - - The native sqlite3_index_orderby structure to use. - - - - - Constructs an instance of this class using the specified field - values. - - - Column number. - - - True for DESC. False for ASC. - - - - - Column number. - - - - - True for DESC. False for ASC. - - - - - This class represents the native sqlite3_index_constraint_usage - structure from the SQLite core library. - - - - - Constructs an instance of this class using the specified native - sqlite3_index_constraint_usage structure. - - - The native sqlite3_index_constraint_usage structure to use. - - - - - Constructs an instance of this class using the specified field - values. - - - If greater than 0, constraint is part of argv to xFilter. - - - Do not code a test for this constraint. - - - - - If greater than 0, constraint is part of argv to xFilter. - - - - - Do not code a test for this constraint. - - - - - This class represents the various inputs provided by the SQLite core - library to the method. - - - - - Constructs an instance of this class. - - - The number of instances to - pre-allocate space for. - - - The number of instances to - pre-allocate space for. - - - - - An array of object instances, - each containing information supplied by the SQLite core library. - - - - - An array of object instances, - each containing information supplied by the SQLite core library. - - - - - This class represents the various outputs provided to the SQLite core - library by the method. - - - - - Constructs an instance of this class. - - - The number of instances - to pre-allocate space for. - - - - - Determines if the native estimatedRows field can be used, based on - the available version of the SQLite core library. - - - Non-zero if the property is supported - by the SQLite core library. - - - - - An array of object - instances, each containing information to be supplied to the SQLite - core library. - - - - - Number used to help identify the selected index. This value will - later be provided to the - method. - - - - - String used to help identify the selected index. This value will - later be provided to the - method. - - - - - Non-zero if the index string must be freed by the SQLite core - library. - - - - - True if output is already ordered. - - - - - Estimated cost of using this index. Using a null value here - indicates that a default estimated cost value should be used. - - - - - Estimated number of rows returned. Using a null value here - indicates that a default estimated rows value should be used. - - - - - This class represents the various inputs and outputs used with the - method. - - - - - Constructs an instance of this class. - - - The number of (and - ) instances to - pre-allocate space for. - - - The number of instances to - pre-allocate space for. - - - - - Converts a native pointer to a native sqlite3_index_info structure - into a new object instance. - - - The native pointer to the native sqlite3_index_info structure to - convert. - - - Upon success, this parameter will be modified to contain the newly - created object instance. - - - - - Populates the outputs of a pre-allocated native sqlite3_index_info - structure using an existing object - instance. - - - The existing object instance containing - the output data to use. - - - The native pointer to the pre-allocated native sqlite3_index_info - structure. - - - - - The object instance containing - the inputs to the - method. - - - - - The object instance containing - the outputs from the - method. - - - - - This class represents a managed virtual table implementation. It is - not sealed and should be used as the base class for any user-defined - virtual table classes implemented in managed code. - - - - - The index within the array of strings provided to the - and - methods containing the - name of the module implementing this virtual table. - - - - - The index within the array of strings provided to the - and - methods containing the - name of the database containing this virtual table. - - - - - The index within the array of strings provided to the - and - methods containing the - name of the virtual table. - - - - - Constructs an instance of this class. - - - The original array of strings provided to the - and - methods. - - - - - This method should normally be used by the - method in order to - perform index selection based on the constraints provided by the - SQLite core library. - - - The object instance containing all the - data for the inputs and outputs relating to index selection. - - - Non-zero upon success. - - - - - Attempts to record the renaming of the virtual table associated - with this object instance. - - - The new name for the virtual table. - - - Non-zero upon success. - - - - - Disposes of this object instance. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is being called - from the finalizer. - - - - - Finalizes this object instance. - - - - - The original array of strings provided to the - and - methods. - - - - - The name of the module implementing this virtual table. - - - - - The name of the database containing this virtual table. - - - - - The name of the virtual table. - - - - - The object instance containing all the - data for the inputs and outputs relating to the most recent index - selection. - - - - - Returns the underlying SQLite native handle associated with this - object instance. - - - - - This class represents a managed virtual table cursor implementation. - It is not sealed and should be used as the base class for any - user-defined virtual table cursor classes implemented in managed code. - - - - - This value represents an invalid integer row sequence number. - - - - - The field holds the integer row sequence number for the current row - pointed to by this cursor object instance. - - - - - Constructs an instance of this class. - - - The object instance associated - with this object instance. - - - - - Constructs an instance of this class. - - - - - Attempts to persist the specified object - instances in order to make them available after the - method returns. - - - The array of object instances to be - persisted. - - - The number of object instances that were - successfully persisted. - - - - - This method should normally be used by the - method in order to - perform filtering of the result rows and/or to record the filtering - criteria provided by the SQLite core library. - - - Number used to help identify the selected index. - - - String used to help identify the selected index. - - - The values corresponding to each column in the selected index. - - - - - Determines the integer row sequence number for the current row. - - - The integer row sequence number for the current row -OR- zero if - it cannot be determined. - - - - - Adjusts the integer row sequence number so that it refers to the - next row. - - - - - Disposes of this object instance. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is being called - from the finalizer. - - - - - Finalizes this object instance. - - - - - The object instance associated - with this object instance. - - - - - Number used to help identify the selected index. This value will - be set via the method. - - - - - String used to help identify the selected index. This value will - be set via the method. - - - - - The values used to filter the rows returned via this cursor object - instance. This value will be set via the - method. - - - - - Returns the underlying SQLite native handle associated with this - object instance. - - - - - This interface represents a virtual table implementation written in - native code. - - - - - - This method is called to create a new instance of a virtual table - in response to a CREATE VIRTUAL TABLE statement. The db parameter - is a pointer to the SQLite database connection that is executing - the CREATE VIRTUAL TABLE statement. The pAux argument is the copy - of the client data pointer that was the fourth argument to the - sqlite3_create_module() or sqlite3_create_module_v2() call that - registered the virtual table module. The argv parameter is an - array of argc pointers to null terminated strings. The first - string, argv[0], is the name of the module being invoked. The - module name is the name provided as the second argument to - sqlite3_create_module() and as the argument to the USING clause of - the CREATE VIRTUAL TABLE statement that is running. The second, - argv[1], is the name of the database in which the new virtual table - is being created. The database name is "main" for the primary - database, or "temp" for TEMP database, or the name given at the - end of the ATTACH statement for attached databases. The third - element of the array, argv[2], is the name of the new virtual - table, as specified following the TABLE keyword in the CREATE - VIRTUAL TABLE statement. If present, the fourth and subsequent - strings in the argv[] array report the arguments to the module name - in the CREATE VIRTUAL TABLE statement. - - - The job of this method is to construct the new virtual table object - (an sqlite3_vtab object) and return a pointer to it in *ppVTab. - - - As part of the task of creating a new sqlite3_vtab structure, this - method must invoke sqlite3_declare_vtab() to tell the SQLite core - about the columns and datatypes in the virtual table. The - sqlite3_declare_vtab() API has the following prototype: - - - - int sqlite3_declare_vtab(sqlite3 *db, const char *zCreateTable) - - - - The first argument to sqlite3_declare_vtab() must be the same - database connection pointer as the first parameter to this method. - The second argument to sqlite3_declare_vtab() must a - zero-terminated UTF-8 string that contains a well-formed CREATE - TABLE statement that defines the columns in the virtual table and - their data types. The name of the table in this CREATE TABLE - statement is ignored, as are all constraints. Only the column names - and datatypes matter. The CREATE TABLE statement string need not to - be held in persistent memory. The string can be deallocated and/or - reused as soon as the sqlite3_declare_vtab() routine returns. - - - - The native database connection handle. - - - The original native pointer value that was provided to the - sqlite3_create_module(), sqlite3_create_module_v2() or - sqlite3_create_disposable_module() functions. - - - The number of arguments from the CREATE VIRTUAL TABLE statement. - - - The array of string arguments from the CREATE VIRTUAL TABLE - statement. - - - Upon success, this parameter must be modified to point to the newly - created native sqlite3_vtab derived structure. - - - Upon failure, this parameter must be modified to point to the error - message, with the underlying memory having been obtained from the - sqlite3_malloc() function. - - - A standard SQLite return code. - - - - - - The xConnect method is very similar to xCreate. It has the same - parameters and constructs a new sqlite3_vtab structure just like - xCreate. And it must also call sqlite3_declare_vtab() like xCreate. - - - The difference is that xConnect is called to establish a new - connection to an existing virtual table whereas xCreate is called - to create a new virtual table from scratch. - - - The xCreate and xConnect methods are only different when the - virtual table has some kind of backing store that must be - initialized the first time the virtual table is created. The - xCreate method creates and initializes the backing store. The - xConnect method just connects to an existing backing store. - - - As an example, consider a virtual table implementation that - provides read-only access to existing comma-separated-value (CSV) - files on disk. There is no backing store that needs to be created - or initialized for such a virtual table (since the CSV files - already exist on disk) so the xCreate and xConnect methods will be - identical for that module. - - - Another example is a virtual table that implements a full-text - index. The xCreate method must create and initialize data - structures to hold the dictionary and posting lists for that index. - The xConnect method, on the other hand, only has to locate and use - an existing dictionary and posting lists that were created by a - prior xCreate call. - - - The xConnect method must return SQLITE_OK if it is successful in - creating the new virtual table, or SQLITE_ERROR if it is not - successful. If not successful, the sqlite3_vtab structure must not - be allocated. An error message may optionally be returned in *pzErr - if unsuccessful. Space to hold the error message string must be - allocated using an SQLite memory allocation function like - sqlite3_malloc() or sqlite3_mprintf() as the SQLite core will - attempt to free the space using sqlite3_free() after the error has - been reported up to the application. - - - The xConnect method is required for every virtual table - implementation, though the xCreate and xConnect pointers of the - sqlite3_module object may point to the same function the virtual - table does not need to initialize backing store. - - - - The native database connection handle. - - - The original native pointer value that was provided to the - sqlite3_create_module(), sqlite3_create_module_v2() or - sqlite3_create_disposable_module() functions. - - - The number of arguments from the CREATE VIRTUAL TABLE statement. - - - The array of string arguments from the CREATE VIRTUAL TABLE - statement. - - - Upon success, this parameter must be modified to point to the newly - created native sqlite3_vtab derived structure. - - - Upon failure, this parameter must be modified to point to the error - message, with the underlying memory having been obtained from the - sqlite3_malloc() function. - - - A standard SQLite return code. - - - - - - SQLite uses the xBestIndex method of a virtual table module to - determine the best way to access the virtual table. The xBestIndex - method has a prototype like this: - - - int (*xBestIndex)(sqlite3_vtab *pVTab, sqlite3_index_info*); - - - The SQLite core communicates with the xBestIndex method by filling - in certain fields of the sqlite3_index_info structure and passing a - pointer to that structure into xBestIndex as the second parameter. - The xBestIndex method fills out other fields of this structure - which forms the reply. The sqlite3_index_info structure looks like - this: - - - struct sqlite3_index_info { - /* Inputs */ - const int nConstraint; /* Number of entries in aConstraint */ - const struct sqlite3_index_constraint { - int iColumn; /* Column on left-hand side of - * constraint */ - unsigned char op; /* Constraint operator */ - unsigned char usable; /* True if this constraint is usable */ - int iTermOffset; /* Used internally - xBestIndex should - * ignore */ - } *const aConstraint; /* Table of WHERE clause constraints */ - const int nOrderBy; /* Number of terms in the ORDER BY - * clause */ - const struct sqlite3_index_orderby { - int iColumn; /* Column number */ - unsigned char desc; /* True for DESC. False for ASC. */ - } *const aOrderBy; /* The ORDER BY clause */ - /* Outputs */ - struct sqlite3_index_constraint_usage { - int argvIndex; /* if greater than zero, constraint is - * part of argv to xFilter */ - unsigned char omit; /* Do not code a test for this - * constraint */ - } *const aConstraintUsage; - int idxNum; /* Number used to identify the index */ - char *idxStr; /* String, possibly obtained from - * sqlite3_malloc() */ - int needToFreeIdxStr; /* Free idxStr using sqlite3_free() if - * true */ - int orderByConsumed; /* True if output is already ordered */ - double estimatedCost; /* Estimated cost of using this index */ - }; - - - In addition, there are some defined constants: - - - #define SQLITE_INDEX_CONSTRAINT_EQ 2 - #define SQLITE_INDEX_CONSTRAINT_GT 4 - #define SQLITE_INDEX_CONSTRAINT_LE 8 - #define SQLITE_INDEX_CONSTRAINT_LT 16 - #define SQLITE_INDEX_CONSTRAINT_GE 32 - #define SQLITE_INDEX_CONSTRAINT_MATCH 64 - - - The SQLite core calls the xBestIndex method when it is compiling a - query that involves a virtual table. In other words, SQLite calls - this method when it is running sqlite3_prepare() or the equivalent. - By calling this method, the SQLite core is saying to the virtual - table that it needs to access some subset of the rows in the - virtual table and it wants to know the most efficient way to do - that access. The xBestIndex method replies with information that - the SQLite core can then use to conduct an efficient search of the - virtual table. - - - While compiling a single SQL query, the SQLite core might call - xBestIndex multiple times with different settings in - sqlite3_index_info. The SQLite core will then select the - combination that appears to give the best performance. - - - Before calling this method, the SQLite core initializes an instance - of the sqlite3_index_info structure with information about the - query that it is currently trying to process. This information - derives mainly from the WHERE clause and ORDER BY or GROUP BY - clauses of the query, but also from any ON or USING clauses if the - query is a join. The information that the SQLite core provides to - the xBestIndex method is held in the part of the structure that is - marked as "Inputs". The "Outputs" section is initialized to zero. - - - The information in the sqlite3_index_info structure is ephemeral - and may be overwritten or deallocated as soon as the xBestIndex - method returns. If the xBestIndex method needs to remember any part - of the sqlite3_index_info structure, it should make a copy. Care - must be take to store the copy in a place where it will be - deallocated, such as in the idxStr field with needToFreeIdxStr set - to 1. - - - Note that xBestIndex will always be called before xFilter, since - the idxNum and idxStr outputs from xBestIndex are required inputs - to xFilter. However, there is no guarantee that xFilter will be - called following a successful xBestIndex. - - - The xBestIndex method is required for every virtual table - implementation. - - - 2.3.1 Inputs - - - The main thing that the SQLite core is trying to communicate to the - virtual table is the constraints that are available to limit the - number of rows that need to be searched. The aConstraint[] array - contains one entry for each constraint. There will be exactly - nConstraint entries in that array. - - - Each constraint will correspond to a term in the WHERE clause or in - a USING or ON clause that is of the form - - - column OP EXPR - - - Where "column" is a column in the virtual table, OP is an operator - like "=" or "<", and EXPR is an arbitrary expression. So, for - example, if the WHERE clause contained a term like this: - - - a = 5 - - - Then one of the constraints would be on the "a" column with - operator "=" and an expression of "5". Constraints need not have a - literal representation of the WHERE clause. The query optimizer - might make transformations to the WHERE clause in order to extract - as many constraints as it can. So, for example, if the WHERE clause - contained something like this: - - - x BETWEEN 10 AND 100 AND 999>y - - - The query optimizer might translate this into three separate - constraints: - - - x >= 10 - x <= 100 - y < 999 - - - For each constraint, the aConstraint[].iColumn field indicates - which column appears on the left-hand side of the constraint. The - first column of the virtual table is column 0. The rowid of the - virtual table is column -1. The aConstraint[].op field indicates - which operator is used. The SQLITE_INDEX_CONSTRAINT_* constants map - integer constants into operator values. Columns occur in the order - they were defined by the call to sqlite3_declare_vtab() in the - xCreate or xConnect method. Hidden columns are counted when - determining the column index. - - - The aConstraint[] array contains information about all constraints - that apply to the virtual table. But some of the constraints might - not be usable because of the way tables are ordered in a join. The - xBestIndex method must therefore only consider constraints that - have an aConstraint[].usable flag which is true. - - - In addition to WHERE clause constraints, the SQLite core also tells - the xBestIndex method about the ORDER BY clause. (In an aggregate - query, the SQLite core might put in GROUP BY clause information in - place of the ORDER BY clause information, but this fact should not - make any difference to the xBestIndex method.) If all terms of the - ORDER BY clause are columns in the virtual table, then nOrderBy - will be the number of terms in the ORDER BY clause and the - aOrderBy[] array will identify the column for each term in the - order by clause and whether or not that column is ASC or DESC. - - - 2.3.2 Outputs - - - Given all of the information above, the job of the xBestIndex - method it to figure out the best way to search the virtual table. - - - The xBestIndex method fills the idxNum and idxStr fields with - information that communicates an indexing strategy to the xFilter - method. The information in idxNum and idxStr is arbitrary as far as - the SQLite core is concerned. The SQLite core just copies the - information through to the xFilter method. Any desired meaning can - be assigned to idxNum and idxStr as long as xBestIndex and xFilter - agree on what that meaning is. - - - The idxStr value may be a string obtained from an SQLite memory - allocation function such as sqlite3_mprintf(). If this is the case, - then the needToFreeIdxStr flag must be set to true so that the - SQLite core will know to call sqlite3_free() on that string when it - has finished with it, and thus avoid a memory leak. - - - If the virtual table will output rows in the order specified by the - ORDER BY clause, then the orderByConsumed flag may be set to true. - If the output is not automatically in the correct order then - orderByConsumed must be left in its default false setting. This - will indicate to the SQLite core that it will need to do a separate - sorting pass over the data after it comes out of the virtual table. - - - The estimatedCost field should be set to the estimated number of - disk access operations required to execute this query against the - virtual table. The SQLite core will often call xBestIndex multiple - times with different constraints, obtain multiple cost estimates, - then choose the query plan that gives the lowest estimate. - - - The aConstraintUsage[] array contains one element for each of the - nConstraint constraints in the inputs section of the - sqlite3_index_info structure. The aConstraintUsage[] array is used - by xBestIndex to tell the core how it is using the constraints. - - - The xBestIndex method may set aConstraintUsage[].argvIndex entries - to values greater than one. Exactly one entry should be set to 1, - another to 2, another to 3, and so forth up to as many or as few as - the xBestIndex method wants. The EXPR of the corresponding - constraints will then be passed in as the argv[] parameters to - xFilter. - - - For example, if the aConstraint[3].argvIndex is set to 1, then when - xFilter is called, the argv[0] passed to xFilter will have the EXPR - value of the aConstraint[3] constraint. - - - By default, the SQLite core double checks all constraints on each - row of the virtual table that it receives. If such a check is - redundant, the xBestFilter method can suppress that double-check by - setting aConstraintUsage[].omit. - - - - The native pointer to the sqlite3_vtab derived structure. - - - The native pointer to the sqlite3_index_info structure. - - - A standard SQLite return code. - - - - - - This method releases a connection to a virtual table. Only the - sqlite3_vtab object is destroyed. The virtual table is not - destroyed and any backing store associated with the virtual table - persists. This method undoes the work of xConnect. - - - This method is a destructor for a connection to the virtual table. - Contrast this method with xDestroy. The xDestroy is a destructor - for the entire virtual table. - - - The xDisconnect method is required for every virtual table - implementation, though it is acceptable for the xDisconnect and - xDestroy methods to be the same function if that makes sense for - the particular virtual table. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - This method releases a connection to a virtual table, just like the - xDisconnect method, and it also destroys the underlying table - implementation. This method undoes the work of xCreate. - - - The xDisconnect method is called whenever a database connection - that uses a virtual table is closed. The xDestroy method is only - called when a DROP TABLE statement is executed against the virtual - table. - - - The xDestroy method is required for every virtual table - implementation, though it is acceptable for the xDisconnect and - xDestroy methods to be the same function if that makes sense for - the particular virtual table. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - The xOpen method creates a new cursor used for accessing (read - and/or writing) a virtual table. A successful invocation of this - method will allocate the memory for the sqlite3_vtab_cursor (or a - subclass), initialize the new object, and make *ppCursor point to - the new object. The successful call then returns SQLITE_OK. - - - For every successful call to this method, the SQLite core will - later invoke the xClose method to destroy the allocated cursor. - - - The xOpen method need not initialize the pVtab field of the - sqlite3_vtab_cursor structure. The SQLite core will take care of - that chore automatically. - - - A virtual table implementation must be able to support an arbitrary - number of simultaneously open cursors. - - - When initially opened, the cursor is in an undefined state. The - SQLite core will invoke the xFilter method on the cursor prior to - any attempt to position or read from the cursor. - - - The xOpen method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab derived structure. - - - Upon success, this parameter must be modified to point to the newly - created native sqlite3_vtab_cursor derived structure. - - - A standard SQLite return code. - - - - - - The xClose method closes a cursor previously opened by xOpen. The - SQLite core will always call xClose once for each cursor opened - using xOpen. - - - This method must release all resources allocated by the - corresponding xOpen call. The routine will not be called again even - if it returns an error. The SQLite core will not use the - sqlite3_vtab_cursor again after it has been closed. - - - The xClose method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - A standard SQLite return code. - - - - - - This method begins a search of a virtual table. The first argument - is a cursor opened by xOpen. The next two argument define a - particular search index previously chosen by xBestIndex. The - specific meanings of idxNum and idxStr are unimportant as long as - xFilter and xBestIndex agree on what that meaning is. - - - The xBestIndex function may have requested the values of certain - expressions using the aConstraintUsage[].argvIndex values of the - sqlite3_index_info structure. Those values are passed to xFilter - using the argc and argv parameters. - - - If the virtual table contains one or more rows that match the - search criteria, then the cursor must be left point at the first - row. Subsequent calls to xEof must return false (zero). If there - are no rows match, then the cursor must be left in a state that - will cause the xEof to return true (non-zero). The SQLite engine - will use the xColumn and xRowid methods to access that row content. - The xNext method will be used to advance to the next row. - - - This method must return SQLITE_OK if successful, or an sqlite error - code if an error occurs. - - - The xFilter method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - Number used to help identify the selected index. - - - The native pointer to the UTF-8 encoded string containing the - string used to help identify the selected index. - - - The number of native pointers to sqlite3_value structures specified - in . - - - An array of native pointers to sqlite3_value structures containing - filtering criteria for the selected index. - - - A standard SQLite return code. - - - - - - The xNext method advances a virtual table cursor to the next row of - a result set initiated by xFilter. If the cursor is already - pointing at the last row when this routine is called, then the - cursor no longer points to valid data and a subsequent call to the - xEof method must return true (non-zero). If the cursor is - successfully advanced to another row of content, then subsequent - calls to xEof must return false (zero). - - - This method must return SQLITE_OK if successful, or an sqlite error - code if an error occurs. - - - The xNext method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - A standard SQLite return code. - - - - - - The xEof method must return false (zero) if the specified cursor - currently points to a valid row of data, or true (non-zero) - otherwise. This method is called by the SQL engine immediately - after each xFilter and xNext invocation. - - - The xEof method is required for every virtual table implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - Non-zero if no more rows are available; zero otherwise. - - - - - - The SQLite core invokes this method in order to find the value for - the N-th column of the current row. N is zero-based so the first - column is numbered 0. The xColumn method may return its result back - to SQLite using one of the following interface: - - - sqlite3_result_blob() - sqlite3_result_double() - sqlite3_result_int() - sqlite3_result_int64() - sqlite3_result_null() - sqlite3_result_text() - sqlite3_result_text16() - sqlite3_result_text16le() - sqlite3_result_text16be() - sqlite3_result_zeroblob() - - - If the xColumn method implementation calls none of the functions - above, then the value of the column defaults to an SQL NULL. - - - To raise an error, the xColumn method should use one of the - result_text() methods to set the error message text, then return an - appropriate error code. The xColumn method must return SQLITE_OK on - success. - - - The xColumn method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - The native pointer to the sqlite3_context structure to be used - for returning the specified column value to the SQLite core - library. - - - The zero-based index corresponding to the column containing the - value to be returned. - - - A standard SQLite return code. - - - - - - A successful invocation of this method will cause *pRowid to be - filled with the rowid of row that the virtual table cursor pCur is - currently pointing at. This method returns SQLITE_OK on success. It - returns an appropriate error code on failure. - - - The xRowid method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the current row for the specified cursor. - - - A standard SQLite return code. - - - - - - All changes to a virtual table are made using the xUpdate method. - This one method can be used to insert, delete, or update. - - - The argc parameter specifies the number of entries in the argv - array. The value of argc will be 1 for a pure delete operation or - N+2 for an insert or replace or update where N is the number of - columns in the table. In the previous sentence, N includes any - hidden columns. - - - Every argv entry will have a non-NULL value in C but may contain - the SQL value NULL. In other words, it is always true that - argv[i]!=0 for i between 0 and argc-1. However, it might be the - case that sqlite3_value_type(argv[i])==SQLITE_NULL. - - - The argv[0] parameter is the rowid of a row in the virtual table - to be deleted. If argv[0] is an SQL NULL, then no deletion occurs. - - - The argv[1] parameter is the rowid of a new row to be inserted into - the virtual table. If argv[1] is an SQL NULL, then the - implementation must choose a rowid for the newly inserted row. - Subsequent argv[] entries contain values of the columns of the - virtual table, in the order that the columns were declared. The - number of columns will match the table declaration that the - xConnect or xCreate method made using the sqlite3_declare_vtab() - call. All hidden columns are included. - - - When doing an insert without a rowid (argc>1, argv[1] is an SQL - NULL), the implementation must set *pRowid to the rowid of the - newly inserted row; this will become the value returned by the - sqlite3_last_insert_rowid() function. Setting this value in all the - other cases is a harmless no-op; the SQLite engine ignores the - *pRowid return value if argc==1 or argv[1] is not an SQL NULL. - - - Each call to xUpdate will fall into one of cases shown below. Note - that references to argv[i] mean the SQL value held within the - argv[i] object, not the argv[i] object itself. - - - argc = 1 - - - The single row with rowid equal to argv[0] is deleted. No - insert occurs. - - - argc > 1 - argv[0] = NULL - - - A new row is inserted with a rowid argv[1] and column - values in argv[2] and following. If argv[1] is an SQL NULL, - the a new unique rowid is generated automatically. - - - argc > 1 - argv[0] ? NULL - argv[0] = argv[1] - - - The row with rowid argv[0] is updated with new values in - argv[2] and following parameters. - - - argc > 1 - argv[0] ? NULL - argv[0] ? argv[1] - - - The row with rowid argv[0] is updated with rowid argv[1] - and new values in argv[2] and following parameters. This - will occur when an SQL statement updates a rowid, as in - the statement: - - - UPDATE table SET rowid=rowid+1 WHERE ...; - - - The xUpdate method must return SQLITE_OK if and only if it is - successful. If a failure occurs, the xUpdate must return an - appropriate error code. On a failure, the pVTab->zErrMsg element - may optionally be replaced with error message text stored in memory - allocated from SQLite using functions such as sqlite3_mprintf() or - sqlite3_malloc(). - - - If the xUpdate method violates some constraint of the virtual table - (including, but not limited to, attempting to store a value of the - wrong datatype, attempting to store a value that is too large or - too small, or attempting to change a read-only value) then the - xUpdate must fail with an appropriate error code. - - - There might be one or more sqlite3_vtab_cursor objects open and in - use on the virtual table instance and perhaps even on the row of - the virtual table when the xUpdate method is invoked. The - implementation of xUpdate must be prepared for attempts to delete - or modify rows of the table out from other existing cursors. If the - virtual table cannot accommodate such changes, the xUpdate method - must return an error code. - - - The xUpdate method is optional. If the xUpdate pointer in the - sqlite3_module for a virtual table is a NULL pointer, then the - virtual table is read-only. - - - - The native pointer to the sqlite3_vtab derived structure. - - - The number of new or modified column values contained in - . - - - The array of native pointers to sqlite3_value structures containing - the new or modified column values, if any. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the row that was inserted, if any. - - - A standard SQLite return code. - - - - - - This method begins a transaction on a virtual table. This is method - is optional. The xBegin pointer of sqlite3_module may be NULL. - - - This method is always followed by one call to either the xCommit or - xRollback method. Virtual table transactions do not nest, so the - xBegin method will not be invoked more than once on a single - virtual table without an intervening call to either xCommit or - xRollback. Multiple calls to other methods can and likely will - occur in between the xBegin and the corresponding xCommit or - xRollback. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - This method signals the start of a two-phase commit on a virtual - table. This is method is optional. The xSync pointer of - sqlite3_module may be NULL. - - - This method is only invoked after call to the xBegin method and - prior to an xCommit or xRollback. In order to implement two-phase - commit, the xSync method on all virtual tables is invoked prior to - invoking the xCommit method on any virtual table. If any of the - xSync methods fail, the entire transaction is rolled back. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - This method causes a virtual table transaction to commit. This is - method is optional. The xCommit pointer of sqlite3_module may be - NULL. - - - A call to this method always follows a prior call to xBegin and - xSync. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - This method causes a virtual table transaction to rollback. This is - method is optional. The xRollback pointer of sqlite3_module may be - NULL. - - - A call to this method always follows a prior call to xBegin. - - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - - This method provides notification that the virtual table - implementation that the virtual table will be given a new name. If - this method returns SQLITE_OK then SQLite renames the table. If - this method returns an error code then the renaming is prevented. - - - The xRename method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab derived structure. - - - The number of arguments to the function being sought. - - - The name of the function being sought. - - - Upon success, this parameter must be modified to contain the - delegate responsible for implementing the specified function. - - - Upon success, this parameter must be modified to contain the - native user-data pointer associated with - . - - - Non-zero if the specified function was found; zero otherwise. - - - - - - This method provides notification that the virtual table - implementation that the virtual table will be given a new name. If - this method returns SQLITE_OK then SQLite renames the table. If - this method returns an error code then the renaming is prevented. - - - The xRename method is required for every virtual table - implementation. - - - - The native pointer to the sqlite3_vtab derived structure. - - - The native pointer to the UTF-8 encoded string containing the new - name for the virtual table. - - - A standard SQLite return code. - - - - - - These methods provide the virtual table implementation an - opportunity to implement nested transactions. They are always - optional and will only be called in SQLite version 3.7.7 and later. - - - When xSavepoint(X,N) is invoked, that is a signal to the virtual - table X that it should save its current state as savepoint N. A - subsequent call to xRollbackTo(X,R) means that the state of the - virtual table should return to what it was when xSavepoint(X,R) was - last called. The call to xRollbackTo(X,R) will invalidate all - savepoints with N>R; none of the invalided savepoints will be - rolled back or released without first being reinitialized by a call - to xSavepoint(). A call to xRelease(X,M) invalidates all savepoints - where N>=M. - - - None of the xSavepoint(), xRelease(), or xRollbackTo() methods will - ever be called except in between calls to xBegin() and either - xCommit() or xRollback(). - - - - The native pointer to the sqlite3_vtab derived structure. - - - This is an integer identifier under which the the current state of - the virtual table should be saved. - - - A standard SQLite return code. - - - - - - These methods provide the virtual table implementation an - opportunity to implement nested transactions. They are always - optional and will only be called in SQLite version 3.7.7 and later. - - - When xSavepoint(X,N) is invoked, that is a signal to the virtual - table X that it should save its current state as savepoint N. A - subsequent call to xRollbackTo(X,R) means that the state of the - virtual table should return to what it was when xSavepoint(X,R) was - last called. The call to xRollbackTo(X,R) will invalidate all - savepoints with N>R; none of the invalided savepoints will be - rolled back or released without first being reinitialized by a call - to xSavepoint(). A call to xRelease(X,M) invalidates all savepoints - where N>=M. - - - None of the xSavepoint(), xRelease(), or xRollbackTo() methods will - ever be called except in between calls to xBegin() and either - xCommit() or xRollback(). - - - - The native pointer to the sqlite3_vtab derived structure. - - - This is an integer used to indicate that any saved states with an - identifier greater than or equal to this should be deleted by the - virtual table. - - - A standard SQLite return code. - - - - - - These methods provide the virtual table implementation an - opportunity to implement nested transactions. They are always - optional and will only be called in SQLite version 3.7.7 and later. - - - When xSavepoint(X,N) is invoked, that is a signal to the virtual - table X that it should save its current state as savepoint N. A - subsequent call to xRollbackTo(X,R) means that the state of the - virtual table should return to what it was when xSavepoint(X,R) was - last called. The call to xRollbackTo(X,R) will invalidate all - savepoints with N>R; none of the invalided savepoints will be - rolled back or released without first being reinitialized by a call - to xSavepoint(). A call to xRelease(X,M) invalidates all savepoints - where N>=M. - - - None of the xSavepoint(), xRelease(), or xRollbackTo() methods will - ever be called except in between calls to xBegin() and either - xCommit() or xRollback(). - - - - The native pointer to the sqlite3_vtab derived structure. - - - This is an integer identifier used to specify a specific saved - state for the virtual table for it to restore itself back to, which - should also have the effect of deleting all saved states with an - integer identifier greater than this one. - - - A standard SQLite return code. - - - - - This interface represents a virtual table implementation written in - managed code. - - - - - This method is called in response to the - method. - - - The object instance associated with - the virtual table. - - - The native user-data pointer associated with this module, as it was - provided to the SQLite core library when the native module instance - was created. - - - The module name, database name, virtual table name, and all other - arguments passed to the CREATE VIRTUAL TABLE statement. - - - Upon success, this parameter must be modified to contain the - object instance associated with - the virtual table. - - - Upon failure, this parameter must be modified to contain an error - message. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated with - the virtual table. - - - The native user-data pointer associated with this module, as it was - provided to the SQLite core library when the native module instance - was created. - - - The module name, database name, virtual table name, and all other - arguments passed to the CREATE VIRTUAL TABLE statement. - - - Upon success, this parameter must be modified to contain the - object instance associated with - the virtual table. - - - Upon failure, this parameter must be modified to contain an error - message. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The object instance containing all the - data for the inputs and outputs relating to index selection. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - Upon success, this parameter must be modified to contain the - object instance associated - with the newly opened virtual table cursor. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Number used to help identify the selected index. - - - String used to help identify the selected index. - - - The values corresponding to each column in the selected index. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Non-zero if no more rows are available; zero otherwise. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - The object instance to be used for - returning the specified column value to the SQLite core library. - - - The zero-based index corresponding to the column containing the - value to be returned. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the current row for the specified cursor. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The array of object instances containing - the new or modified column values, if any. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the row that was inserted, if any. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The number of arguments to the function being sought. - - - The name of the function being sought. - - - Upon success, this parameter must be modified to contain the - object instance responsible for - implementing the specified function. - - - Upon success, this parameter must be modified to contain the - native user-data pointer associated with - . - - - Non-zero if the specified function was found; zero otherwise. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The new name for the virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer identifier under which the the current state of - the virtual table should be saved. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer used to indicate that any saved states with an - identifier greater than or equal to this should be deleted by the - virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer identifier used to specify a specific saved - state for the virtual table for it to restore itself back to, which - should also have the effect of deleting all saved states with an - integer identifier greater than this one. - - - A standard SQLite return code. - - - - - Returns non-zero if the schema for the virtual table has been - declared. - - - - - Returns the name of the module as it was registered with the SQLite - core library. - - - - - This class contains static methods that are used to allocate, - manipulate, and free native memory provided by the SQLite core library. - - - - - Allocates at least the specified number of bytes of native memory - via the SQLite core library sqlite3_malloc() function and returns - the resulting native pointer. - - - The number of bytes to allocate. - - - The native pointer that points to a block of memory of at least the - specified size -OR- if the memory could - not be allocated. - - - - - Gets and returns the actual size of the specified memory block that - was previously obtained from the method. - - - The native pointer to the memory block previously obtained from the - method. - - - The actual size, in bytes, of the memory block specified via the - native pointer. - - - - - Frees a memory block previously obtained from the - method. - - - The native pointer to the memory block previously obtained from the - method. - - - - - This class contains static methods that are used to deal with native - UTF-8 string pointers to be used with the SQLite core library. - - - - - This is the maximum possible length for the native UTF-8 encoded - strings used with the SQLite core library. - - - - - This is the object instance used to handle - conversions from/to UTF-8. - - - - - Converts the specified managed string into the UTF-8 encoding and - returns the array of bytes containing its representation in that - encoding. - - - The managed string to convert. - - - The array of bytes containing the representation of the managed - string in the UTF-8 encoding or null upon failure. - - - - - Converts the specified array of bytes representing a string in the - UTF-8 encoding and returns a managed string. - - - The array of bytes to convert. - - - The managed string or null upon failure. - - - - - Probes a native pointer to a string in the UTF-8 encoding for its - terminating NUL character, within the specified length limit. - - - The native NUL-terminated string pointer. - - - The maximum length of the native string, in bytes. - - - The length of the native string, in bytes -OR- zero if the length - could not be determined. - - - - - Converts the specified native NUL-terminated UTF-8 string pointer - into a managed string. - - - The native NUL-terminated UTF-8 string pointer. - - - The managed string or null upon failure. - - - - - Converts the specified native UTF-8 string pointer of the specified - length into a managed string. - - - The native UTF-8 string pointer. - - - The length of the native string, in bytes. - - - The managed string or null upon failure. - - - - - Converts the specified managed string into a native NUL-terminated - UTF-8 string pointer using memory obtained from the SQLite core - library. - - - The managed string to convert. - - - The native NUL-terminated UTF-8 string pointer or - upon failure. - - - - - Converts a logical array of native NUL-terminated UTF-8 string - pointers into an array of managed strings. - - - The number of elements in the logical array of native - NUL-terminated UTF-8 string pointers. - - - The native pointer to the logical array of native NUL-terminated - UTF-8 string pointers to convert. - - - The array of managed strings or null upon failure. - - - - - Converts an array of managed strings into an array of native - NUL-terminated UTF-8 string pointers. - - - The array of managed strings to convert. - - - The array of native NUL-terminated UTF-8 string pointers or null - upon failure. - - - - - This class contains static methods that are used to deal with native - pointers to memory blocks that logically contain arrays of bytes to be - used with the SQLite core library. - - - - - Converts a native pointer to a logical array of bytes of the - specified length into a managed byte array. - - - The native pointer to the logical array of bytes to convert. - - - The length, in bytes, of the logical array of bytes to convert. - - - The managed byte array or null upon failure. - - - - - Converts a managed byte array into a native pointer to a logical - array of bytes. - - - The managed byte array to convert. - - - The native pointer to a logical byte array or null upon failure. - - - - - This class contains static methods that are used to perform several - low-level data marshalling tasks between native and managed code. - - - - - Returns a new object instance based on the - specified object instance and an integer - offset. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location that the new - object instance should point to. - - - The new object instance. - - - - - Rounds up an integer size to the next multiple of the alignment. - - - The size, in bytes, to be rounded up. - - - The required alignment for the return value. - - - The size, in bytes, rounded up to the next multiple of the - alignment. This value may end up being the same as the original - size. - - - - - Determines the offset, in bytes, of the next structure member. - - - The offset, in bytes, of the current structure member. - - - The size, in bytes, of the current structure member. - - - The alignment, in bytes, of the next structure member. - - - The offset, in bytes, of the next structure member. - - - - - Reads a value from the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be read is located. - - - The value at the specified memory location. - - - - - Reads a value from the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - to be read is located. - - - The value at the specified memory location. - - - - - Reads an value from the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be read is located. - - - The value at the specified memory location. - - - - - Writes an value to the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be written is located. - - - The value to write. - - - - - Writes an value to the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be written is located. - - - The value to write. - - - - - Writes a value to the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be written is located. - - - The value to write. - - - - - Writes a value to the specified memory - location. - - - The object instance representing the base - memory location. - - - The integer offset from the base memory location where the - value to be written is located. - - - The value to write. - - - - - Generates a hash code value for the object. - - - The object instance used to calculate the hash code. - - - Non-zero if different object instances with the same value should - generate different hash codes, where applicable. This parameter - has no effect on the .NET Compact Framework. - - - The hash code value -OR- zero if the object is null. - - - - - This class represents a managed virtual table module implementation. - It is not sealed and must be used as the base class for any - user-defined virtual table module classes implemented in managed code. - - - - - The default version of the native sqlite3_module structure in use. - - - - - This field is used to store the native sqlite3_module structure - associated with this object instance. - - - - - This field is used to store the destructor delegate to be passed to - the SQLite core library via the sqlite3_create_disposable_module() - function. - - - - - This field is used to store a pointer to the native sqlite3_module - structure returned by the sqlite3_create_disposable_module - function. - - - - - This field is used to store the virtual table instances associated - with this module. The native pointer to the sqlite3_vtab derived - structure is used to key into this collection. - - - - - This field is used to store the virtual table cursor instances - associated with this module. The native pointer to the - sqlite3_vtab_cursor derived structure is used to key into this - collection. - - - - - This field is used to store the virtual table function instances - associated with this module. The case-insensitive function name - and the number of arguments (with -1 meaning "any") are used to - construct the string that is used to key into this collection. - - - - - Constructs an instance of this class. - - - The name of the module. This parameter cannot be null. - - - - - Calls the native SQLite core library in order to create a new - disposable module containing the implementation of a virtual table. - - - The native database connection pointer to use. - - - Non-zero upon success. - - - - - This method is called by the SQLite core library when the native - module associated with this object instance is being destroyed due - to its parent connection being closed. It may also be called by - the "vtshim" module if/when the sqlite3_dispose_module() function - is called. - - - The native user-data pointer associated with this module, as it was - provided to the SQLite core library when the native module instance - was created. - - - - - Creates and returns the native sqlite_module structure using the - configured (or default) - interface implementation. - - - The native sqlite_module structure using the configured (or - default) interface - implementation. - - - - - Creates and returns the native sqlite_module structure using the - specified interface - implementation. - - - The interface implementation to - use. - - - The native sqlite_module structure using the specified - interface implementation. - - - - - Creates a copy of the specified - object instance, - using default implementations for the contained delegates when - necessary. - - - The object - instance to copy. - - - The new object - instance. - - - - - Calls one of the virtual table initialization methods. - - - Non-zero to call the - method; otherwise, the - method will be called. - - - The native database connection handle. - - - The original native pointer value that was provided to the - sqlite3_create_module(), sqlite3_create_module_v2() or - sqlite3_create_disposable_module() functions. - - - The number of arguments from the CREATE VIRTUAL TABLE statement. - - - The array of string arguments from the CREATE VIRTUAL TABLE - statement. - - - Upon success, this parameter must be modified to point to the newly - created native sqlite3_vtab derived structure. - - - Upon failure, this parameter must be modified to point to the error - message, with the underlying memory having been obtained from the - sqlite3_malloc() function. - - - A standard SQLite return code. - - - - - Calls one of the virtual table finalization methods. - - - Non-zero to call the - method; otherwise, the - method will be - called. - - - The native pointer to the sqlite3_vtab derived structure. - - - A standard SQLite return code. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance to be used. - - - The native pointer to the sqlite3_vtab derived structure. - - - Non-zero if this error message should also be logged using the - class. - - - Non-zero if caught exceptions should be logged using the - class. - - - The error message. - - - Non-zero upon success. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance to be used. - - - The object instance used to - lookup the native pointer to the sqlite3_vtab derived structure. - - - Non-zero if this error message should also be logged using the - class. - - - Non-zero if caught exceptions should be logged using the - class. - - - The error message. - - - Non-zero upon success. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance to be used. - - - The native pointer to the sqlite3_vtab_cursor derived structure - used to get the native pointer to the sqlite3_vtab derived - structure. - - - Non-zero if this error message should also be logged using the - class. - - - Non-zero if caught exceptions should be logged using the - class. - - - The error message. - - - Non-zero upon success. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance to be used. - - - The object instance used to - lookup the native pointer to the sqlite3_vtab derived structure. - - - Non-zero if this error message should also be logged using the - class. - - - Non-zero if caught exceptions should be logged using the - class. - - - The error message. - - - Non-zero upon success. - - - - - Gets and returns the interface - implementation to be used when creating the native sqlite3_module - structure. Derived classes may override this method to supply an - alternate implementation for the - interface. - - - The interface implementation to - be used when populating the native sqlite3_module structure. If - the returned value is null, the private methods provided by the - class and relating to the - interface will be used to - create the necessary delegates. - - - - - Creates and returns the - interface implementation corresponding to the current - object instance. - - - The interface implementation - corresponding to the current object - instance. - - - - - Allocates a native sqlite3_vtab derived structure and returns a - native pointer to it. - - - A native pointer to a native sqlite3_vtab derived structure. - - - - - Zeros out the fields of a native sqlite3_vtab derived structure. - - - The native pointer to the native sqlite3_vtab derived structure to - zero. - - - - - Frees a native sqlite3_vtab structure using the provided native - pointer to it. - - - A native pointer to a native sqlite3_vtab derived structure. - - - - - Allocates a native sqlite3_vtab_cursor derived structure and - returns a native pointer to it. - - - A native pointer to a native sqlite3_vtab_cursor derived structure. - - - - - Frees a native sqlite3_vtab_cursor structure using the provided - native pointer to it. - - - A native pointer to a native sqlite3_vtab_cursor derived structure. - - - - - Reads and returns the native pointer to the sqlite3_vtab derived - structure based on the native pointer to the sqlite3_vtab_cursor - derived structure. - - - The object instance to be used. - - - The native pointer to the sqlite3_vtab_cursor derived structure - from which to read the native pointer to the sqlite3_vtab derived - structure. - - - The native pointer to the sqlite3_vtab derived structure -OR- - if it cannot be determined. - - - - - Reads and returns the native pointer to the sqlite3_vtab derived - structure based on the native pointer to the sqlite3_vtab_cursor - derived structure. - - - The native pointer to the sqlite3_vtab_cursor derived structure - from which to read the native pointer to the sqlite3_vtab derived - structure. - - - The native pointer to the sqlite3_vtab derived structure -OR- - if it cannot be determined. - - - - - Looks up and returns the object - instance based on the native pointer to the sqlite3_vtab derived - structure. - - - The native pointer to the sqlite3_vtab derived structure. - - - The object instance or null if - the corresponding one cannot be found. - - - - - Allocates and returns a native pointer to a sqlite3_vtab derived - structure and creates an association between it and the specified - object instance. - - - The object instance to be used - when creating the association. - - - The native pointer to a sqlite3_vtab derived structure or - if the method fails for any reason. - - - - - Looks up and returns the - object instance based on the native pointer to the - sqlite3_vtab_cursor derived structure. - - - The native pointer to the sqlite3_vtab derived structure. - - - The native pointer to the sqlite3_vtab_cursor derived structure. - - - The object instance or null - if the corresponding one cannot be found. - - - - - Allocates and returns a native pointer to a sqlite3_vtab_cursor - derived structure and creates an association between it and the - specified object instance. - - - The object instance to be - used when creating the association. - - - The native pointer to a sqlite3_vtab_cursor derived structure or - if the method fails for any reason. - - - - - Deterimines the key that should be used to identify and store the - object instance for the virtual table - (i.e. to be returned via the - method). - - - The number of arguments to the virtual table function. - - - The name of the virtual table function. - - - The object instance associated with - this virtual table function. - - - The string that should be used to identify and store the virtual - table function instance. This method cannot return null. If null - is returned from this method, the behavior is undefined. - - - - - Attempts to declare the schema for the virtual table using the - specified database connection. - - - The object instance to use when - declaring the schema of the virtual table. This parameter may not - be null. - - - The string containing the CREATE TABLE statement that completely - describes the schema for the virtual table. This parameter may not - be null. - - - Upon failure, this parameter must be modified to contain an error - message. - - - A standard SQLite return code. - - - - - Calls the native SQLite core library in order to declare a virtual - table function in response to a call into the - - or virtual table - methods. - - - The object instance to use when - declaring the schema of the virtual table. - - - The number of arguments to the function being declared. - - - The name of the function being declared. - - - Upon success, the contents of this parameter are undefined. Upon - failure, it should contain an appropriate error message. - - - A standard SQLite return code. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The native pointer to the sqlite3_vtab derived structure. - - - The error message. - - - Non-zero upon success. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance used to - lookup the native pointer to the sqlite3_vtab derived structure. - - - The error message. - - - Non-zero upon success. - - - - - Arranges for the specified error message to be placed into the - zErrMsg field of a sqlite3_vtab derived structure, freeing the - existing error message, if any. - - - The object instance used to - lookup the native pointer to the sqlite3_vtab derived structure. - - - The error message. - - - Non-zero upon success. - - - - - Modifies the specified object instance - to contain the specified estimated cost. - - - The object instance to modify. - - - The estimated cost value to use. Using a null value means that the - default value provided by the SQLite core library should be used. - - - Non-zero upon success. - - - - - Modifies the specified object instance - to contain the default estimated cost. - - - The object instance to modify. - - - Non-zero upon success. - - - - - Modifies the specified object instance - to contain the specified estimated rows. - - - The object instance to modify. - - - The estimated rows value to use. Using a null value means that the - default value provided by the SQLite core library should be used. - - - Non-zero upon success. - - - - - Modifies the specified object instance - to contain the default estimated rows. - - - The object instance to modify. - - - Non-zero upon success. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - This method is called in response to the - method. - - - The object instance associated with - the virtual table. - - - The native user-data pointer associated with this module, as it was - provided to the SQLite core library when the native module instance - was created. - - - The module name, database name, virtual table name, and all other - arguments passed to the CREATE VIRTUAL TABLE statement. - - - Upon success, this parameter must be modified to contain the - object instance associated with - the virtual table. - - - Upon failure, this parameter must be modified to contain an error - message. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated with - the virtual table. - - - The native user-data pointer associated with this module, as it was - provided to the SQLite core library when the native module instance - was created. - - - The module name, database name, virtual table name, and all other - arguments passed to the CREATE VIRTUAL TABLE statement. - - - Upon success, this parameter must be modified to contain the - object instance associated with - the virtual table. - - - Upon failure, this parameter must be modified to contain an error - message. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The object instance containing all the - data for the inputs and outputs relating to index selection. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - Upon success, this parameter must be modified to contain the - object instance associated - with the newly opened virtual table cursor. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Number used to help identify the selected index. - - - String used to help identify the selected index. - - - The values corresponding to each column in the selected index. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Non-zero if no more rows are available; zero otherwise. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - The object instance to be used for - returning the specified column value to the SQLite core library. - - - The zero-based index corresponding to the column containing the - value to be returned. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the current row for the specified cursor. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The array of object instances containing - the new or modified column values, if any. - - - Upon success, this parameter must be modified to contain the unique - integer row identifier for the row that was inserted, if any. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The number of arguments to the function being sought. - - - The name of the function being sought. - - - Upon success, this parameter must be modified to contain the - object instance responsible for - implementing the specified function. - - - Upon success, this parameter must be modified to contain the - native user-data pointer associated with - . - - - Non-zero if the specified function was found; zero otherwise. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - The new name for the virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer identifier under which the the current state of - the virtual table should be saved. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer used to indicate that any saved states with an - identifier greater than or equal to this should be deleted by the - virtual table. - - - A standard SQLite return code. - - - - - This method is called in response to the - method. - - - The object instance associated - with this virtual table. - - - This is an integer identifier used to specify a specific saved - state for the virtual table for it to restore itself back to, which - should also have the effect of deleting all saved states with an - integer identifier greater than this one. - - - A standard SQLite return code. - - - - - Disposes of this object instance. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is being - called from the finalizer. - - - - - Finalizes this object instance. - - - - - Returns or sets a boolean value indicating whether virtual table - errors should be logged using the class. - - - - - Returns or sets a boolean value indicating whether exceptions - caught in the - method, - the method, - the method, - the method, - and the method should be logged using the - class. - - - - - Returns or sets a boolean value indicating whether virtual table - errors should be logged using the class. - - - - - Returns or sets a boolean value indicating whether exceptions - caught in the - method, - method, and the - method should be logged using the - class. - - - - - Returns non-zero if the schema for the virtual table has been - declared. - - - - - Returns the name of the module as it was registered with the SQLite - core library. - - - - - This class implements the - interface by forwarding those method calls to the - object instance it contains. If the - contained object instance is null, all - the methods simply generate an - error. - - - - - This is the value that is always used for the "logErrors" - parameter to the various static error handling methods provided - by the class. - - - - - This is the value that is always used for the "logExceptions" - parameter to the various static error handling methods provided - by the class. - - - - - This is the error message text used when the contained - object instance is not available - for any reason. - - - - - The object instance used to provide - an implementation of the - interface. - - - - - Constructs an instance of this class. - - - The object instance used to provide - an implementation of the - interface. - - - - - Sets the table error message to one that indicates the native - module implementation is not available. - - - The native pointer to the sqlite3_vtab derived structure. - - - The value of . - - - - - Sets the table error message to one that indicates the native - module implementation is not available. - - - The native pointer to the sqlite3_vtab_cursor derived - structure. - - - The value of . - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - Disposes of this object instance. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is being - called from the finalizer. - - - - - Finalizes this object instance. - - - - - This class represents a virtual table cursor to be used with the - class. It is not sealed and may - be used as the base class for any user-defined virtual table cursor - class that wraps an object instance. - - - - - The instance provided when this cursor - was created. - - - - - This value will be non-zero if false has been returned from the - method. - - - - - Constructs an instance of this class. - - - The object instance associated - with this object instance. - - - The instance to expose as a virtual - table cursor. - - - - - Advances to the next row of the virtual table cursor using the - method of the - object instance. - - - Non-zero if the current row is valid; zero otherwise. If zero is - returned, no further rows are available. - - - - - Resets the virtual table cursor position, also invalidating the - current row, using the method of - the object instance. - - - - - Closes the virtual table cursor. This method must not throw any - exceptions. - - - - - Throws an if the virtual - table cursor has been closed. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is - being called from the finalizer. - - - - - Returns the value for the current row of the virtual table cursor - using the property of the - object instance. - - - - - Returns non-zero if the end of the virtual table cursor has been - seen (i.e. no more rows are available, including the current one). - - - - - Returns non-zero if the virtual table cursor is open. - - - - - This class implements a virtual table module that exposes an - object instance as a read-only virtual - table. It is not sealed and may be used as the base class for any - user-defined virtual table class that wraps an - object instance. The following short - example shows it being used to treat an array of strings as a table - data source: - - public static class Sample - { - public static void Main() - { - using (SQLiteConnection connection = new SQLiteConnection( - "Data Source=:memory:;")) - { - connection.Open(); - - connection.CreateModule(new SQLiteModuleEnumerable( - "sampleModule", new string[] { "one", "two", "three" })); - - using (SQLiteCommand command = connection.CreateCommand()) - { - command.CommandText = - "CREATE VIRTUAL TABLE t1 USING sampleModule;"; - - command.ExecuteNonQuery(); - } - - using (SQLiteCommand command = connection.CreateCommand()) - { - command.CommandText = "SELECT * FROM t1;"; - - using (SQLiteDataReader dataReader = command.ExecuteReader()) - { - while (dataReader.Read()) - Console.WriteLine(dataReader[0].ToString()); - } - } - - connection.Close(); - } - } - } - - - - - - This class implements a virtual table module that does nothing by - providing "empty" implementations for all of the - interface methods. The result - codes returned by these "empty" method implementations may be - controlled on a per-method basis by using and/or overriding the - , - , - , - , and - methods from within derived classes. - - - - - This field is used to store the - values to return, on a per-method basis, for all methods that are - part of the interface. - - - - - Constructs an instance of this class. - - - The name of the module. This parameter cannot be null. - - - - - Determines the default value to be - returned by methods of the - interface that lack an overridden implementation in all classes - derived from the class. - - - The value that should be returned - by all interface methods unless - a more specific result code has been set for that interface method. - - - - - Converts a value into a boolean - return value for use with the - method. - - - The value to convert. - - - The value. - - - - - Converts a value into a boolean - return value for use with the - method. - - - The value to convert. - - - The value. - - - - - Determines the value that should be - returned by the specified - interface method if it lack an overridden implementation. If no - specific value is available (or set) - for the specified method, the value - returned by the method will be - returned instead. - - - The name of the method. Currently, this method must be part of - the interface. - - - The value that should be returned - by the interface method. - - - - - Sets the value that should be - returned by the specified - interface method if it lack an overridden implementation. - - - The name of the method. Currently, this method must be part of - the interface. - - - The value that should be returned - by the interface method. - - - Non-zero upon success. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is - being called from the finalizer. - - - - - The CREATE TABLE statement used to declare the schema for the - virtual table. - - - - - The instance containing the backing data - for the virtual table. - - - - - Non-zero if different object instances with the same value should - generate different row identifiers, where applicable. This has no - effect on the .NET Compact Framework. - - - - - Constructs an instance of this class. - - - The name of the module. This parameter cannot be null. - - - The instance to expose as a virtual - table. This parameter cannot be null. - - - - - Constructs an instance of this class. - - - The name of the module. This parameter cannot be null. - - - The instance to expose as a virtual - table. This parameter cannot be null. - - - Non-zero if different object instances with the same value should - generate different row identifiers, where applicable. This - parameter has no effect on the .NET Compact Framework. - - - - - Determines the SQL statement used to declare the virtual table. - This method should be overridden in derived classes if they require - a custom virtual table schema. - - - The SQL statement used to declare the virtual table -OR- null if it - cannot be determined. - - - - - Sets the table error message to one that indicates the virtual - table cursor is of the wrong type. - - - The object instance. - - - The value of . - - - - - Sets the table error message to one that indicates the virtual - table cursor has no current row. - - - The object instance. - - - The value of . - - - - - Determines the string to return as the column value for the object - instance value. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - The object instance to return a string representation for. - - - The string representation of the specified object instance or null - upon failure. - - - - - Constructs an unique row identifier from two - values. The first value - must contain the row sequence number for the current row and the - second value must contain the hash code of the enumerator value - for the current row. - - - The integer row sequence number for the current row. - - - The hash code of the enumerator value for the current row. - - - The unique row identifier or zero upon failure. - - - - - Determines the unique row identifier for the current row. - - - The object instance - associated with the previously opened virtual table cursor to be - used. - - - The object instance to return a unique row identifier for. - - - The unique row identifier or zero upon failure. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is - being called from the finalizer. - - - - - This class represents a virtual table cursor to be used with the - class. It is not sealed and may - be used as the base class for any user-defined virtual table cursor - class that wraps an object instance. - - - - - The instance provided when this - cursor was created. - - - - - Constructs an instance of this class. - - - The object instance associated - with this object instance. - - - The instance to expose as a virtual - table cursor. - - - - - Closes the virtual table cursor. This method must not throw any - exceptions. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is - being called from the finalizer. - - - - - Returns the value for the current row of the virtual table cursor - using the property of the - object instance. - - - - - This class implements a virtual table module that exposes an - object instance as a read-only virtual - table. It is not sealed and may be used as the base class for any - user-defined virtual table class that wraps an - object instance. - - - - - The instance containing the backing - data for the virtual table. - - - - - Constructs an instance of this class. - - - The name of the module. This parameter cannot be null. - - - The instance to expose as a virtual - table. This parameter cannot be null. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - See the method. - - - - - Throws an if this object - instance has been disposed. - - - - - Disposes of this object instance. - - - Non-zero if this method is being called from the - method. Zero if this method is - being called from the finalizer. - - -
-
diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.5/x64/SQLite.Interop.dll b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.5/x64/SQLite.Interop.dll deleted file mode 100644 index fd4ce999..00000000 Binary files a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.5/x64/SQLite.Interop.dll and /dev/null differ diff --git a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.5/x86/SQLite.Interop.dll b/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.5/x86/SQLite.Interop.dll deleted file mode 100644 index e12a1998..00000000 Binary files a/test/Spring/Spring.Web.Conversation.NHibernate5.Tests/lib/net/4.5/x86/SQLite.Interop.dll and /dev/null differ diff --git a/test/Spring/Spring.Web.Tests/Spring.Web.Tests.csproj b/test/Spring/Spring.Web.Tests/Spring.Web.Tests.csproj index eca9c03d..6b9532ec 100644 --- a/test/Spring/Spring.Web.Tests/Spring.Web.Tests.csproj +++ b/test/Spring/Spring.Web.Tests/Spring.Web.Tests.csproj @@ -28,7 +28,14 @@ - + + Data\%(RecursiveDir)%(Filename)%(Extension) + PreserveNewest + + + %(RecursiveDir)%(Filename)%(Extension) + PreserveNewest + @@ -42,7 +49,4 @@ - - - \ No newline at end of file diff --git a/test/Spring/Spring.Web.Tests/Threading/HttpContextStorageTests.cs b/test/Spring/Spring.Web.Tests/Threading/HttpContextStorageTests.cs index e201fad5..f7380b67 100644 --- a/test/Spring/Spring.Web.Tests/Threading/HttpContextStorageTests.cs +++ b/test/Spring/Spring.Web.Tests/Threading/HttpContextStorageTests.cs @@ -1,7 +1,7 @@ #region License /* - * Copyright © 2002-2011 the original author or authors. + * Copyright © 2002-2011 the original author or authors. * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License.