diff --git a/Spring.Net.2002.sln b/Spring.Net.2002.sln
deleted file mode 100644
index 91b574fa..00000000
--- a/Spring.Net.2002.sln
+++ /dev/null
@@ -1,34 +0,0 @@
-Microsoft Visual Studio Solution File, Format Version 7.00
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Core.Tests.2002", "test\Spring\Spring.Core.Tests\Spring.Core.Tests.2002.csproj", "{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}"
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Core.2002", "src\Spring\Spring.Core\Spring.Core.2002.csproj", "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Aop.2002", "src\Spring\Spring.Aop\Spring.Aop.2002.csproj", "{828F16E3-20A4-4EC4-A8F4-CD95B8ED44C9}"
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Aop.Tests.2002", "test\Spring\Spring.Aop.Tests\Spring.Aop.Tests.2002.csproj", "{F856BCAE-421E-469A-B75F-E41E5BA7F160}"
-EndProject
-Global
-	GlobalSection(SolutionConfiguration) = preSolution
-		ConfigName.0 = Debug-1.0
-		ConfigName.1 = Release-1.0
-	EndGlobalSection
-	GlobalSection(ProjectDependencies) = postSolution
-	EndGlobalSection
-	GlobalSection(ProjectConfiguration) = postSolution
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug-1.0.ActiveCfg = Debug|.NET
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release-1.0.ActiveCfg = Release|.NET
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug-1.0.ActiveCfg = Debug|.NET
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug-1.0.Build.0 = Debug|.NET
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release-1.0.ActiveCfg = Release|.NET
-		{828F16E3-20A4-4EC4-A8F4-CD95B8ED44C9}.Debug-1.0.ActiveCfg = Debug|.NET
-		{828F16E3-20A4-4EC4-A8F4-CD95B8ED44C9}.Release-1.0.ActiveCfg = Release|.NET
-		{F856BCAE-421E-469A-B75F-E41E5BA7F160}.Debug-1.0.ActiveCfg = Debug|.NET
-		{F856BCAE-421E-469A-B75F-E41E5BA7F160}.Release-1.0.ActiveCfg = Release|.NET
-	EndGlobalSection
-	GlobalSection(SolutionItems) = postSolution
-	EndGlobalSection
-	GlobalSection(ExtensibilityGlobals) = postSolution
-	EndGlobalSection
-	GlobalSection(ExtensibilityAddIns) = postSolution
-	EndGlobalSection
-EndGlobal
diff --git a/Spring.Net.2003.sln b/Spring.Net.2003.sln
deleted file mode 100644
index 2449db86..00000000
--- a/Spring.Net.2003.sln
+++ /dev/null
@@ -1,151 +0,0 @@
-Microsoft Visual Studio Solution File, Format Version 8.00
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Core.2003", "src\Spring\Spring.Core\Spring.Core.2003.csproj", "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Core.Tests.2003", "test\Spring\Spring.Core.Tests\Spring.Core.Tests.2003.csproj", "{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Aop.2003", "src\Spring\Spring.Aop\Spring.Aop.2003.csproj", "{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Aop.Tests.2003", "test\Spring\Spring.Aop.Tests\Spring.Aop.Tests.2003.csproj", "{2111596A-0327-4C9D-8919-294FBD988A23}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Web.2003", "src\Spring\Spring.Web\Spring.Web.2003.csproj", "{BA4789EB-281A-48EA-8763-28B9F0596A18}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Web.Tests.2003", "test\Spring\Spring.Web.Tests\Spring.Web.Tests.2003.csproj", "{EB2587B7-8B26-4FBC-852A-4128D5CACAFC}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Services.2003", "src\Spring\Spring.Services\Spring.Services.2003.csproj", "{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Services.Tests.2003", "test\Spring\Spring.Services.Tests\Spring.Services.Tests.2003.csproj", "{EB2687B7-8B26-4FBC-852A-4128D5CACAFC}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.2003", "src\Spring\Spring.Data\Spring.Data.2003.csproj", "{E10A3BED-795F-41CB-A4A8-8C4B342ACDDF}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.Tests.2003", "test\Spring\Spring.Data.Tests\Spring.Data.Tests.2003.csproj", "{C5585365-561C-4EC4-8956-87FFBD9AB1CD}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.Integration.Tests.2003", "test\Spring\Spring.Data.Integration.Tests\Spring.Data.Integration.Tests.2003.csproj", "{A9D3732A-D40B-4C35-80CE-9C4A53D2DEAD}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Testing.NUnit.2003", "src\Spring\Spring.Testing.NUnit\Spring.Testing.NUnit.2003.csproj", "{6B8639E3-88BB-4F7B-9F23-699E84C30D58}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.NHibernate.Tests.2003", "test\Spring\Spring.Data.NHibernate.Tests\Spring.Data.NHibernate.Tests.2003.csproj", "{8755D942-7828-4971-835B-37A5992C06C9}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Testing.NUnit.Tests.2003", "test\Spring\Spring.Testing.NUnit.Tests\Spring.Testing.NUnit.Tests.2003.csproj", "{E2689B4A-A951-420E-A274-BE5EBCD5F8D8}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.NHibernate12.2003", "src\Spring\Spring.Data.NHibernate12\Spring.Data.NHibernate12.2003.csproj", "{2E12AE3E-5690-46A5-9F89-80F1D3004ADB}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Scheduling.Quartz.2003", "src\Spring\Spring.Scheduling.Quartz\Spring.Scheduling.Quartz.2003.csproj", "{0C0D8C65-90DE-4914-9940-4C684C54971B}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(VisualSVN) = preSolution
-	EndGlobalSection
-	GlobalSection(SolutionConfiguration) = preSolution
-		Debug-1.1 = Debug-1.1
-		Release-1.1 = Release-1.1
-	EndGlobalSection
-	GlobalSection(ProjectDependencies) = postSolution
-	EndGlobalSection
-	GlobalSection(ProjectConfiguration) = postSolution
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release-1.1.Build.0 = Release-1.1|.NET
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release-1.1.Build.0 = Release-1.1|.NET
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release-1.1.Build.0 = Release-1.1|.NET
-		{2111596A-0327-4C9D-8919-294FBD988A23}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{2111596A-0327-4C9D-8919-294FBD988A23}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{2111596A-0327-4C9D-8919-294FBD988A23}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{2111596A-0327-4C9D-8919-294FBD988A23}.Release-1.1.Build.0 = Release-1.1|.NET
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Release-1.1.Build.0 = Release-1.1|.NET
-		{EB2587B7-8B26-4FBC-852A-4128D5CACAFC}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{EB2587B7-8B26-4FBC-852A-4128D5CACAFC}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{EB2587B7-8B26-4FBC-852A-4128D5CACAFC}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{EB2587B7-8B26-4FBC-852A-4128D5CACAFC}.Release-1.1.Build.0 = Release-1.1|.NET
-		{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}.Release-1.1.Build.0 = Release-1.1|.NET
-		{EB2687B7-8B26-4FBC-852A-4128D5CACAFC}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{EB2687B7-8B26-4FBC-852A-4128D5CACAFC}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{EB2687B7-8B26-4FBC-852A-4128D5CACAFC}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{EB2687B7-8B26-4FBC-852A-4128D5CACAFC}.Release-1.1.Build.0 = Release-1.1|.NET
-		{E10A3BED-795F-41CB-A4A8-8C4B342ACDDF}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{E10A3BED-795F-41CB-A4A8-8C4B342ACDDF}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{E10A3BED-795F-41CB-A4A8-8C4B342ACDDF}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{E10A3BED-795F-41CB-A4A8-8C4B342ACDDF}.Release-1.1.Build.0 = Release-1.1|.NET
-		{C5585365-561C-4EC4-8956-87FFBD9AB1CD}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{C5585365-561C-4EC4-8956-87FFBD9AB1CD}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{C5585365-561C-4EC4-8956-87FFBD9AB1CD}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{C5585365-561C-4EC4-8956-87FFBD9AB1CD}.Release-1.1.Build.0 = Release-1.1|.NET
-		{A9D3732A-D40B-4C35-80CE-9C4A53D2DEAD}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{A9D3732A-D40B-4C35-80CE-9C4A53D2DEAD}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{A9D3732A-D40B-4C35-80CE-9C4A53D2DEAD}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{A9D3732A-D40B-4C35-80CE-9C4A53D2DEAD}.Release-1.1.Build.0 = Release-1.1|.NET
-		{6B8639E3-88BB-4F7B-9F23-699E84C30D58}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{6B8639E3-88BB-4F7B-9F23-699E84C30D58}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{6B8639E3-88BB-4F7B-9F23-699E84C30D58}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{6B8639E3-88BB-4F7B-9F23-699E84C30D58}.Release-1.1.Build.0 = Release-1.1|.NET
-		{8755D942-7828-4971-835B-37A5992C06C9}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{8755D942-7828-4971-835B-37A5992C06C9}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{8755D942-7828-4971-835B-37A5992C06C9}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{8755D942-7828-4971-835B-37A5992C06C9}.Release-1.1.Build.0 = Release-1.1|.NET
-		{E2689B4A-A951-420E-A274-BE5EBCD5F8D8}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{E2689B4A-A951-420E-A274-BE5EBCD5F8D8}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{E2689B4A-A951-420E-A274-BE5EBCD5F8D8}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{E2689B4A-A951-420E-A274-BE5EBCD5F8D8}.Release-1.1.Build.0 = Release-1.1|.NET
-		{2E12AE3E-5690-46A5-9F89-80F1D3004ADB}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{2E12AE3E-5690-46A5-9F89-80F1D3004ADB}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{2E12AE3E-5690-46A5-9F89-80F1D3004ADB}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{2E12AE3E-5690-46A5-9F89-80F1D3004ADB}.Release-1.1.Build.0 = Release-1.1|.NET
-		{0C0D8C65-90DE-4914-9940-4C684C54971B}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{0C0D8C65-90DE-4914-9940-4C684C54971B}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{0C0D8C65-90DE-4914-9940-4C684C54971B}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{0C0D8C65-90DE-4914-9940-4C684C54971B}.Release-1.1.Build.0 = Release-1.1|.NET
-	EndGlobalSection
-	GlobalSection(SolutionItems) = postSolution
-		common-project.include = common-project.include
-		doc\NamespaceSummary.xml = doc\NamespaceSummary.xml
-		Spring.build = Spring.build
-		Spring.include = Spring.include
-	EndGlobalSection
-	GlobalSection(ExtensibilityGlobals) = postSolution
-	EndGlobalSection
-	GlobalSection(ExtensibilityAddIns) = postSolution
-	EndGlobalSection
-EndGlobal
diff --git a/Spring.Net.2005.sln b/Spring.Net.2005.sln
deleted file mode 100644
index de9286aa..00000000
--- a/Spring.Net.2005.sln
+++ /dev/null
@@ -1,426 +0,0 @@
-Microsoft Visual Studio Solution File, Format Version 9.00
-# Visual Studio 2005
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Core.2005", "src\Spring\Spring.Core\Spring.Core.2005.csproj", "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Core.Tests.2005", "test\Spring\Spring.Core.Tests\Spring.Core.Tests.2005.csproj", "{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Aop.2005", "src\Spring\Spring.Aop\Spring.Aop.2005.csproj", "{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Aop.Tests.2005", "test\Spring\Spring.Aop.Tests\Spring.Aop.Tests.2005.csproj", "{2111596A-0327-4C9D-8919-294FBD988A23}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{2150E333-8FDC-42A3-9474-1A3956D46DE8}") = "Solution Items", "Solution Items", "{F04753EF-7A1B-4837-AB63-8C0821E8155D}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Services.2005", "src\Spring\Spring.Services\Spring.Services.2005.csproj", "{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Services.Tests.2005", "test\Spring\Spring.Services.Tests\Spring.Services.Tests.2005.csproj", "{EB2687B7-8B26-4FBC-852A-4128D5CACAFC}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Web.2005", "src\Spring\Spring.Web\Spring.Web.2005.csproj", "{BA4789EB-281A-48EA-8763-28B9F0596A18}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Web.Tests.2005", "test\Spring\Spring.Web.Tests\Spring.Web.Tests.2005.csproj", "{C67E47AA-1ACD-41B4-A465-4D336A2319CA}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.2005", "src\Spring\Spring.Data\Spring.Data.2005.csproj", "{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.Tests.2005", "test\Spring\Spring.Data.Tests\Spring.Data.Tests.2005.csproj", "{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.Integration.Tests.2005", "test\Spring\Spring.Data.Integration.Tests\Spring.Data.Integration.Tests.2005.csproj", "{91766D21-C568-459F-9BEA-759B011F23CF}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Web.Extensions.2005", "src\Spring\Spring.Web.Extensions\Spring.Web.Extensions.2005.csproj", "{E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Testing.NUnit.2005", "src\Spring\Spring.Testing.NUnit\Spring.Testing.NUnit.2005.csproj", "{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.NHibernate12.2005", "src\Spring\Spring.Data.NHibernate12\Spring.Data.NHibernate12.2005.csproj", "{90F2D070-6F98-4926-A626-BD7A6071D6D9}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Testing.NUnit.Tests.2005", "test\Spring\Spring.Testing.NUnit.Tests\Spring.Testing.NUnit.Tests.2005.csproj", "{4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Scheduling.Quartz.2005", "src\Spring\Spring.Scheduling.Quartz\Spring.Scheduling.Quartz.2005.csproj", "{E823D54C-CE82-4868-929F-5F95A999F61E}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Scheduling.Quartz.Tests.2005", "test\Spring\Spring.Scheduling.Quartz.Tests\Spring.Scheduling.Quartz.Tests.2005.csproj", "{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Messaging.Nms.2005", "src\Spring\Spring.Messaging.Nms\Spring.Messaging.Nms.2005.csproj", "{AEB1578C-9018-4D49-B440-789F38DD2F29}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Messaging.Nms.Tests.2005", "test\Spring\Spring.Messaging.Nms.Tests\Spring.Messaging.Nms.Tests.2005.csproj", "{FA7A6931-7DBE-4A32-A312-51FAD2E80332}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.NHibernate20.2005", "src\Spring\Spring.Data.NHibernate20\Spring.Data.NHibernate20.2005.csproj", "{71368632-B8B7-4A6A-8C65-8DA848120C82}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Messaging.2005", "src\Spring\Spring.Messaging\Spring.Messaging.2005.csproj", "{0E23AE41-D8D8-41C2-84A2-D35564049F0D}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Messaging.Tests.2005", "test\Spring\Spring.Messaging.Tests\Spring.Messaging.Tests.2005.csproj", "{41BC3AEA-7EB3-48BF-B1EC-84119376AC98}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.NHibernate20.Tests.2005", "test\Spring\Spring.Data.NHibernate20.Tests\Spring.Data.NHibernate20.Tests.2005.csproj", "{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfigurationPlatforms) = preSolution
-		Debug|.NET = Debug|.NET
-		Debug|Any CPU = Debug|Any CPU
-		Debug|Mixed Platforms = Debug|Mixed Platforms
-		Release|.NET = Release|.NET
-		Release|Any CPU = Release|Any CPU
-		Release|Mixed Platforms = Release|Mixed Platforms
-	EndGlobalSection
-	GlobalSection(ProjectConfigurationPlatforms) = postSolution
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|.NET.Build.0 = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|.NET.ActiveCfg = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|.NET.Build.0 = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Any CPU.Build.0 = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|.NET.Build.0 = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|.NET.ActiveCfg = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|.NET.Build.0 = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Any CPU.Build.0 = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|.NET.Build.0 = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|.NET.ActiveCfg = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|.NET.Build.0 = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Any CPU.Build.0 = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{2111596A-0327-4C9D-8919-294FBD988A23}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{2111596A-0327-4C9D-8919-294FBD988A23}.Debug|.NET.Build.0 = Debug|Any CPU
-		{2111596A-0327-4C9D-8919-294FBD988A23}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{2111596A-0327-4C9D-8919-294FBD988A23}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{2111596A-0327-4C9D-8919-294FBD988A23}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{2111596A-0327-4C9D-8919-294FBD988A23}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{2111596A-0327-4C9D-8919-294FBD988A23}.Release|.NET.ActiveCfg = Release|Any CPU
-		{2111596A-0327-4C9D-8919-294FBD988A23}.Release|.NET.Build.0 = Release|Any CPU
-		{2111596A-0327-4C9D-8919-294FBD988A23}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{2111596A-0327-4C9D-8919-294FBD988A23}.Release|Any CPU.Build.0 = Release|Any CPU
-		{2111596A-0327-4C9D-8919-294FBD988A23}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{2111596A-0327-4C9D-8919-294FBD988A23}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}.Debug|.NET.Build.0 = Debug|Any CPU
-		{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}.Release|.NET.ActiveCfg = Release|Any CPU
-		{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}.Release|.NET.Build.0 = Release|Any CPU
-		{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}.Release|Any CPU.Build.0 = Release|Any CPU
-		{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{EB2687B7-8B26-4FBC-852A-4128D5CACAFC}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{EB2687B7-8B26-4FBC-852A-4128D5CACAFC}.Debug|.NET.Build.0 = Debug|Any CPU
-		{EB2687B7-8B26-4FBC-852A-4128D5CACAFC}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{EB2687B7-8B26-4FBC-852A-4128D5CACAFC}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{EB2687B7-8B26-4FBC-852A-4128D5CACAFC}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{EB2687B7-8B26-4FBC-852A-4128D5CACAFC}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{EB2687B7-8B26-4FBC-852A-4128D5CACAFC}.Release|.NET.ActiveCfg = Release|Any CPU
-		{EB2687B7-8B26-4FBC-852A-4128D5CACAFC}.Release|.NET.Build.0 = Release|Any CPU
-		{EB2687B7-8B26-4FBC-852A-4128D5CACAFC}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{EB2687B7-8B26-4FBC-852A-4128D5CACAFC}.Release|Any CPU.Build.0 = Release|Any CPU
-		{EB2687B7-8B26-4FBC-852A-4128D5CACAFC}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{EB2687B7-8B26-4FBC-852A-4128D5CACAFC}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Debug|.NET.Build.0 = Debug|Any CPU
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Release|.NET.ActiveCfg = Release|Any CPU
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Release|.NET.Build.0 = Release|Any CPU
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Release|Any CPU.Build.0 = Release|Any CPU
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Debug|.NET.Build.0 = Debug|Any CPU
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Release|.NET.ActiveCfg = Release|Any CPU
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Release|.NET.Build.0 = Release|Any CPU
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Release|Any CPU.Build.0 = Release|Any CPU
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|.NET.Build.0 = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|.NET.ActiveCfg = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|.NET.Build.0 = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Any CPU.Build.0 = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|.NET.Build.0 = Debug|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|.NET.ActiveCfg = Release|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|.NET.Build.0 = Release|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|Any CPU.Build.0 = Release|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{91766D21-C568-459F-9BEA-759B011F23CF}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{91766D21-C568-459F-9BEA-759B011F23CF}.Debug|.NET.Build.0 = Debug|Any CPU
-		{91766D21-C568-459F-9BEA-759B011F23CF}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{91766D21-C568-459F-9BEA-759B011F23CF}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{91766D21-C568-459F-9BEA-759B011F23CF}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{91766D21-C568-459F-9BEA-759B011F23CF}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{91766D21-C568-459F-9BEA-759B011F23CF}.Release|.NET.ActiveCfg = Release|Any CPU
-		{91766D21-C568-459F-9BEA-759B011F23CF}.Release|.NET.Build.0 = Release|Any CPU
-		{91766D21-C568-459F-9BEA-759B011F23CF}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{91766D21-C568-459F-9BEA-759B011F23CF}.Release|Any CPU.Build.0 = Release|Any CPU
-		{91766D21-C568-459F-9BEA-759B011F23CF}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{91766D21-C568-459F-9BEA-759B011F23CF}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Debug|.NET.Build.0 = Debug|Any CPU
-		{E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Release|.NET.ActiveCfg = Release|Any CPU
-		{E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Release|.NET.Build.0 = Release|Any CPU
-		{E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Release|Any CPU.Build.0 = Release|Any CPU
-		{E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Debug|.NET.Build.0 = Debug|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Release|.NET.ActiveCfg = Release|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Release|.NET.Build.0 = Release|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Release|Any CPU.Build.0 = Release|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{90F2D070-6F98-4926-A626-BD7A6071D6D9}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{90F2D070-6F98-4926-A626-BD7A6071D6D9}.Debug|.NET.Build.0 = Debug|Any CPU
-		{90F2D070-6F98-4926-A626-BD7A6071D6D9}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{90F2D070-6F98-4926-A626-BD7A6071D6D9}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{90F2D070-6F98-4926-A626-BD7A6071D6D9}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{90F2D070-6F98-4926-A626-BD7A6071D6D9}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{90F2D070-6F98-4926-A626-BD7A6071D6D9}.Release|.NET.ActiveCfg = Release|Any CPU
-		{90F2D070-6F98-4926-A626-BD7A6071D6D9}.Release|.NET.Build.0 = Release|Any CPU
-		{90F2D070-6F98-4926-A626-BD7A6071D6D9}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{90F2D070-6F98-4926-A626-BD7A6071D6D9}.Release|Any CPU.Build.0 = Release|Any CPU
-		{90F2D070-6F98-4926-A626-BD7A6071D6D9}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{90F2D070-6F98-4926-A626-BD7A6071D6D9}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Debug|.NET.Build.0 = Debug|Any CPU
-		{4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Release|.NET.ActiveCfg = Release|Any CPU
-		{4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Release|.NET.Build.0 = Release|Any CPU
-		{4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Release|Any CPU.Build.0 = Release|Any CPU
-		{4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{E823D54C-CE82-4868-929F-5F95A999F61E}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{E823D54C-CE82-4868-929F-5F95A999F61E}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{E823D54C-CE82-4868-929F-5F95A999F61E}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{E823D54C-CE82-4868-929F-5F95A999F61E}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{E823D54C-CE82-4868-929F-5F95A999F61E}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{E823D54C-CE82-4868-929F-5F95A999F61E}.Release|.NET.ActiveCfg = Release|Any CPU
-		{E823D54C-CE82-4868-929F-5F95A999F61E}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{E823D54C-CE82-4868-929F-5F95A999F61E}.Release|Any CPU.Build.0 = Release|Any CPU
-		{E823D54C-CE82-4868-929F-5F95A999F61E}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{E823D54C-CE82-4868-929F-5F95A999F61E}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}.Release|.NET.ActiveCfg = Release|Any CPU
-		{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}.Release|Any CPU.Build.0 = Release|Any CPU
-		{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{AEB1578C-9018-4D49-B440-789F38DD2F29}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{AEB1578C-9018-4D49-B440-789F38DD2F29}.Debug|.NET.Build.0 = Debug|Any CPU
-		{AEB1578C-9018-4D49-B440-789F38DD2F29}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{AEB1578C-9018-4D49-B440-789F38DD2F29}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{AEB1578C-9018-4D49-B440-789F38DD2F29}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{AEB1578C-9018-4D49-B440-789F38DD2F29}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{AEB1578C-9018-4D49-B440-789F38DD2F29}.Release|.NET.ActiveCfg = Release|Any CPU
-		{AEB1578C-9018-4D49-B440-789F38DD2F29}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{AEB1578C-9018-4D49-B440-789F38DD2F29}.Release|Any CPU.Build.0 = Release|Any CPU
-		{AEB1578C-9018-4D49-B440-789F38DD2F29}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{AEB1578C-9018-4D49-B440-789F38DD2F29}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{FA7A6931-7DBE-4A32-A312-51FAD2E80332}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{FA7A6931-7DBE-4A32-A312-51FAD2E80332}.Debug|.NET.Build.0 = Debug|Any CPU
-		{FA7A6931-7DBE-4A32-A312-51FAD2E80332}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{FA7A6931-7DBE-4A32-A312-51FAD2E80332}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{FA7A6931-7DBE-4A32-A312-51FAD2E80332}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{FA7A6931-7DBE-4A32-A312-51FAD2E80332}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{FA7A6931-7DBE-4A32-A312-51FAD2E80332}.Release|.NET.ActiveCfg = Release|Any CPU
-		{FA7A6931-7DBE-4A32-A312-51FAD2E80332}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{FA7A6931-7DBE-4A32-A312-51FAD2E80332}.Release|Any CPU.Build.0 = Release|Any CPU
-		{FA7A6931-7DBE-4A32-A312-51FAD2E80332}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{FA7A6931-7DBE-4A32-A312-51FAD2E80332}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{71368632-B8B7-4A6A-8C65-8DA848120C82}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{71368632-B8B7-4A6A-8C65-8DA848120C82}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{71368632-B8B7-4A6A-8C65-8DA848120C82}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{71368632-B8B7-4A6A-8C65-8DA848120C82}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{71368632-B8B7-4A6A-8C65-8DA848120C82}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{71368632-B8B7-4A6A-8C65-8DA848120C82}.Release|.NET.ActiveCfg = Release|Any CPU
-		{71368632-B8B7-4A6A-8C65-8DA848120C82}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{71368632-B8B7-4A6A-8C65-8DA848120C82}.Release|Any CPU.Build.0 = Release|Any CPU
-		{71368632-B8B7-4A6A-8C65-8DA848120C82}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{71368632-B8B7-4A6A-8C65-8DA848120C82}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Release|.NET.ActiveCfg = Release|Any CPU
-		{0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Release|Any CPU.Build.0 = Release|Any CPU
-		{0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{41BC3AEA-7EB3-48BF-B1EC-84119376AC98}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{41BC3AEA-7EB3-48BF-B1EC-84119376AC98}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{41BC3AEA-7EB3-48BF-B1EC-84119376AC98}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{41BC3AEA-7EB3-48BF-B1EC-84119376AC98}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{41BC3AEA-7EB3-48BF-B1EC-84119376AC98}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{41BC3AEA-7EB3-48BF-B1EC-84119376AC98}.Release|.NET.ActiveCfg = Release|Any CPU
-		{41BC3AEA-7EB3-48BF-B1EC-84119376AC98}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{41BC3AEA-7EB3-48BF-B1EC-84119376AC98}.Release|Any CPU.Build.0 = Release|Any CPU
-		{41BC3AEA-7EB3-48BF-B1EC-84119376AC98}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{41BC3AEA-7EB3-48BF-B1EC-84119376AC98}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|.NET.ActiveCfg = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Any CPU.Build.0 = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(SolutionProperties) = preSolution
-		HideSolutionNode = FALSE
-	EndGlobalSection
-	GlobalSection(ExtensibilityGlobals) = postSolution
-		NAntAddinLastFileName = Spring.build
-	EndGlobalSection
-EndGlobal
diff --git a/build-support/solutions/Spring.Net.Messaging.Ems.2005.sln b/build-support/solutions/Spring.Net.Messaging.Ems.2005.sln
deleted file mode 100644
index 29f5b947..00000000
--- a/build-support/solutions/Spring.Net.Messaging.Ems.2005.sln
+++ /dev/null
@@ -1,163 +0,0 @@
-Microsoft Visual Studio Solution File, Format Version 9.00
-# Visual Studio 2005
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Core.2005", "..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj", "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Aop.2005", "..\..\src\Spring\Spring.Aop\Spring.Aop.2005.csproj", "{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{2150E333-8FDC-42A3-9474-1A3956D46DE8}") = "Solution Items", "Solution Items", "{F04753EF-7A1B-4837-AB63-8C0821E8155D}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-	ProjectSection(SolutionItems) = preProject
-		Spring.build = Spring.build
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.2005", "..\..\src\Spring\Spring.Data\Spring.Data.2005.csproj", "{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.Tests.2005", "..\..\test\Spring\Spring.Data.Tests\Spring.Data.Tests.2005.csproj", "{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Core.Tests.2005", "..\..\test\Spring\Spring.Core.Tests\Spring.Core.Tests.2005.csproj", "{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Messaging.Ems.2005", "..\..\src\Spring\Spring.Messaging.Ems\Spring.Messaging.Ems.2005.csproj", "{900E3839-301E-48B1-BAEB-B6645620ACFF}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Messaging.Ems.Tests.2005", "..\..\test\Spring\Spring.Messaging.Ems.Tests\Spring.Messaging.Ems.Tests.2005.csproj", "{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Testing.NUnit.2005", "..\..\src\Spring\Spring.Testing.NUnit\Spring.Testing.NUnit.2005.csproj", "{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfigurationPlatforms) = preSolution
-		Debug|.NET = Debug|.NET
-		Debug|Any CPU = Debug|Any CPU
-		Debug|Mixed Platforms = Debug|Mixed Platforms
-		Release|.NET = Release|.NET
-		Release|Any CPU = Release|Any CPU
-		Release|Mixed Platforms = Release|Mixed Platforms
-	EndGlobalSection
-	GlobalSection(ProjectConfigurationPlatforms) = postSolution
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|.NET.Build.0 = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|.NET.ActiveCfg = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|.NET.Build.0 = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Any CPU.Build.0 = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|.NET.Build.0 = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|.NET.ActiveCfg = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|.NET.Build.0 = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Any CPU.Build.0 = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|.NET.Build.0 = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|.NET.ActiveCfg = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|.NET.Build.0 = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Any CPU.Build.0 = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|.NET.ActiveCfg = Release|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|Any CPU.Build.0 = Release|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|.NET.ActiveCfg = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Any CPU.Build.0 = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{900E3839-301E-48B1-BAEB-B6645620ACFF}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{900E3839-301E-48B1-BAEB-B6645620ACFF}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{900E3839-301E-48B1-BAEB-B6645620ACFF}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{900E3839-301E-48B1-BAEB-B6645620ACFF}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{900E3839-301E-48B1-BAEB-B6645620ACFF}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{900E3839-301E-48B1-BAEB-B6645620ACFF}.Release|.NET.ActiveCfg = Release|Any CPU
-		{900E3839-301E-48B1-BAEB-B6645620ACFF}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{900E3839-301E-48B1-BAEB-B6645620ACFF}.Release|Any CPU.Build.0 = Release|Any CPU
-		{900E3839-301E-48B1-BAEB-B6645620ACFF}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{900E3839-301E-48B1-BAEB-B6645620ACFF}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|.NET.ActiveCfg = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Any CPU.Build.0 = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Release|.NET.ActiveCfg = Release|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Release|Any CPU.Build.0 = Release|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(SolutionProperties) = preSolution
-		HideSolutionNode = FALSE
-	EndGlobalSection
-	GlobalSection(ExtensibilityGlobals) = postSolution
-		NAntAddinLastFileName = Spring.build
-	EndGlobalSection
-EndGlobal
diff --git a/build-support/solutions/Spring.Net.NHibernate20.2005.sln b/build-support/solutions/Spring.Net.NHibernate20.2005.sln
deleted file mode 100644
index e667cae7..00000000
--- a/build-support/solutions/Spring.Net.NHibernate20.2005.sln
+++ /dev/null
@@ -1,167 +0,0 @@
-Microsoft Visual Studio Solution File, Format Version 9.00
-# Visual Studio 2005
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Core.2005", "..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj", "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Aop.2005", "..\..\src\Spring\Spring.Aop\Spring.Aop.2005.csproj", "{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{2150E333-8FDC-42A3-9474-1A3956D46DE8}") = "Solution Items", "Solution Items", "{F04753EF-7A1B-4837-AB63-8C0821E8155D}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-	ProjectSection(SolutionItems) = preProject
-		Spring.build = Spring.build
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.2005", "..\..\src\Spring\Spring.Data\Spring.Data.2005.csproj", "{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.NHibernate20.Integration.Tests.2005", "..\..\test\Spring\Spring.Data.NHibernate20.Integration.Tests\Spring.Data.NHibernate20.Integration.Tests.2005.csproj", "{4A07E150-ED90-407C-8CAD-4760444DDFD9}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.NHibernate20.Tests.2005", "..\..\test\Spring\Spring.Data.NHibernate20.Tests\Spring.Data.NHibernate20.Tests.2005.csproj", "{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.NHibernate20.2005", "..\..\src\Spring\Spring.Data.NHibernate20\Spring.Data.NHibernate20.2005.csproj", "{71368632-B8B7-4A6A-8C65-8DA848120C82}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.Tests.2005", "..\..\test\Spring\Spring.Data.Tests\Spring.Data.Tests.2005.csproj", "{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Core.Tests.2005", "..\..\test\Spring\Spring.Core.Tests\Spring.Core.Tests.2005.csproj", "{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfigurationPlatforms) = preSolution
-		Debug|.NET = Debug|.NET
-		Debug|Any CPU = Debug|Any CPU
-		Debug|Mixed Platforms = Debug|Mixed Platforms
-		Release|.NET = Release|.NET
-		Release|Any CPU = Release|Any CPU
-		Release|Mixed Platforms = Release|Mixed Platforms
-	EndGlobalSection
-	GlobalSection(ProjectConfigurationPlatforms) = postSolution
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|.NET.Build.0 = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|.NET.ActiveCfg = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|.NET.Build.0 = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Any CPU.Build.0 = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|.NET.Build.0 = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|.NET.ActiveCfg = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|.NET.Build.0 = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Any CPU.Build.0 = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|.NET.Build.0 = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|.NET.ActiveCfg = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|.NET.Build.0 = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Any CPU.Build.0 = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Debug|.NET.Build.0 = Debug|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Release|.NET.ActiveCfg = Release|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Release|.NET.Build.0 = Release|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Release|Any CPU.Build.0 = Release|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|.NET.Build.0 = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|.NET.ActiveCfg = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|.NET.Build.0 = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Any CPU.Build.0 = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{71368632-B8B7-4A6A-8C65-8DA848120C82}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{71368632-B8B7-4A6A-8C65-8DA848120C82}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{71368632-B8B7-4A6A-8C65-8DA848120C82}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{71368632-B8B7-4A6A-8C65-8DA848120C82}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{71368632-B8B7-4A6A-8C65-8DA848120C82}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{71368632-B8B7-4A6A-8C65-8DA848120C82}.Release|.NET.ActiveCfg = Release|Any CPU
-		{71368632-B8B7-4A6A-8C65-8DA848120C82}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{71368632-B8B7-4A6A-8C65-8DA848120C82}.Release|Any CPU.Build.0 = Release|Any CPU
-		{71368632-B8B7-4A6A-8C65-8DA848120C82}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{71368632-B8B7-4A6A-8C65-8DA848120C82}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|.NET.ActiveCfg = Release|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|Any CPU.Build.0 = Release|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|.NET.ActiveCfg = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Any CPU.Build.0 = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(SolutionProperties) = preSolution
-		HideSolutionNode = FALSE
-	EndGlobalSection
-	GlobalSection(ExtensibilityGlobals) = postSolution
-		NAntAddinLastFileName = Spring.build
-	EndGlobalSection
-EndGlobal
diff --git a/build-support/solutions/Spring.Net.NHibernate21.2005.sln b/build-support/solutions/Spring.Net.NHibernate21.2005.sln
deleted file mode 100644
index 67d2615b..00000000
--- a/build-support/solutions/Spring.Net.NHibernate21.2005.sln
+++ /dev/null
@@ -1,168 +0,0 @@
-Microsoft Visual Studio Solution File, Format Version 9.00
-# Visual Studio 2005
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Core.2005", "..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj", "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Aop.2005", "..\..\src\Spring\Spring.Aop\Spring.Aop.2005.csproj", "{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{2150E333-8FDC-42A3-9474-1A3956D46DE8}") = "Solution Items", "Solution Items", "{F04753EF-7A1B-4837-AB63-8C0821E8155D}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-	ProjectSection(SolutionItems) = preProject
-		..\..\Spring.build = ..\..\Spring.build
-		..\..\src\Spring\Spring.Data.NHibernate21\Spring.Data.NHibernate21.build = ..\..\src\Spring\Spring.Data.NHibernate21\Spring.Data.NHibernate21.build
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.2005", "..\..\src\Spring\Spring.Data\Spring.Data.2005.csproj", "{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.NHibernate21.Integration.Tests.2005", "..\..\test\Spring\Spring.Data.NHibernate21.Integration.Tests\Spring.Data.NHibernate21.Integration.Tests.2005.csproj", "{4A07E150-ED90-407C-8CAD-4760444DDFD9}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.NHibernate21.Tests.2005", "..\..\test\Spring\Spring.Data.NHibernate21.Tests\Spring.Data.NHibernate21.Tests.2005.csproj", "{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.NHibernate21.2005", "..\..\src\Spring\Spring.Data.NHibernate21\Spring.Data.NHibernate21.2005.csproj", "{E57B4652-0231-49CB-B058-87E10EFE540D}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.Tests.2005", "..\..\test\Spring\Spring.Data.Tests\Spring.Data.Tests.2005.csproj", "{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Core.Tests.2005", "..\..\test\Spring\Spring.Core.Tests\Spring.Core.Tests.2005.csproj", "{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfigurationPlatforms) = preSolution
-		Debug|.NET = Debug|.NET
-		Debug|Any CPU = Debug|Any CPU
-		Debug|Mixed Platforms = Debug|Mixed Platforms
-		Release|.NET = Release|.NET
-		Release|Any CPU = Release|Any CPU
-		Release|Mixed Platforms = Release|Mixed Platforms
-	EndGlobalSection
-	GlobalSection(ProjectConfigurationPlatforms) = postSolution
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|.NET.Build.0 = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|.NET.ActiveCfg = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|.NET.Build.0 = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Any CPU.Build.0 = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|.NET.Build.0 = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|.NET.ActiveCfg = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|.NET.Build.0 = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Any CPU.Build.0 = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|.NET.Build.0 = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|.NET.ActiveCfg = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|.NET.Build.0 = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Any CPU.Build.0 = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Debug|.NET.Build.0 = Debug|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Release|.NET.ActiveCfg = Release|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Release|.NET.Build.0 = Release|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Release|Any CPU.Build.0 = Release|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{4A07E150-ED90-407C-8CAD-4760444DDFD9}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|.NET.Build.0 = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|.NET.ActiveCfg = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|.NET.Build.0 = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Any CPU.Build.0 = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{E57B4652-0231-49CB-B058-87E10EFE540D}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{E57B4652-0231-49CB-B058-87E10EFE540D}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{E57B4652-0231-49CB-B058-87E10EFE540D}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{E57B4652-0231-49CB-B058-87E10EFE540D}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{E57B4652-0231-49CB-B058-87E10EFE540D}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{E57B4652-0231-49CB-B058-87E10EFE540D}.Release|.NET.ActiveCfg = Release|Any CPU
-		{E57B4652-0231-49CB-B058-87E10EFE540D}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{E57B4652-0231-49CB-B058-87E10EFE540D}.Release|Any CPU.Build.0 = Release|Any CPU
-		{E57B4652-0231-49CB-B058-87E10EFE540D}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{E57B4652-0231-49CB-B058-87E10EFE540D}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|.NET.ActiveCfg = Release|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|Any CPU.Build.0 = Release|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|.NET.ActiveCfg = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Any CPU.Build.0 = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(SolutionProperties) = preSolution
-		HideSolutionNode = FALSE
-	EndGlobalSection
-	GlobalSection(ExtensibilityGlobals) = postSolution
-		NAntAddinLastFileName = Spring.build
-	EndGlobalSection
-EndGlobal
diff --git a/build-support/solutions/Spring.Net.Quartz.2005.sln b/build-support/solutions/Spring.Net.Quartz.2005.sln
deleted file mode 100644
index 2c00764c..00000000
--- a/build-support/solutions/Spring.Net.Quartz.2005.sln
+++ /dev/null
@@ -1,168 +0,0 @@
-Microsoft Visual Studio Solution File, Format Version 9.00
-# Visual Studio 2005
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Core.2005", "..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj", "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Aop.2005", "..\..\src\Spring\Spring.Aop\Spring.Aop.2005.csproj", "{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{2150E333-8FDC-42A3-9474-1A3956D46DE8}") = "Solution Items", "Solution Items", "{F04753EF-7A1B-4837-AB63-8C0821E8155D}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-	ProjectSection(SolutionItems) = preProject
-		Spring.build = Spring.build
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.2005", "..\..\src\Spring\Spring.Data\Spring.Data.2005.csproj", "{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Scheduling.Quartz.2005", "..\..\src\Spring\Spring.Scheduling.Quartz\Spring.Scheduling.Quartz.2005.csproj", "{E823D54C-CE82-4868-929F-5F95A999F61E}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Scheduling.Quartz.Tests.2005", "..\..\test\Spring\Spring.Scheduling.Quartz.Tests\Spring.Scheduling.Quartz.Tests.2005.csproj", "{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Scheduling.Quartz.Integration.Tests.2005", "..\..\test\Spring\Spring.Scheduling.Quartz.Integration.Tests\Spring.Scheduling.Quartz.Integration.Tests.2005.csproj", "{E4328F68-C3FC-43E2-9D63-30CEC55215B0}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{2150E333-8FDC-42A3-9474-1A3956D46DE8}") = "Core", "Core", "{438FE108-6F55-4C8A-8BF4-C85D0906D134}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{2150E333-8FDC-42A3-9474-1A3956D46DE8}") = "Tests", "Tests", "{5ECE7B2B-6975-4800-982E-618794909499}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Core.Tests.2005", "..\..\test\Spring\Spring.Core.Tests\Spring.Core.Tests.2005.csproj", "{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfigurationPlatforms) = preSolution
-		Debug|.NET = Debug|.NET
-		Debug|Any CPU = Debug|Any CPU
-		Debug|Mixed Platforms = Debug|Mixed Platforms
-		Release|.NET = Release|.NET
-		Release|Any CPU = Release|Any CPU
-		Release|Mixed Platforms = Release|Mixed Platforms
-	EndGlobalSection
-	GlobalSection(ProjectConfigurationPlatforms) = postSolution
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|.NET.Build.0 = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|.NET.ActiveCfg = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|.NET.Build.0 = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Any CPU.Build.0 = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|.NET.Build.0 = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|.NET.ActiveCfg = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|.NET.Build.0 = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Any CPU.Build.0 = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|.NET.Build.0 = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|.NET.ActiveCfg = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|.NET.Build.0 = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Any CPU.Build.0 = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{E823D54C-CE82-4868-929F-5F95A999F61E}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{E823D54C-CE82-4868-929F-5F95A999F61E}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{E823D54C-CE82-4868-929F-5F95A999F61E}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{E823D54C-CE82-4868-929F-5F95A999F61E}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{E823D54C-CE82-4868-929F-5F95A999F61E}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{E823D54C-CE82-4868-929F-5F95A999F61E}.Release|.NET.ActiveCfg = Release|Any CPU
-		{E823D54C-CE82-4868-929F-5F95A999F61E}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{E823D54C-CE82-4868-929F-5F95A999F61E}.Release|Any CPU.Build.0 = Release|Any CPU
-		{E823D54C-CE82-4868-929F-5F95A999F61E}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{E823D54C-CE82-4868-929F-5F95A999F61E}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}.Release|.NET.ActiveCfg = Release|Any CPU
-		{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}.Release|Any CPU.Build.0 = Release|Any CPU
-		{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{E4328F68-C3FC-43E2-9D63-30CEC55215B0}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{E4328F68-C3FC-43E2-9D63-30CEC55215B0}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{E4328F68-C3FC-43E2-9D63-30CEC55215B0}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{E4328F68-C3FC-43E2-9D63-30CEC55215B0}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{E4328F68-C3FC-43E2-9D63-30CEC55215B0}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{E4328F68-C3FC-43E2-9D63-30CEC55215B0}.Release|.NET.ActiveCfg = Release|Any CPU
-		{E4328F68-C3FC-43E2-9D63-30CEC55215B0}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{E4328F68-C3FC-43E2-9D63-30CEC55215B0}.Release|Any CPU.Build.0 = Release|Any CPU
-		{E4328F68-C3FC-43E2-9D63-30CEC55215B0}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{E4328F68-C3FC-43E2-9D63-30CEC55215B0}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|.NET.ActiveCfg = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Any CPU.Build.0 = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(SolutionProperties) = preSolution
-		HideSolutionNode = FALSE
-	EndGlobalSection
-	GlobalSection(NestedProjects) = preSolution
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C} = {438FE108-6F55-4C8A-8BF4-C85D0906D134}
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40} = {438FE108-6F55-4C8A-8BF4-C85D0906D134}
-		{E823D54C-CE82-4868-929F-5F95A999F61E} = {438FE108-6F55-4C8A-8BF4-C85D0906D134}
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84} = {438FE108-6F55-4C8A-8BF4-C85D0906D134}
-		{E4328F68-C3FC-43E2-9D63-30CEC55215B0} = {5ECE7B2B-6975-4800-982E-618794909499}
-		{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5} = {5ECE7B2B-6975-4800-982E-618794909499}
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904} = {5ECE7B2B-6975-4800-982E-618794909499}
-	EndGlobalSection
-	GlobalSection(ExtensibilityGlobals) = postSolution
-		NAntAddinLastFileName = Spring.build
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/Spring.AopQuickStart/Spring.AopQuickStart.2003.sln b/examples/Spring/Spring.AopQuickStart/Spring.AopQuickStart.2003.sln
deleted file mode 100644
index 8528e9fd..00000000
--- a/examples/Spring/Spring.AopQuickStart/Spring.AopQuickStart.2003.sln
+++ /dev/null
@@ -1,80 +0,0 @@
-Microsoft Visual Studio Solution File, Format Version 8.00
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.AopQuickStart.Common.2003", "src\Spring.AopQuickStart.Common\Spring.AopQuickStart.Common.2003.csproj", "{C707543A-8F0E-4483-AECC-BC6EE14C3A29}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.AopQuickStart.Step1.2003", "src\Spring.AopQuickStart.Step1\Spring.AopQuickStart.Step1.2003.csproj", "{72D32026-23F5-4C62-8E6C-BFB30210BFD3}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.AopQuickStart.Step2.2003", "src\Spring.AopQuickStart.Step2\Spring.AopQuickStart.Step2.2003.csproj", "{202672D3-F523-4C62-8E6C-BFB30210BFD3}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.AopQuickStart.Step3.2003", "src\Spring.AopQuickStart.Step3\Spring.AopQuickStart.Step3.2003.csproj", "{BFB30210-4C62-F523-8E6C-202672D3BFD3}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.AopQuickStart.Step4.2003", "src\Spring.AopQuickStart.Step4\Spring.AopQuickStart.Step4.2003.csproj", "{672D3BFD-4C62-F523-8E6C-20BFB3021023}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.AopQuickStart.Step5.2003", "src\Spring.AopQuickStart.Step5\Spring.AopQuickStart.Step5.2003.csproj", "{F5233BFD-8E6C-FB30-4C62-20BFB3021023}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.AopQuickStart.Step6.2003", "src\Spring.AopQuickStart.Step6\Spring.AopQuickStart.Step6.2003.csproj", "{8E620210-4D33-F523-BF6C-202672CBBFD3}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.AopQuickStart.Step7.2003", "src\Spring.AopQuickStart.Step7\Spring.AopQuickStart.Step7.2003.csproj", "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfiguration) = preSolution
-		Debug = Debug
-		Release = Release
-	EndGlobalSection
-	GlobalSection(ProjectConfiguration) = postSolution
-		{C707543A-8F0E-4483-AECC-BC6EE14C3A29}.Debug.ActiveCfg = Debug|.NET
-		{C707543A-8F0E-4483-AECC-BC6EE14C3A29}.Debug.Build.0 = Debug|.NET
-		{C707543A-8F0E-4483-AECC-BC6EE14C3A29}.Release.ActiveCfg = Release|.NET
-		{C707543A-8F0E-4483-AECC-BC6EE14C3A29}.Release.Build.0 = Release|.NET
-		{72D32026-23F5-4C62-8E6C-BFB30210BFD3}.Debug.ActiveCfg = Debug|.NET
-		{72D32026-23F5-4C62-8E6C-BFB30210BFD3}.Debug.Build.0 = Debug|.NET
-		{72D32026-23F5-4C62-8E6C-BFB30210BFD3}.Release.ActiveCfg = Release|.NET
-		{72D32026-23F5-4C62-8E6C-BFB30210BFD3}.Release.Build.0 = Release|.NET
-		{202672D3-F523-4C62-8E6C-BFB30210BFD3}.Debug.ActiveCfg = Debug|.NET
-		{202672D3-F523-4C62-8E6C-BFB30210BFD3}.Debug.Build.0 = Debug|.NET
-		{202672D3-F523-4C62-8E6C-BFB30210BFD3}.Release.ActiveCfg = Release|.NET
-		{202672D3-F523-4C62-8E6C-BFB30210BFD3}.Release.Build.0 = Release|.NET
-		{BFB30210-4C62-F523-8E6C-202672D3BFD3}.Debug.ActiveCfg = Debug|.NET
-		{BFB30210-4C62-F523-8E6C-202672D3BFD3}.Debug.Build.0 = Debug|.NET
-		{BFB30210-4C62-F523-8E6C-202672D3BFD3}.Release.ActiveCfg = Release|.NET
-		{BFB30210-4C62-F523-8E6C-202672D3BFD3}.Release.Build.0 = Release|.NET
-		{672D3BFD-4C62-F523-8E6C-20BFB3021023}.Debug.ActiveCfg = Debug|.NET
-		{672D3BFD-4C62-F523-8E6C-20BFB3021023}.Debug.Build.0 = Debug|.NET
-		{672D3BFD-4C62-F523-8E6C-20BFB3021023}.Release.ActiveCfg = Release|.NET
-		{672D3BFD-4C62-F523-8E6C-20BFB3021023}.Release.Build.0 = Release|.NET
-		{F5233BFD-8E6C-FB30-4C62-20BFB3021023}.Debug.ActiveCfg = Debug|.NET
-		{F5233BFD-8E6C-FB30-4C62-20BFB3021023}.Debug.Build.0 = Debug|.NET
-		{F5233BFD-8E6C-FB30-4C62-20BFB3021023}.Release.ActiveCfg = Release|.NET
-		{F5233BFD-8E6C-FB30-4C62-20BFB3021023}.Release.Build.0 = Release|.NET
-		{8E620210-4D33-F523-BF6C-202672CBBFD3}.Debug.ActiveCfg = Debug|.NET
-		{8E620210-4D33-F523-BF6C-202672CBBFD3}.Debug.Build.0 = Debug|.NET
-		{8E620210-4D33-F523-BF6C-202672CBBFD3}.Release.ActiveCfg = Release|.NET
-		{8E620210-4D33-F523-BF6C-202672CBBFD3}.Release.Build.0 = Release|.NET
-		{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}.Debug.ActiveCfg = Debug|.NET
-		{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}.Debug.Build.0 = Debug|.NET
-		{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}.Release.ActiveCfg = Release|.NET
-		{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}.Release.Build.0 = Release|.NET
-	EndGlobalSection
-	GlobalSection(SolutionItems) = postSolution
-		readme.txt = readme.txt
-	EndGlobalSection
-	GlobalSection(ExtensibilityGlobals) = postSolution
-	EndGlobalSection
-	GlobalSection(ExtensibilityAddIns) = postSolution
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/Spring.AopQuickStart/Spring.AopQuickStart.2005.sln b/examples/Spring/Spring.AopQuickStart/Spring.AopQuickStart.2005.sln
deleted file mode 100644
index 9e053726..00000000
--- a/examples/Spring/Spring.AopQuickStart/Spring.AopQuickStart.2005.sln
+++ /dev/null
@@ -1,66 +0,0 @@
-Microsoft Visual Studio Solution File, Format Version 9.00
-# Visual Studio 2005
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.AopQuickStart.Common.2005", "src\Spring.AopQuickStart.Common\Spring.AopQuickStart.Common.2005.csproj", "{C707543A-8F0E-4483-AECC-BC6EE14C3A29}"
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.AopQuickStart.Step1.2005", "src\Spring.AopQuickStart.Step1\Spring.AopQuickStart.Step1.2005.csproj", "{1B3559A0-5274-4968-A628-77F036984F02}"
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.AopQuickStart.Step2.2005", "src\Spring.AopQuickStart.Step2\Spring.AopQuickStart.Step2.2005.csproj", "{4ACE3EB7-B60A-4ACE-B4BB-2C33494D6108}"
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.AopQuickStart.Step3.2005", "src\Spring.AopQuickStart.Step3\Spring.AopQuickStart.Step3.2005.csproj", "{2C33494D-B4BB-4ACE-B60A-4ACE3EB76108}"
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.AopQuickStart.Step4.2005", "src\Spring.AopQuickStart.Step4\Spring.AopQuickStart.Step4.2005.csproj", "{3EB76108-4ACE-4ACE-B60A-B4BB3EB76108}"
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.AopQuickStart.Step5.2005", "src\Spring.AopQuickStart.Step5\Spring.AopQuickStart.Step5.2005.csproj", "{61086108-3EB7-4ACE-B4B6-B4B60AB76108}"
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.AopQuickStart.Step6.2005", "src\Spring.AopQuickStart.Step6\Spring.AopQuickStart.Step6.2005.csproj", "{AB33BB4D-B449-4AC1-760A-4ACE3EA56108}"
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.AopQuickStart.Step7.2005", "src\Spring.AopQuickStart.Step7\Spring.AopQuickStart.Step7.2005.csproj", "{0077A8CA-4C09-42B1-B227-91095CE4CCA2}"
-EndProject
-Project("{2150E333-8FDC-42A3-9474-1A3956D46DE8}") = "Solution Items", "Solution Items", "{919AF8FE-423F-4A8C-BDA4-CB8B39D64780}"
-	ProjectSection(SolutionItems) = preProject
-		readme.txt = readme.txt
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfigurationPlatforms) = preSolution
-		Debug|Any CPU = Debug|Any CPU
-		Release|Any CPU = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(ProjectConfigurationPlatforms) = postSolution
-		{C707543A-8F0E-4483-AECC-BC6EE14C3A29}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{C707543A-8F0E-4483-AECC-BC6EE14C3A29}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{C707543A-8F0E-4483-AECC-BC6EE14C3A29}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{C707543A-8F0E-4483-AECC-BC6EE14C3A29}.Release|Any CPU.Build.0 = Release|Any CPU
-		{1B3559A0-5274-4968-A628-77F036984F02}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{1B3559A0-5274-4968-A628-77F036984F02}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{1B3559A0-5274-4968-A628-77F036984F02}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{1B3559A0-5274-4968-A628-77F036984F02}.Release|Any CPU.Build.0 = Release|Any CPU
-		{4ACE3EB7-B60A-4ACE-B4BB-2C33494D6108}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{4ACE3EB7-B60A-4ACE-B4BB-2C33494D6108}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{4ACE3EB7-B60A-4ACE-B4BB-2C33494D6108}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{4ACE3EB7-B60A-4ACE-B4BB-2C33494D6108}.Release|Any CPU.Build.0 = Release|Any CPU
-		{2C33494D-B4BB-4ACE-B60A-4ACE3EB76108}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{2C33494D-B4BB-4ACE-B60A-4ACE3EB76108}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{2C33494D-B4BB-4ACE-B60A-4ACE3EB76108}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{2C33494D-B4BB-4ACE-B60A-4ACE3EB76108}.Release|Any CPU.Build.0 = Release|Any CPU
-		{3EB76108-4ACE-4ACE-B60A-B4BB3EB76108}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{3EB76108-4ACE-4ACE-B60A-B4BB3EB76108}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{3EB76108-4ACE-4ACE-B60A-B4BB3EB76108}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{3EB76108-4ACE-4ACE-B60A-B4BB3EB76108}.Release|Any CPU.Build.0 = Release|Any CPU
-		{61086108-3EB7-4ACE-B4B6-B4B60AB76108}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{61086108-3EB7-4ACE-B4B6-B4B60AB76108}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{61086108-3EB7-4ACE-B4B6-B4B60AB76108}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{61086108-3EB7-4ACE-B4B6-B4B60AB76108}.Release|Any CPU.Build.0 = Release|Any CPU
-		{AB33BB4D-B449-4AC1-760A-4ACE3EA56108}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{AB33BB4D-B449-4AC1-760A-4ACE3EA56108}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{AB33BB4D-B449-4AC1-760A-4ACE3EA56108}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{AB33BB4D-B449-4AC1-760A-4ACE3EA56108}.Release|Any CPU.Build.0 = Release|Any CPU
-		{0077A8CA-4C09-42B1-B227-91095CE4CCA2}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{0077A8CA-4C09-42B1-B227-91095CE4CCA2}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{0077A8CA-4C09-42B1-B227-91095CE4CCA2}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{0077A8CA-4C09-42B1-B227-91095CE4CCA2}.Release|Any CPU.Build.0 = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(SolutionProperties) = preSolution
-		HideSolutionNode = FALSE
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Common/Spring.AopQuickStart.Common.2003.csproj b/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Common/Spring.AopQuickStart.Common.2003.csproj
deleted file mode 100644
index 8829a55e..00000000
--- a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Common/Spring.AopQuickStart.Common.2003.csproj
+++ /dev/null
@@ -1,120 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.3077"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{C707543A-8F0E-4483-AECC-BC6EE14C3A29}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.AopQuickStart.Common"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring.AopQuickStart"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = "Spring.Examples.AopQuickStart.Application"
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "Spring.Aop"
-                    AssemblyName = "Spring.Aop"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Aop.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "Aspects\ConsoleLoggingAfterAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\ConsoleLoggingAroundAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\ConsoleLoggingBeforeAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\ConsoleLoggingThrowsAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Commands\ICommand.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Commands\ServiceCommand.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Common/Spring.AopQuickStart.Common.2005.csproj b/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Common/Spring.AopQuickStart.Common.2005.csproj
deleted file mode 100644
index fb49b0ee..00000000
--- a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Common/Spring.AopQuickStart.Common.2005.csproj
+++ /dev/null
@@ -1,104 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{C707543A-8F0E-4483-AECC-BC6EE14C3A29}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.AopQuickStart.Common</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Library</OutputType>
-    <RootNamespace>Spring.AopQuickStart</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>bin\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>bin\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Spring.Aop, Version=2.0.0.0, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Aop.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Core, Version=2.0.0.0, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="System">
-      <Name>System</Name>
-    </Reference>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="Aspects\ConsoleLoggingAroundAdvice.cs" />
-    <Compile Include="Aspects\ConsoleLoggingBeforeAdvice.cs" />
-    <Compile Include="Aspects\ConsoleLoggingAfterAdvice.cs" />
-    <Compile Include="Aspects\ConsoleLoggingThrowsAdvice.cs" />
-    <Compile Include="Commands\ICommand.cs" />
-    <Compile Include="Commands\ServiceCommand.cs" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>
-    </PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step1/Spring.AopQuickStart.Step1.2003.csproj b/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step1/Spring.AopQuickStart.Step1.2003.csproj
deleted file mode 100644
index d3dd6b46..00000000
--- a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step1/Spring.AopQuickStart.Step1.2003.csproj
+++ /dev/null
@@ -1,100 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.3077"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{72D32026-23F5-4C62-8E6C-BFB30210BFD3}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.AopQuickStart.Step1"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Exe"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring.AopQuickStart"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = "Spring.AopQuickStart.Program"
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "Spring.AopQuickStart.Common.2003"
-                    Project = "{C707543A-8F0E-4483-AECC-BC6EE14C3A29}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-                <Reference
-                    Name = "Spring.Aop"
-                    AssemblyName = "Spring.Aop"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Aop.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "Program.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step1/Spring.AopQuickStart.Step1.2005.csproj b/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step1/Spring.AopQuickStart.Step1.2005.csproj
deleted file mode 100644
index 6b496048..00000000
--- a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step1/Spring.AopQuickStart.Step1.2005.csproj
+++ /dev/null
@@ -1,59 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{1B3559A0-5274-4968-A628-77F036984F02}</ProjectGuid>
-    <OutputType>Exe</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring.AopQuickStart</RootNamespace>
-    <AssemblyName>Spring.AopQuickStart.Step1</AssemblyName>
-    <StartupObject>Spring.AopQuickStart.Program</StartupObject>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>bin\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>bin\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Spring.Aop, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Aop.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Core, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="Program.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.AopQuickStart.Common\Spring.AopQuickStart.Common.2005.csproj">
-      <Project>{C707543A-8F0E-4483-AECC-BC6EE14C3A29}</Project>
-      <Name>Spring.AopQuickStart.Common.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step2/Spring.AopQuickStart.Step2.2003.csproj b/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step2/Spring.AopQuickStart.Step2.2003.csproj
deleted file mode 100644
index 03438e1d..00000000
--- a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step2/Spring.AopQuickStart.Step2.2003.csproj
+++ /dev/null
@@ -1,104 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.3077"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{202672D3-F523-4C62-8E6C-BFB30210BFD3}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.AopQuickStart.Step2"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Exe"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring.AopQuickStart"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = "Spring.AopQuickStart.Program"
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "Spring.AopQuickStart.Common.2003"
-                    Project = "{C707543A-8F0E-4483-AECC-BC6EE14C3A29}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Aop"
-                    AssemblyName = "Spring.Aop"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Aop.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "App.config"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Program.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step2/Spring.AopQuickStart.Step2.2005.csproj b/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step2/Spring.AopQuickStart.Step2.2005.csproj
deleted file mode 100644
index 0f7903fc..00000000
--- a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step2/Spring.AopQuickStart.Step2.2005.csproj
+++ /dev/null
@@ -1,62 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{4ACE3EB7-B60A-4ACE-B4BB-2C33494D6108}</ProjectGuid>
-    <OutputType>Exe</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring.AopQuickStart</RootNamespace>
-    <AssemblyName>Spring.AopQuickStart.Step2</AssemblyName>
-    <StartupObject>Spring.AopQuickStart.Program</StartupObject>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>bin\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>bin\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Spring.Aop, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Aop.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Core, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="Program.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="App.config" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.AopQuickStart.Common\Spring.AopQuickStart.Common.2005.csproj">
-      <Project>{C707543A-8F0E-4483-AECC-BC6EE14C3A29}</Project>
-      <Name>Spring.AopQuickStart.Common.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step3/Spring.AopQuickStart.Step3.2003.csproj b/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step3/Spring.AopQuickStart.Step3.2003.csproj
deleted file mode 100644
index 10ca9e74..00000000
--- a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step3/Spring.AopQuickStart.Step3.2003.csproj
+++ /dev/null
@@ -1,104 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.3077"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{BFB30210-4C62-F523-8E6C-202672D3BFD3}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.AopQuickStart.Step3"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Exe"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring.AopQuickStart"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "Spring.AopQuickStart.Common.2003"
-                    Project = "{C707543A-8F0E-4483-AECC-BC6EE14C3A29}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Aop"
-                    AssemblyName = "Spring.Aop"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Aop.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "App.config"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Program.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step3/Spring.AopQuickStart.Step3.2005.csproj b/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step3/Spring.AopQuickStart.Step3.2005.csproj
deleted file mode 100644
index 4d59121f..00000000
--- a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step3/Spring.AopQuickStart.Step3.2005.csproj
+++ /dev/null
@@ -1,62 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{2C33494D-B4BB-4ACE-B60A-4ACE3EB76108}</ProjectGuid>
-    <OutputType>Exe</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring.AopQuickStart</RootNamespace>
-    <AssemblyName>Spring.AopQuickStart.Step3</AssemblyName>
-    <StartupObject>Spring.AopQuickStart.Program</StartupObject>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>bin\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>bin\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Spring.Aop, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Aop.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Core, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="Program.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="App.config" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.AopQuickStart.Common\Spring.AopQuickStart.Common.2005.csproj">
-      <Project>{C707543A-8F0E-4483-AECC-BC6EE14C3A29}</Project>
-      <Name>Spring.AopQuickStart.Common.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step4/Spring.AopQuickStart.Step4.2003.csproj b/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step4/Spring.AopQuickStart.Step4.2003.csproj
deleted file mode 100644
index 2a50e3d7..00000000
--- a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step4/Spring.AopQuickStart.Step4.2003.csproj
+++ /dev/null
@@ -1,119 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.3077"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{672D3BFD-4C62-F523-8E6C-20BFB3021023}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.AopQuickStart.Step4"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Exe"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring.AopQuickStart"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "Spring.AopQuickStart.Common.2003"
-                    Project = "{C707543A-8F0E-4483-AECC-BC6EE14C3A29}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Aop"
-                    AssemblyName = "Spring.Aop"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Aop.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "App.config"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Program.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\ConsoleLoggingAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Attributes\ConsoleLoggingAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Commands\AnotherServiceCommand.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step4/Spring.AopQuickStart.Step4.2005.csproj b/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step4/Spring.AopQuickStart.Step4.2005.csproj
deleted file mode 100644
index ba66573f..00000000
--- a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step4/Spring.AopQuickStart.Step4.2005.csproj
+++ /dev/null
@@ -1,67 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{3EB76108-4ACE-4ACE-B60A-B4BB3EB76108}</ProjectGuid>
-    <OutputType>Exe</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring.AopQuickStart</RootNamespace>
-    <AssemblyName>Spring.AopQuickStart.Step4</AssemblyName>
-    <StartupObject>Spring.AopQuickStart.Program</StartupObject>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>bin\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>bin\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Spring.Aop, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Aop.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Core, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="Aspects\ConsoleLoggingAdvice.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Attributes\ConsoleLoggingAttribute.cs" />
-    <Compile Include="Commands\AnotherServiceCommand.cs" />
-    <Compile Include="Program.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="App.config" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.AopQuickStart.Common\Spring.AopQuickStart.Common.2005.csproj">
-      <Project>{C707543A-8F0E-4483-AECC-BC6EE14C3A29}</Project>
-      <Name>Spring.AopQuickStart.Common.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step5/Spring.AopQuickStart.Step5.2003.csproj b/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step5/Spring.AopQuickStart.Step5.2003.csproj
deleted file mode 100644
index a1229b78..00000000
--- a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step5/Spring.AopQuickStart.Step5.2003.csproj
+++ /dev/null
@@ -1,109 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.3077"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{F5233BFD-8E6C-FB30-4C62-20BFB3021023}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.AopQuickStart.Step5"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Exe"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring.AopQuickStart"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "Spring.AopQuickStart.Common.2003"
-                    Project = "{C707543A-8F0E-4483-AECC-BC6EE14C3A29}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Aop"
-                    AssemblyName = "Spring.Aop"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Aop.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "App.config"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Program.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\ExpressionDynamicPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step5/Spring.AopQuickStart.Step5.2005.csproj b/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step5/Spring.AopQuickStart.Step5.2005.csproj
deleted file mode 100644
index cf826f8b..00000000
--- a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step5/Spring.AopQuickStart.Step5.2005.csproj
+++ /dev/null
@@ -1,63 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{61086108-3EB7-4ACE-B4B6-B4B60AB76108}</ProjectGuid>
-    <OutputType>Exe</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring.AopQuickStart</RootNamespace>
-    <AssemblyName>Spring.AopQuickStart.Step5</AssemblyName>
-    <StartupObject>Spring.AopQuickStart.Program</StartupObject>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>bin\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>bin\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Spring.Aop, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Aop.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Core, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="Aspects\ExpressionDynamicPointcutAdvisor.cs" />
-    <Compile Include="Program.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="App.config" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.AopQuickStart.Common\Spring.AopQuickStart.Common.2005.csproj">
-      <Project>{C707543A-8F0E-4483-AECC-BC6EE14C3A29}</Project>
-      <Name>Spring.AopQuickStart.Common.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step6/Spring.AopQuickStart.Step6.2003.csproj b/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step6/Spring.AopQuickStart.Step6.2003.csproj
deleted file mode 100644
index bbf08146..00000000
--- a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step6/Spring.AopQuickStart.Step6.2003.csproj
+++ /dev/null
@@ -1,124 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.3077"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{8E620210-4D33-F523-BF6C-202672CBBFD3}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.AopQuickStart.Step6"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Exe"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring.AopQuickStart"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "Spring.Aop"
-                    AssemblyName = "Spring.Aop"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Aop.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "App.config"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Contact.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "IIsModified.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "IsModifiedMixin.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "ModificationAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "ModificationAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Program.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step6/Spring.AopQuickStart.Step6.2005.csproj b/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step6/Spring.AopQuickStart.Step6.2005.csproj
deleted file mode 100644
index 404df50f..00000000
--- a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step6/Spring.AopQuickStart.Step6.2005.csproj
+++ /dev/null
@@ -1,61 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{AB33BB4D-B449-4AC1-760A-4ACE3EA56108}</ProjectGuid>
-    <OutputType>Exe</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring.AopQuickStart</RootNamespace>
-    <AssemblyName>Spring.AopQuickStart.Step6</AssemblyName>
-    <StartupObject>Spring.AopQuickStart.Program</StartupObject>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>bin\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>bin\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Spring.Aop, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Aop.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Core, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="Contact.cs" />
-    <Compile Include="IIsModified.cs" />
-    <Compile Include="IsModifiedMixin.cs" />
-    <Compile Include="ModificationAdvice.cs" />
-    <Compile Include="ModificationAdvisor.cs" />
-    <Compile Include="Program.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="App.config" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step7/Spring.AopQuickStart.Step7.2003.csproj b/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step7/Spring.AopQuickStart.Step7.2003.csproj
deleted file mode 100644
index 7f1235e9..00000000
--- a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step7/Spring.AopQuickStart.Step7.2003.csproj
+++ /dev/null
@@ -1,109 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.3077"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.AopQuickStart.Step7"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Exe"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring.AopQuickStart"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "Spring.AopQuickStart.Common.2003"
-                    Project = "{C707543A-8F0E-4483-AECC-BC6EE14C3A29}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Aop"
-                    AssemblyName = "Spring.Aop"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Aop.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "App.config"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Program.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Commands\AnotherServiceCommand.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step7/Spring.AopQuickStart.Step7.2005.csproj b/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step7/Spring.AopQuickStart.Step7.2005.csproj
deleted file mode 100644
index 88361c2a..00000000
--- a/examples/Spring/Spring.AopQuickStart/src/Spring.AopQuickStart.Step7/Spring.AopQuickStart.Step7.2005.csproj
+++ /dev/null
@@ -1,63 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{0077A8CA-4C09-42B1-B227-91095CE4CCA2}</ProjectGuid>
-    <OutputType>Exe</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring.AopQuickStart</RootNamespace>
-    <AssemblyName>Spring.AopQuickStart.Step7</AssemblyName>
-    <StartupObject>Spring.AopQuickStart.Program</StartupObject>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>bin\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>bin\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Spring.Aop, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Aop.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Core, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="Commands\AnotherServiceCommand.cs" />
-    <Compile Include="Program.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="App.config" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.AopQuickStart.Common\Spring.AopQuickStart.Common.2005.csproj">
-      <Project>{C707543A-8F0E-4483-AECC-BC6EE14C3A29}</Project>
-      <Name>Spring.AopQuickStart.Common.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.Calculator/Spring.Calculator.2003.sln b/examples/Spring/Spring.Calculator/Spring.Calculator.2003.sln
deleted file mode 100644
index 4ad3f6b8..00000000
--- a/examples/Spring/Spring.Calculator/Spring.Calculator.2003.sln
+++ /dev/null
@@ -1,75 +0,0 @@
-Microsoft Visual Studio Solution File, Format Version 8.00
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Calculator.Services.2003", "src\Spring.Calculator.Services\Spring.Calculator.Services.2003.csproj", "{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Calculator.Contract.2003", "src\Spring.Calculator.Contract\Spring.Calculator.Contract.2003.csproj", "{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Calculator.RemoteApp.2003", "src\Spring.Calculator.RemoteApp\Spring.Calculator.RemoteApp.2003.csproj", "{78B542F5-0CE3-4EDD-ACF7-3B2C619ADFC1}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Calculator.ClientApp.2003", "src\Spring.Calculator.ClientApp\Spring.Calculator.ClientApp.2003.csproj", "{F202BB75-CEFD-400B-9CD3-0914F466EBF5}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Calculator.Web.2003", "http://localhost/Spring.Calculator.2003/Spring.Calculator.Web.2003.csproj", "{1AA797F9-51F7-43FE-BDFE-6AC8C1CACC0B}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Aspects.2003", "src\Spring.Aspects\Spring.Aspects.2003.csproj", "{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Calculator.RegisterComponentServices.2003", "src\Spring.Calculator.RegisterComponentServices\Spring.Calculator.RegisterComponentServices.2003.csproj", "{75E2042D-1FCF-42F1-8FB9-0C6C40AE4ACD}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfiguration) = preSolution
-		Debug-1.1 = Debug-1.1
-		Release-1.1 = Release-1.1
-	EndGlobalSection
-	GlobalSection(ProjectDependencies) = postSolution
-	EndGlobalSection
-	GlobalSection(ProjectConfiguration) = postSolution
-		{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}.Release-1.1.Build.0 = Release-1.1|.NET
-		{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}.Release-1.1.Build.0 = Release-1.1|.NET
-		{78B542F5-0CE3-4EDD-ACF7-3B2C619ADFC1}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{78B542F5-0CE3-4EDD-ACF7-3B2C619ADFC1}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{78B542F5-0CE3-4EDD-ACF7-3B2C619ADFC1}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{78B542F5-0CE3-4EDD-ACF7-3B2C619ADFC1}.Release-1.1.Build.0 = Release-1.1|.NET
-		{F202BB75-CEFD-400B-9CD3-0914F466EBF5}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{F202BB75-CEFD-400B-9CD3-0914F466EBF5}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{F202BB75-CEFD-400B-9CD3-0914F466EBF5}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{F202BB75-CEFD-400B-9CD3-0914F466EBF5}.Release-1.1.Build.0 = Release-1.1|.NET
-		{1AA797F9-51F7-43FE-BDFE-6AC8C1CACC0B}.Debug-1.1.ActiveCfg = Debug|.NET
-		{1AA797F9-51F7-43FE-BDFE-6AC8C1CACC0B}.Debug-1.1.Build.0 = Debug|.NET
-		{1AA797F9-51F7-43FE-BDFE-6AC8C1CACC0B}.Release-1.1.ActiveCfg = Release|.NET
-		{1AA797F9-51F7-43FE-BDFE-6AC8C1CACC0B}.Release-1.1.Build.0 = Release|.NET
-		{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}.Release-1.1.Build.0 = Release-1.1|.NET
-		{75E2042D-1FCF-42F1-8FB9-0C6C40AE4ACD}.Debug-1.1.ActiveCfg = Debug-1.1|.NET
-		{75E2042D-1FCF-42F1-8FB9-0C6C40AE4ACD}.Debug-1.1.Build.0 = Debug-1.1|.NET
-		{75E2042D-1FCF-42F1-8FB9-0C6C40AE4ACD}.Release-1.1.ActiveCfg = Release-1.1|.NET
-		{75E2042D-1FCF-42F1-8FB9-0C6C40AE4ACD}.Release-1.1.Build.0 = Release-1.1|.NET
-	EndGlobalSection
-	GlobalSection(SolutionItems) = postSolution
-		readme.txt = readme.txt
-		SpringCalculator.snk = SpringCalculator.snk
-	EndGlobalSection
-	GlobalSection(ExtensibilityGlobals) = postSolution
-	EndGlobalSection
-	GlobalSection(ExtensibilityAddIns) = postSolution
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/Spring.Calculator/Spring.Calculator.2005.sln b/examples/Spring/Spring.Calculator/Spring.Calculator.2005.sln
deleted file mode 100644
index d3f429a8..00000000
--- a/examples/Spring/Spring.Calculator/Spring.Calculator.2005.sln
+++ /dev/null
@@ -1,125 +0,0 @@
-Microsoft Visual Studio Solution File, Format Version 9.00
-# Visual Studio 2005
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Calculator.Services.2005", "src\Spring.Calculator.Services\Spring.Calculator.Services.2005.csproj", "{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}"
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Calculator.Contract.2005", "src\Spring.Calculator.Contract\Spring.Calculator.Contract.2005.csproj", "{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}"
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Calculator.RemoteApp.2005", "src\Spring.Calculator.RemoteApp\Spring.Calculator.RemoteApp.2005.csproj", "{78B542F5-0CE3-4EDD-ACF7-3B2C619ADFC1}"
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Calculator.ClientApp.2005", "src\Spring.Calculator.ClientApp\Spring.Calculator.ClientApp.2005.csproj", "{F202BB75-CEFD-400B-9CD3-0914F466EBF5}"
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Aspects.2005", "src\Spring.Aspects\Spring.Aspects.2005.csproj", "{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}"
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Calculator.RegisterComponentServices.2005", "src\Spring.Calculator.RegisterComponentServices\Spring.Calculator.RegisterComponentServices.2005.csproj", "{75E2042D-1FCF-42F1-8FB9-0C6C40AE4ACD}"
-EndProject
-Project("{2150E333-8FDC-42A3-9474-1A3956D46DE8}") = "Solution Items", "Solution Items", "{B1FF7E1F-9BF9-4EB3-B38C-39A0E3EA4D0A}"
-	ProjectSection(SolutionItems) = preProject
-		readme.txt = readme.txt
-		SpringCalculator.snk = SpringCalculator.snk
-	EndProjectSection
-EndProject
-Project("{E24C65DC-7377-472B-9ABA-BC803B73C61A}") = "D:\...\Spring.Calculator.Web.2005\", "src\Spring.Calculator.Web.2005", "{9697F719-BA0B-492E-ABAE-6132A8FCEC45}"
-	ProjectSection(WebsiteProperties) = preProject
-		ProjectReferences = "{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}|Spring.Aspects.dll;{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}|Spring.Calculator.Contract.dll;{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}|Spring.Calculator.Services.dll;"
-		Debug.AspNetCompiler.VirtualPath = "/Spring.Calculator.Web.2005"
-		Debug.AspNetCompiler.PhysicalPath = "Spring.Calculator.Web.2005\"
-		Debug.AspNetCompiler.TargetPath = "PrecompiledWeb\Spring.Calculator.Web.2005\"
-		Debug.AspNetCompiler.Updateable = "true"
-		Debug.AspNetCompiler.ForceOverwrite = "true"
-		Debug.AspNetCompiler.FixedNames = "false"
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.VirtualPath = "/Spring.Calculator.Web.2005"
-		Release.AspNetCompiler.PhysicalPath = "Spring.Calculator.Web.2005\"
-		Release.AspNetCompiler.TargetPath = "PrecompiledWeb\Spring.Calculator.Web.2005\"
-		Release.AspNetCompiler.Updateable = "true"
-		Release.AspNetCompiler.ForceOverwrite = "true"
-		Release.AspNetCompiler.FixedNames = "false"
-		Release.AspNetCompiler.Debug = "False"
-		VWDPort = "1643"
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfigurationPlatforms) = preSolution
-		Debug|.NET = Debug|.NET
-		Debug|Any CPU = Debug|Any CPU
-		Debug|Mixed Platforms = Debug|Mixed Platforms
-		Release|.NET = Release|.NET
-		Release|Any CPU = Release|Any CPU
-		Release|Mixed Platforms = Release|Mixed Platforms
-	EndGlobalSection
-	GlobalSection(ProjectConfigurationPlatforms) = postSolution
-		{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}.Release|.NET.ActiveCfg = Release|Any CPU
-		{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}.Release|Any CPU.Build.0 = Release|Any CPU
-		{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}.Release|.NET.ActiveCfg = Release|Any CPU
-		{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}.Release|Any CPU.Build.0 = Release|Any CPU
-		{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{78B542F5-0CE3-4EDD-ACF7-3B2C619ADFC1}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{78B542F5-0CE3-4EDD-ACF7-3B2C619ADFC1}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{78B542F5-0CE3-4EDD-ACF7-3B2C619ADFC1}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{78B542F5-0CE3-4EDD-ACF7-3B2C619ADFC1}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{78B542F5-0CE3-4EDD-ACF7-3B2C619ADFC1}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{78B542F5-0CE3-4EDD-ACF7-3B2C619ADFC1}.Release|.NET.ActiveCfg = Release|Any CPU
-		{78B542F5-0CE3-4EDD-ACF7-3B2C619ADFC1}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{78B542F5-0CE3-4EDD-ACF7-3B2C619ADFC1}.Release|Any CPU.Build.0 = Release|Any CPU
-		{78B542F5-0CE3-4EDD-ACF7-3B2C619ADFC1}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{78B542F5-0CE3-4EDD-ACF7-3B2C619ADFC1}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{F202BB75-CEFD-400B-9CD3-0914F466EBF5}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{F202BB75-CEFD-400B-9CD3-0914F466EBF5}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{F202BB75-CEFD-400B-9CD3-0914F466EBF5}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{F202BB75-CEFD-400B-9CD3-0914F466EBF5}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{F202BB75-CEFD-400B-9CD3-0914F466EBF5}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{F202BB75-CEFD-400B-9CD3-0914F466EBF5}.Release|.NET.ActiveCfg = Release|Any CPU
-		{F202BB75-CEFD-400B-9CD3-0914F466EBF5}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{F202BB75-CEFD-400B-9CD3-0914F466EBF5}.Release|Any CPU.Build.0 = Release|Any CPU
-		{F202BB75-CEFD-400B-9CD3-0914F466EBF5}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{F202BB75-CEFD-400B-9CD3-0914F466EBF5}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}.Release|.NET.ActiveCfg = Release|Any CPU
-		{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}.Release|Any CPU.Build.0 = Release|Any CPU
-		{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{75E2042D-1FCF-42F1-8FB9-0C6C40AE4ACD}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{75E2042D-1FCF-42F1-8FB9-0C6C40AE4ACD}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{75E2042D-1FCF-42F1-8FB9-0C6C40AE4ACD}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{75E2042D-1FCF-42F1-8FB9-0C6C40AE4ACD}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{75E2042D-1FCF-42F1-8FB9-0C6C40AE4ACD}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{75E2042D-1FCF-42F1-8FB9-0C6C40AE4ACD}.Release|.NET.ActiveCfg = Release|Any CPU
-		{75E2042D-1FCF-42F1-8FB9-0C6C40AE4ACD}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{75E2042D-1FCF-42F1-8FB9-0C6C40AE4ACD}.Release|Any CPU.Build.0 = Release|Any CPU
-		{75E2042D-1FCF-42F1-8FB9-0C6C40AE4ACD}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{75E2042D-1FCF-42F1-8FB9-0C6C40AE4ACD}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{9697F719-BA0B-492E-ABAE-6132A8FCEC45}.Debug|.NET.ActiveCfg = Debug|.NET
-		{9697F719-BA0B-492E-ABAE-6132A8FCEC45}.Debug|.NET.Build.0 = Debug|.NET
-		{9697F719-BA0B-492E-ABAE-6132A8FCEC45}.Debug|Any CPU.ActiveCfg = Debug|.NET
-		{9697F719-BA0B-492E-ABAE-6132A8FCEC45}.Debug|Mixed Platforms.ActiveCfg = Debug|.NET
-		{9697F719-BA0B-492E-ABAE-6132A8FCEC45}.Debug|Mixed Platforms.Build.0 = Debug|.NET
-		{9697F719-BA0B-492E-ABAE-6132A8FCEC45}.Release|.NET.ActiveCfg = Debug|.NET
-		{9697F719-BA0B-492E-ABAE-6132A8FCEC45}.Release|.NET.Build.0 = Debug|.NET
-		{9697F719-BA0B-492E-ABAE-6132A8FCEC45}.Release|Any CPU.ActiveCfg = Debug|.NET
-		{9697F719-BA0B-492E-ABAE-6132A8FCEC45}.Release|Mixed Platforms.ActiveCfg = Debug|.NET
-		{9697F719-BA0B-492E-ABAE-6132A8FCEC45}.Release|Mixed Platforms.Build.0 = Debug|.NET
-	EndGlobalSection
-	GlobalSection(SolutionProperties) = preSolution
-		HideSolutionNode = FALSE
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/Spring.Calculator/src/Spring.Aspects/Spring.Aspects.2003.csproj b/examples/Spring/Spring.Calculator/src/Spring.Aspects/Spring.Aspects.2003.csproj
deleted file mode 100644
index 88a9fcbc..00000000
--- a/examples/Spring/Spring.Calculator/src/Spring.Aspects/Spring.Aspects.2003.csproj
+++ /dev/null
@@ -1,100 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Aspects"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring.Aspects"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\system.dll"
-                />
-                <Reference
-                    Name = "Spring.Aop"
-                    AssemblyName = "Spring.Aop"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Aop.dll"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Common.Logging.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "Logging\CommonLoggingAroundAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Logging\ConsoleLoggingAroundAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.Calculator/src/Spring.Aspects/Spring.Aspects.2005.csproj b/examples/Spring/Spring.Calculator/src/Spring.Aspects/Spring.Aspects.2005.csproj
deleted file mode 100644
index 348af2be..00000000
--- a/examples/Spring/Spring.Calculator/src/Spring.Aspects/Spring.Aspects.2005.csproj
+++ /dev/null
@@ -1,102 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003" ToolsVersion="3.5">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.Aspects</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Library</OutputType>
-    <RootNamespace>Spring.Aspects</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-    <SignAssembly>false</SignAssembly>
-    <OldToolsVersion>2.0</OldToolsVersion>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>bin\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>bin\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=1.1.0.2, Culture=neutral, PublicKeyToken=65e474d141e25e07, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Aop, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Aop.dll</HintPath>
-    </Reference>
-    <Reference Include="System">
-      <Name>System</Name>
-    </Reference>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="Logging\ConsoleLoggingAroundAdvice.cs" />
-    <Compile Include="Logging\CommonLoggingAroundAdvice.cs" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>
-    </PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.Calculator/src/Spring.Calculator.ClientApp/Spring.Calculator.ClientApp.2003.csproj b/examples/Spring/Spring.Calculator/src/Spring.Calculator.ClientApp/Spring.Calculator.ClientApp.2003.csproj
deleted file mode 100644
index 4f7fdb95..00000000
--- a/examples/Spring/Spring.Calculator/src/Spring.Calculator.ClientApp/Spring.Calculator.ClientApp.2003.csproj
+++ /dev/null
@@ -1,176 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{F202BB75-CEFD-400B-9CD3-0914F466EBF5}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Calculator.ClientApp"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Exe"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring.Calculator.ClientApp"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "system.web.services"
-                    AssemblyName = "System.Web.Services"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\system.web.services.dll"
-                />
-                <Reference
-                    Name = "system"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\system.dll"
-                />
-                <Reference
-                    Name = "Spring.Aspects.2003"
-                    Project = "{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Calculator.Contract.2003"
-                    Project = "{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Calculator.Services.2003"
-                    Project = "{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Services"
-                    AssemblyName = "Spring.Services"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Services.dll"
-                />
-                <Reference
-                    Name = "Spring.Aop"
-                    AssemblyName = "Spring.Aop"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Aop.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "App.config"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Program.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Config\EnterpriseServices\enterpriseServices.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Config\InProcess\inProcess.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Config\Remoting\cao.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Config\Remoting\cao-aop.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Config\Remoting\cao-ctor.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Config\Remoting\cao-ctor-aop.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Config\Remoting\saoSingleCall.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Config\Remoting\saoSingleCall-aop.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Config\Remoting\saoSingleton.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Config\Remoting\saoSingleton-aop.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Config\WebServices2003\calculatorService.wsdl"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Config\WebServices2003\webServices.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Config\WebServices2003\webServices-aop.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.Calculator/src/Spring.Calculator.ClientApp/Spring.Calculator.ClientApp.2005.csproj b/examples/Spring/Spring.Calculator/src/Spring.Calculator.ClientApp/Spring.Calculator.ClientApp.2005.csproj
deleted file mode 100644
index 8a9e51e2..00000000
--- a/examples/Spring/Spring.Calculator/src/Spring.Calculator.ClientApp/Spring.Calculator.ClientApp.2005.csproj
+++ /dev/null
@@ -1,141 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003" ToolsVersion="3.5">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{F202BB75-CEFD-400B-9CD3-0914F466EBF5}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.Calculator.ClientApp</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Exe</OutputType>
-    <RootNamespace>Spring.Calculator.ClientApp</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-    <OldToolsVersion>2.0</OldToolsVersion>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>bin\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-    <UseVSHostingProcess>false</UseVSHostingProcess>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>bin\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.Aspects\Spring.Aspects.2005.csproj">
-      <Name>Spring.Aspects.2003</Name>
-      <Project>{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}</Project>
-      <Package>{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}</Package>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Calculator.Contract\Spring.Calculator.Contract.2005.csproj">
-      <Name>Spring.Calculator.Contract.2003</Name>
-      <Project>{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}</Project>
-      <Package>{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}</Package>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Calculator.Services\Spring.Calculator.Services.2005.csproj">
-      <Name>Spring.Calculator.Services.2003</Name>
-      <Project>{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}</Project>
-      <Package>{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}</Package>
-    </ProjectReference>
-    <Reference Include="Spring.Aop, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Aop.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Core, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Services, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Services.dll</HintPath>
-    </Reference>
-    <Reference Include="System">
-      <Name>system</Name>
-    </Reference>
-    <Reference Include="System.Web.Services">
-      <Name>system.web.services</Name>
-    </Reference>
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="App.config" />
-    <Compile Include="Program.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <EmbeddedResource Include="Config\EnterpriseServices\enterpriseServices.xml" />
-    <EmbeddedResource Include="Config\InProcess\inProcess.xml" />
-    <EmbeddedResource Include="Config\Remoting\cao-aop.xml" />
-    <EmbeddedResource Include="Config\Remoting\cao-ctor-aop.xml" />
-    <EmbeddedResource Include="Config\Remoting\cao-ctor.xml" />
-    <EmbeddedResource Include="Config\Remoting\cao.xml" />
-    <EmbeddedResource Include="Config\Remoting\saoSingleCall-aop.xml" />
-    <EmbeddedResource Include="Config\Remoting\saoSingleCall.xml" />
-    <EmbeddedResource Include="Config\Remoting\saoSingleton-aop.xml" />
-    <EmbeddedResource Include="Config\Remoting\saoSingleton.xml" />
-    <EmbeddedResource Include="Config\WebServices2005\webServices-aop.xml" />
-    <EmbeddedResource Include="Config\WebServices2005\webServices.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Config\WebServices2005\calculatorService.wsdl" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>
-    </PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.Calculator/src/Spring.Calculator.Contract/Spring.Calculator.Contract.2003.csproj b/examples/Spring/Spring.Calculator/src/Spring.Calculator.Contract/Spring.Calculator.Contract.2003.csproj
deleted file mode 100644
index 3bbfac93..00000000
--- a/examples/Spring/Spring.Calculator/src/Spring.Calculator.Contract/Spring.Calculator.Contract.2003.csproj
+++ /dev/null
@@ -1,89 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Calculator.Contract"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring.Calculator"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;STRONG"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE;STRONG"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References/>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "Domain\DivisionResult.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Interfaces\IAdvancedCalculator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Interfaces\ICalculator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.Calculator/src/Spring.Calculator.Contract/Spring.Calculator.Contract.2005.csproj b/examples/Spring/Spring.Calculator/src/Spring.Calculator.Contract/Spring.Calculator.Contract.2005.csproj
deleted file mode 100644
index c78adb28..00000000
--- a/examples/Spring/Spring.Calculator/src/Spring.Calculator.Contract/Spring.Calculator.Contract.2005.csproj
+++ /dev/null
@@ -1,93 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003" ToolsVersion="3.5">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.Calculator.Contract</AssemblyName>
-    <AssemblyOriginatorKeyFile>../../Spring.Calculator.snk</AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Library</OutputType>
-    <RootNamespace>Spring.Calculator</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-    <SignAssembly>true</SignAssembly>
-    <OldToolsVersion>2.0</OldToolsVersion>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>bin\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>bin\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Compile Include="Domain\DivisionResult.cs" />
-    <Compile Include="Interfaces\IAdvancedCalculator.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Interfaces\ICalculator.cs">
-      <SubType>Code</SubType>
-    </Compile>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>
-    </PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.Calculator/src/Spring.Calculator.RegisterComponentServices/Spring.Calculator.RegisterComponentServices.2003.csproj b/examples/Spring/Spring.Calculator/src/Spring.Calculator.RegisterComponentServices/Spring.Calculator.RegisterComponentServices.2003.csproj
deleted file mode 100644
index 3a49cdb0..00000000
--- a/examples/Spring/Spring.Calculator/src/Spring.Calculator.RegisterComponentServices/Spring.Calculator.RegisterComponentServices.2003.csproj
+++ /dev/null
@@ -1,116 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{75E2042D-1FCF-42F1-8FB9-0C6C40AE4ACD}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Calculator.RegisterComponentServices"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Exe"
-                PreBuildEvent = ""
-                PostBuildEvent = "xcopy $(ProjectDir)Spring.Calculator.EnterpriseServices.* $(TargetDir) /Y /F&#xd;&#xa;xcopy $(ProjectDir)Config\*.* $(TargetDir)Config /S /Y /F /I"
-                RootNamespace = "Spring.Calculator.RegisterComponentServices"
-                RunPostBuildEvent = "Always"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "Spring.Calculator.Contract"
-                    Project = "{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Calculator.Services"
-                    Project = "{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Services"
-                    AssemblyName = "Spring.Services"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Services.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "App.config"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Program.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Spring.Calculator.EnterpriseServices.dll.config"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Spring.Calculator.EnterpriseServices.exe.config"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Config\services.xml"
-                    BuildAction = "Content"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.Calculator/src/Spring.Calculator.RegisterComponentServices/Spring.Calculator.RegisterComponentServices.2005.csproj b/examples/Spring/Spring.Calculator/src/Spring.Calculator.RegisterComponentServices/Spring.Calculator.RegisterComponentServices.2005.csproj
deleted file mode 100644
index 99b453ca..00000000
--- a/examples/Spring/Spring.Calculator/src/Spring.Calculator.RegisterComponentServices/Spring.Calculator.RegisterComponentServices.2005.csproj
+++ /dev/null
@@ -1,118 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003" ToolsVersion="3.5">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{75E2042D-1FCF-42F1-8FB9-0C6C40AE4ACD}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.Calculator.RegisterComponentServices</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Exe</OutputType>
-    <RootNamespace>Spring.Calculator.RegisterComponentServices</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-    <OldToolsVersion>2.0</OldToolsVersion>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>bin\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-    <UseVSHostingProcess>false</UseVSHostingProcess>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>bin\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <None Include="App.config" />
-    <None Include="Spring.Calculator.EnterpriseServices.dll.config" />
-    <None Include="Spring.Calculator.EnterpriseServices.exe.config" />
-    <Compile Include="Program.cs">
-      <SubType>Code</SubType>
-    </Compile>
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.Calculator.Contract\Spring.Calculator.Contract.2005.csproj">
-      <Project>{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}</Project>
-      <Name>Spring.Calculator.Contract.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Calculator.Services\Spring.Calculator.Services.2005.csproj">
-      <Project>{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}</Project>
-      <Name>Spring.Calculator.Services.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <ItemGroup>
-    <Reference Include="Spring.Core, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Services, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Services.dll</HintPath>
-    </Reference>
-  </ItemGroup>
-  <ItemGroup>
-    <Content Include="Config\services.xml">
-      <CopyToOutputDirectory>Always</CopyToOutputDirectory>
-    </Content>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>
-    </PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.Calculator/src/Spring.Calculator.RemoteApp/Spring.Calculator.RemoteApp.2003.csproj b/examples/Spring/Spring.Calculator/src/Spring.Calculator.RemoteApp/Spring.Calculator.RemoteApp.2003.csproj
deleted file mode 100644
index 3e9cf573..00000000
--- a/examples/Spring/Spring.Calculator/src/Spring.Calculator.RemoteApp/Spring.Calculator.RemoteApp.2003.csproj
+++ /dev/null
@@ -1,143 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{78B542F5-0CE3-4EDD-ACF7-3B2C619ADFC1}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Calculator.RemoteApp"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Exe"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring.Calculator.RemoteApp"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "Spring.Calculator.Contract"
-                    Project = "{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Calculator.Services"
-                    Project = "{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Aspects.2003"
-                    Project = "{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Aop"
-                    AssemblyName = "Spring.Aop"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Aop.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-                <Reference
-                    Name = "Spring.Services"
-                    AssemblyName = "Spring.Services"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Services.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "App.config"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Program.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Config\cao.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Config\cao-aop.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Config\saoSingleCall.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Config\saoSingleCall-aop.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Config\saoSingleton.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Config\saoSingleton-aop.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.Calculator/src/Spring.Calculator.RemoteApp/Spring.Calculator.RemoteApp.2005.csproj b/examples/Spring/Spring.Calculator/src/Spring.Calculator.RemoteApp/Spring.Calculator.RemoteApp.2005.csproj
deleted file mode 100644
index b5d13936..00000000
--- a/examples/Spring/Spring.Calculator/src/Spring.Calculator.RemoteApp/Spring.Calculator.RemoteApp.2005.csproj
+++ /dev/null
@@ -1,127 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003" ToolsVersion="3.5">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{78B542F5-0CE3-4EDD-ACF7-3B2C619ADFC1}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.Calculator.RemoteApp</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Exe</OutputType>
-    <RootNamespace>Spring.Calculator.RemoteApp</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-    <OldToolsVersion>2.0</OldToolsVersion>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>bin\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>bin\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Spring.Aop, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Aop.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Core, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Services, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Services.dll</HintPath>
-    </Reference>
-    <Reference Include="System">
-      <Name>System</Name>
-    </Reference>
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="App.config" />
-    <Compile Include="Program.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <EmbeddedResource Include="Config\cao-aop.xml" />
-    <EmbeddedResource Include="Config\cao.xml" />
-    <EmbeddedResource Include="Config\saoSingleCall-aop.xml" />
-    <EmbeddedResource Include="Config\saoSingleCall.xml" />
-    <EmbeddedResource Include="Config\saoSingleton-aop.xml" />
-    <EmbeddedResource Include="Config\saoSingleton.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.Aspects\Spring.Aspects.2005.csproj">
-      <Project>{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}</Project>
-      <Name>Spring.Aspects.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Calculator.Contract\Spring.Calculator.Contract.2005.csproj">
-      <Project>{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}</Project>
-      <Name>Spring.Calculator.Contract.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Calculator.Services\Spring.Calculator.Services.2005.csproj">
-      <Project>{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}</Project>
-      <Name>Spring.Calculator.Services.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>
-    </PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.Calculator/src/Spring.Calculator.Services/Spring.Calculator.Services.2003.csproj b/examples/Spring/Spring.Calculator/src/Spring.Calculator.Services/Spring.Calculator.Services.2003.csproj
deleted file mode 100644
index 879aab48..00000000
--- a/examples/Spring/Spring.Calculator/src/Spring.Calculator.Services/Spring.Calculator.Services.2003.csproj
+++ /dev/null
@@ -1,90 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Calculator.Services"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring.Calculator"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;STRONG"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE;STRONG"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "Spring.Calculator.Contract"
-                    Project = "{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "Services\AdvancedCalculator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Services\Calculator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.Calculator/src/Spring.Calculator.Services/Spring.Calculator.Services.2005.csproj b/examples/Spring/Spring.Calculator/src/Spring.Calculator.Services/Spring.Calculator.Services.2005.csproj
deleted file mode 100644
index 5c9c1e3a..00000000
--- a/examples/Spring/Spring.Calculator/src/Spring.Calculator.Services/Spring.Calculator.Services.2005.csproj
+++ /dev/null
@@ -1,98 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003" ToolsVersion="3.5">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.Calculator.Services</AssemblyName>
-    <AssemblyOriginatorKeyFile>../../Spring.Calculator.snk</AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Library</OutputType>
-    <RootNamespace>Spring.Calculator</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-    <SignAssembly>true</SignAssembly>
-    <OldToolsVersion>2.0</OldToolsVersion>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>bin\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>bin\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Compile Include="Services\AdvancedCalculator.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Services\Calculator.cs">
-      <SubType>Code</SubType>
-    </Compile>
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.Calculator.Contract\Spring.Calculator.Contract.2005.csproj">
-      <Project>{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}</Project>
-      <Name>Spring.Calculator.Contract.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>
-    </PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.Calculator/src/Spring.Calculator.Web.2003/Spring.Calculator.Web.2003.csproj b/examples/Spring/Spring.Calculator/src/Spring.Calculator.Web.2003/Spring.Calculator.Web.2003.csproj
deleted file mode 100644
index 16228b11..00000000
--- a/examples/Spring/Spring.Calculator/src/Spring.Calculator.Web.2003/Spring.Calculator.Web.2003.csproj
+++ /dev/null
@@ -1,146 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Web"
-        ProductVersion = "7.10.3077"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{1AA797F9-51F7-43FE-BDFE-6AC8C1CACC0B}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Calculator.Web"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring.Calculator.Web"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Web"
-                    AssemblyName = "System.Web"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Web.dll"
-                />
-                <Reference
-                    Name = "Spring.Aspects.2003"
-                    Project = "{6B34626E-8D2A-4387-BBB6-CB352D4DBDEC}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Calculator.Contract.2003"
-                    Project = "{284C0873-BBB4-4399-B6F7-CB7EDBD001C7}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Calculator.Services.2003"
-                    Project = "{D9FB04E5-D636-4EC2-A3AB-FAB1C4F37827}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Common.Logging.Log4Net"
-                    AssemblyName = "Common.Logging.Log4Net"
-                    HintPath = "..\..\lib\net\1.1\Common.Logging.Log4Net.dll"
-                />
-                <Reference
-                    Name = "log4net"
-                    AssemblyName = "log4net"
-                    HintPath = "..\..\lib\net\1.1\log4net.dll"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Common.Logging.dll"
-                />
-                <Reference
-                    Name = "Spring.Aop"
-                    AssemblyName = "Spring.Aop"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Aop.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-                <Reference
-                    Name = "Spring.Web"
-                    AssemblyName = "Spring.Web"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Web.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "Default.aspx"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web.config"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Config\webServices.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Config\webServices-aop.xml"
-                    BuildAction = "Content"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.DataQuickStart/Spring.DataQuickStart.2003.sln b/examples/Spring/Spring.DataQuickStart/Spring.DataQuickStart.2003.sln
deleted file mode 100644
index 6d4e45a8..00000000
--- a/examples/Spring/Spring.DataQuickStart/Spring.DataQuickStart.2003.sln
+++ /dev/null
@@ -1,29 +0,0 @@
-Microsoft Visual Studio Solution File, Format Version 8.00
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.DataQuickStart.2003", "src\Spring\Spring.DataQuickStart\Spring.DataQuickStart.2003.csproj", "{4599FD80-29F6-4542-8945-F93F709DFD3F}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.DataQuickStart.Tests.2003", "test\Spring\Spring.DataQuickStart.Tests\Spring.DataQuickStart.Tests.2003.csproj", "{9989A239-3406-4E67-B2B5-C8CF78E2311B}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfiguration) = preSolution
-		Debug = Debug
-		Release = Release
-	EndGlobalSection
-	GlobalSection(ProjectConfiguration) = postSolution
-		{4599FD80-29F6-4542-8945-F93F709DFD3F}.Debug.ActiveCfg = Debug|.NET
-		{4599FD80-29F6-4542-8945-F93F709DFD3F}.Debug.Build.0 = Debug|.NET
-		{4599FD80-29F6-4542-8945-F93F709DFD3F}.Release.ActiveCfg = Release|.NET
-		{4599FD80-29F6-4542-8945-F93F709DFD3F}.Release.Build.0 = Release|.NET
-		{9989A239-3406-4E67-B2B5-C8CF78E2311B}.Debug.ActiveCfg = Debug|.NET
-		{9989A239-3406-4E67-B2B5-C8CF78E2311B}.Debug.Build.0 = Debug|.NET
-		{9989A239-3406-4E67-B2B5-C8CF78E2311B}.Release.ActiveCfg = Release|.NET
-		{9989A239-3406-4E67-B2B5-C8CF78E2311B}.Release.Build.0 = Release|.NET
-	EndGlobalSection
-	GlobalSection(ExtensibilityGlobals) = postSolution
-	EndGlobalSection
-	GlobalSection(ExtensibilityAddIns) = postSolution
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/Spring.DataQuickStart/Spring.DataQuickStart.2005.sln b/examples/Spring/Spring.DataQuickStart/Spring.DataQuickStart.2005.sln
deleted file mode 100644
index d9929cab..00000000
--- a/examples/Spring/Spring.DataQuickStart/Spring.DataQuickStart.2005.sln
+++ /dev/null
@@ -1,26 +0,0 @@
-
-Microsoft Visual Studio Solution File, Format Version 9.00
-# Visual Studio 2005
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.DataQuickStart.2005", "src\Spring\Spring.DataQuickStart\Spring.DataQuickStart.2005.csproj", "{92B2A60E-D3B9-4647-8CFE-AC19611869F6}"
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.DataQuickStart.Tests.2005", "test\Spring\Spring.DataQuickStart.Tests\Spring.DataQuickStart.Tests.2005.csproj", "{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}"
-EndProject
-Global
-	GlobalSection(SolutionConfigurationPlatforms) = preSolution
-		Debug|Any CPU = Debug|Any CPU
-		Release|Any CPU = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(ProjectConfigurationPlatforms) = postSolution
-		{92B2A60E-D3B9-4647-8CFE-AC19611869F6}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{92B2A60E-D3B9-4647-8CFE-AC19611869F6}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{92B2A60E-D3B9-4647-8CFE-AC19611869F6}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{92B2A60E-D3B9-4647-8CFE-AC19611869F6}.Release|Any CPU.Build.0 = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Any CPU.Build.0 = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(SolutionProperties) = preSolution
-		HideSolutionNode = FALSE
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/Spring.DataQuickStart/src/Spring/Spring.DataQuickStart/Spring.DataQuickStart.2003.csproj b/examples/Spring/Spring.DataQuickStart/src/Spring/Spring.DataQuickStart/Spring.DataQuickStart.2003.csproj
deleted file mode 100644
index b9bc3476..00000000
--- a/examples/Spring/Spring.DataQuickStart/src/Spring/Spring.DataQuickStart/Spring.DataQuickStart.2003.csproj
+++ /dev/null
@@ -1,155 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{4599FD80-29F6-4542-8945-F93F709DFD3F}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.DataQuickStart"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "Spring.Data"
-                    AssemblyName = "Spring.Data"
-                    HintPath = "..\..\..\..\..\..\bin\net\1.1\debug\Spring.Data.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "DataQuickStart\Dao\Template\CommandCallbackDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataQuickStart\Dao\Template\CustomerDataSetDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataQuickStart\Dao\Template\CustomerRowMapper.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataQuickStart\Dao\Template\CustOrdersDetailStoredProc.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataQuickStart\Dao\Template\OrderDetailRowMapper.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataQuickStart\Dao\Template\QueryForObjectDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataQuickStart\Dao\Template\ResultSetExtractorDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataQuickStart\Dao\Template\RowCallbackDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataQuickStart\Dao\Template\RowMapperDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataQuickStart\Domain\Customer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataQuickStart\Domain\OrderDetails.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.DataQuickStart/src/Spring/Spring.DataQuickStart/Spring.DataQuickStart.2005.csproj b/examples/Spring/Spring.DataQuickStart/src/Spring/Spring.DataQuickStart/Spring.DataQuickStart.2005.csproj
deleted file mode 100644
index fe3cc1fc..00000000
--- a/examples/Spring/Spring.DataQuickStart/src/Spring/Spring.DataQuickStart/Spring.DataQuickStart.2005.csproj
+++ /dev/null
@@ -1,78 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{92B2A60E-D3B9-4647-8CFE-AC19611869F6}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.DataQuickStart</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>bin\Debug\</OutputPath>
-    <DefineConstants>DEBUG;TRACE</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-    <DocumentationFile>
-    </DocumentationFile>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>bin\Release\</OutputPath>
-    <DefineConstants>TRACE</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=1.1.0.2, Culture=neutral, PublicKeyToken=65e474d141e25e07, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\..\bin\net\2.0\debug\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Core, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Data, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\..\bin\net\2.0\debug\Spring.Data.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="DataQuickStart\Dao\GenericTemplate\CommandCallbackDao.cs" />
-    <Compile Include="DataQuickStart\Dao\GenericTemplate\CustOrdersDetailStoredProc.cs" />
-    <Compile Include="DataQuickStart\Dao\GenericTemplate\OrderDetailRowMapper.cs" />
-    <Compile Include="DataQuickStart\Dao\Template\OrderDetailRowMapper.cs" />
-    <Compile Include="DataQuickStart\Dao\Template\CustOrdersDetailStoredProc.cs" />
-    <Compile Include="DataQuickStart\Dao\GenericTemplate\QueryForObjectDao.cs" />
-    <Compile Include="DataQuickStart\Dao\GenericTemplate\RowCallbackDao.cs" />
-    <Compile Include="DataQuickStart\Dao\Template\CommandCallbackDao.cs" />
-    <Compile Include="DataQuickStart\Dao\Template\CustomerRowMapper.cs" />
-    <Compile Include="DataQuickStart\Dao\Template\CustomerDataSetDao.cs" />
-    <Compile Include="DataQuickStart\Dao\Template\QueryForObjectDao.cs" />
-    <Compile Include="DataQuickStart\Dao\Template\ResultSetExtractorDao.cs" />
-    <Compile Include="DataQuickStart\Dao\Template\RowCallbackDao.cs" />
-    <Compile Include="DataQuickStart\Dao\Template\RowMapperDao.cs" />
-    <Compile Include="DataQuickStart\Domain\Customer.cs" />
-    <Compile Include="DataQuickStart\Dao\GenericTemplate\CustomerRowMapper.cs" />
-    <Compile Include="DataQuickStart\Dao\GenericTemplate\ResultSetExtractorDao.cs" />
-    <Compile Include="DataQuickStart\Dao\GenericTemplate\RowMapperDao.cs" />
-    <Compile Include="DataQuickStart\Domain\OrderDetails.cs" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.DataQuickStart/test/Spring/Spring.DataQuickStart.Tests/Spring.DataQuickStart.Tests.2003.csproj b/examples/Spring/Spring.DataQuickStart/test/Spring/Spring.DataQuickStart.Tests/Spring.DataQuickStart.Tests.2003.csproj
deleted file mode 100644
index 76c8b0c2..00000000
--- a/examples/Spring/Spring.DataQuickStart/test/Spring/Spring.DataQuickStart.Tests/Spring.DataQuickStart.Tests.2003.csproj
+++ /dev/null
@@ -1,128 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.3077"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{9989A239-3406-4E67-B2B5-C8CF78E2311B}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.DataQuickStart.Tests"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = 'copy /y "$(ProjectDir)Spring.DataQuickStart.Tests.dll.config"  "$(TargetDir)Spring.DataQuickStart.Tests.dll.config"'
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "0"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "Spring.DataQuickStart.2003"
-                    Project = "{4599FD80-29F6-4542-8945-F93F709DFD3F}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Data"
-                    AssemblyName = "Spring.Data"
-                    HintPath = "..\..\..\..\..\..\bin\net\1.1\debug\Spring.Data.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-                <Reference
-                    Name = "nunit.framework"
-                    AssemblyName = "nunit.framework"
-                    HintPath = "..\..\..\..\..\..\lib\Net\1.1\nunit.framework.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Spring.DataQuickStart.Tests.dll.config"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "DataQuickStart\Template\ExampleTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataQuickStart\Template\ExampleTests.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.DataQuickStart/test/Spring/Spring.DataQuickStart.Tests/Spring.DataQuickStart.Tests.2005.csproj b/examples/Spring/Spring.DataQuickStart/test/Spring/Spring.DataQuickStart.Tests/Spring.DataQuickStart.Tests.2005.csproj
deleted file mode 100644
index 7948174f..00000000
--- a/examples/Spring/Spring.DataQuickStart/test/Spring/Spring.DataQuickStart.Tests/Spring.DataQuickStart.Tests.2005.csproj
+++ /dev/null
@@ -1,78 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.DataQuickStart.Tests</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>bin\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>bin\Release\</OutputPath>
-    <DefineConstants>TRACE</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=2.1.0.0, Culture=neutral, PublicKeyToken=65e474d141e25e07, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.framework, Version=2.2.7.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\..\lib\Net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Core, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Data, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\..\bin\net\2.0\debug\Spring.Data.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.DataQuickStart\Spring.DataQuickStart.2005.csproj">
-      <Project>{92B2A60E-D3B9-4647-8CFE-AC19611869F6}</Project>
-      <Name>Spring.DataQuickStart.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="DataQuickStart\GenericTemplate\ExampleTests.cs" />
-    <Compile Include="DataQuickStart\Template\ExampleTests.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="DataQuickStart\GenericTemplate\ExampleTests.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="DataQuickStart\Template\ExampleTests.xml" />
-    <Content Include="Spring.DataQuickStart.Tests.dll.config">
-      <CopyToOutputDirectory>Always</CopyToOutputDirectory>
-    </Content>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.IoCQuickStart.AppContext/Spring.IocQuickStart.AppContext.2003.sln b/examples/Spring/Spring.IoCQuickStart.AppContext/Spring.IocQuickStart.AppContext.2003.sln
deleted file mode 100644
index 5d123b75..00000000
--- a/examples/Spring/Spring.IoCQuickStart.AppContext/Spring.IocQuickStart.AppContext.2003.sln
+++ /dev/null
@@ -1,21 +0,0 @@
-Microsoft Visual Studio Solution File, Format Version 8.00
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.IocQuickStart.AppContext.2003", "src/Spring.IocQuickStart.AppContext.2003.csproj", "{880EA873-E951-465A-AC5B-BA899A2C744E}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfiguration) = preSolution
-		Debug = Debug
-		Release = Release
-	EndGlobalSection
-	GlobalSection(ProjectConfiguration) = postSolution
-		{880EA873-E951-465A-AC5B-BA899A2C744E}.Debug.ActiveCfg = Debug|.NET
-		{880EA873-E951-465A-AC5B-BA899A2C744E}.Debug.Build.0 = Debug|.NET
-		{880EA873-E951-465A-AC5B-BA899A2C744E}.Release.ActiveCfg = Release|.NET
-		{880EA873-E951-465A-AC5B-BA899A2C744E}.Release.Build.0 = Release|.NET
-	EndGlobalSection
-	GlobalSection(ExtensibilityGlobals) = postSolution
-	EndGlobalSection
-	GlobalSection(ExtensibilityAddIns) = postSolution
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/Spring.IoCQuickStart.AppContext/Spring.IocQuickStart.AppContext.2005.sln b/examples/Spring/Spring.IoCQuickStart.AppContext/Spring.IocQuickStart.AppContext.2005.sln
deleted file mode 100644
index 7a7cfc8b..00000000
--- a/examples/Spring/Spring.IoCQuickStart.AppContext/Spring.IocQuickStart.AppContext.2005.sln
+++ /dev/null
@@ -1,19 +0,0 @@
-Microsoft Visual Studio Solution File, Format Version 9.00
-# Visual Studio 2005
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.IocQuickStart.AppContext.2005", "src/Spring.IocQuickStart.AppContext.2005.csproj", "{880EA873-E951-465A-AC5B-BA899A2C744E}"
-EndProject
-Global
-	GlobalSection(SolutionConfigurationPlatforms) = preSolution
-		Debug|Any CPU = Debug|Any CPU
-		Release|Any CPU = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(ProjectConfigurationPlatforms) = postSolution
-		{880EA873-E951-465A-AC5B-BA899A2C744E}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{880EA873-E951-465A-AC5B-BA899A2C744E}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{880EA873-E951-465A-AC5B-BA899A2C744E}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{880EA873-E951-465A-AC5B-BA899A2C744E}.Release|Any CPU.Build.0 = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(SolutionProperties) = preSolution
-		HideSolutionNode = FALSE
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/Spring.IoCQuickStart.AppContext/src/Spring.IocQuickStart.AppContext.2003.csproj b/examples/Spring/Spring.IoCQuickStart.AppContext/src/Spring.IocQuickStart.AppContext.2003.csproj
deleted file mode 100644
index f671c81a..00000000
--- a/examples/Spring/Spring.IoCQuickStart.AppContext/src/Spring.IocQuickStart.AppContext.2003.csproj
+++ /dev/null
@@ -1,151 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.3077"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{880EA873-E951-465A-AC5B-BA899A2C744E}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.IocQuickStart.AppContext"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "WinExe"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring.IocQuickStart"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "System.Drawing"
-                    AssemblyName = "System.Drawing"
-                    HintPath = "..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Drawing.dll"
-                />
-                <Reference
-                    Name = "System.Windows.Forms"
-                    AssemblyName = "System.Windows.Forms"
-                    HintPath = "..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Windows.Forms.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "App.config"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "AppContext\Images.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "AppContext\Keys.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AppContext\MyResource.es.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "AppContext\MyResource.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "AppContext\Person.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AppContext\Person.resx"
-                    DependentUpon = "Person.cs"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "AppContext\Program.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AppContext\ResourcesDisplayForm.cs"
-                    SubType = "Form"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AppContext\ResourcesDisplayForm.resx"
-                    DependentUpon = "ResourcesDisplayForm.cs"
-                    BuildAction = "EmbeddedResource"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.IoCQuickStart.AppContext/src/Spring.IocQuickStart.AppContext.2005.csproj b/examples/Spring/Spring.IoCQuickStart.AppContext/src/Spring.IocQuickStart.AppContext.2005.csproj
deleted file mode 100644
index a77ff771..00000000
--- a/examples/Spring/Spring.IoCQuickStart.AppContext/src/Spring.IocQuickStart.AppContext.2005.csproj
+++ /dev/null
@@ -1,130 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{880EA873-E951-465A-AC5B-BA899A2C744E}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.IocQuickStart.AppContext</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>WinExe</OutputType>
-    <RootNamespace>Spring.IocQuickStart</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>bin\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>bin\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Spring.Core, Version=2.0.0.0, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="System">
-      <Name>System</Name>
-    </Reference>
-    <Reference Include="System.Data">
-      <Name>System.Data</Name>
-    </Reference>
-    <Reference Include="System.Drawing">
-      <Name>System.Drawing</Name>
-    </Reference>
-    <Reference Include="System.Windows.Forms">
-      <Name>System.Windows.Forms</Name>
-    </Reference>
-    <Reference Include="System.Xml">
-      <Name>System.XML</Name>
-    </Reference>
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="App.config" />
-    <EmbeddedResource Include="AppContext\Images.resx">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="AppContext\MyResource.es.resx">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="AppContext\MyResource.resx">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="AppContext\Person.resx">
-      <DependentUpon>Person.cs</DependentUpon>
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="AppContext\ResourcesDisplayForm.resx">
-      <DependentUpon>ResourcesDisplayForm.cs</DependentUpon>
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <Compile Include="AppContext\Keys.cs" />
-    <Compile Include="AppContext\Program.cs" />
-    <Compile Include="AppContext\Person.cs" />
-    <Compile Include="AppContext\ResourcesDisplayForm.cs">
-      <SubType>Form</SubType>
-    </Compile>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>
-    </PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.IoCQuickStart.EventRegistry/Spring.IocQuickStart.EventRegistry.2003.sln b/examples/Spring/Spring.IoCQuickStart.EventRegistry/Spring.IocQuickStart.EventRegistry.2003.sln
deleted file mode 100644
index 5ac2b6d3..00000000
--- a/examples/Spring/Spring.IoCQuickStart.EventRegistry/Spring.IocQuickStart.EventRegistry.2003.sln
+++ /dev/null
@@ -1,21 +0,0 @@
-Microsoft Visual Studio Solution File, Format Version 8.00
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.IocQuickStart.EventRegistry.2003", "src/Spring.IocQuickStart.EventRegistry.2003.csproj", "{0D35F19E-308E-4A0B-88B1-7E7C2D665053}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfiguration) = preSolution
-		Debug = Debug
-		Release = Release
-	EndGlobalSection
-	GlobalSection(ProjectConfiguration) = postSolution
-		{0D35F19E-308E-4A0B-88B1-7E7C2D665053}.Debug.ActiveCfg = Debug|.NET
-		{0D35F19E-308E-4A0B-88B1-7E7C2D665053}.Debug.Build.0 = Debug|.NET
-		{0D35F19E-308E-4A0B-88B1-7E7C2D665053}.Release.ActiveCfg = Release|.NET
-		{0D35F19E-308E-4A0B-88B1-7E7C2D665053}.Release.Build.0 = Release|.NET
-	EndGlobalSection
-	GlobalSection(ExtensibilityGlobals) = postSolution
-	EndGlobalSection
-	GlobalSection(ExtensibilityAddIns) = postSolution
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/Spring.IoCQuickStart.EventRegistry/Spring.IocQuickStart.EventRegistry.2005.sln b/examples/Spring/Spring.IoCQuickStart.EventRegistry/Spring.IocQuickStart.EventRegistry.2005.sln
deleted file mode 100644
index 0eeb8bc6..00000000
--- a/examples/Spring/Spring.IoCQuickStart.EventRegistry/Spring.IocQuickStart.EventRegistry.2005.sln
+++ /dev/null
@@ -1,19 +0,0 @@
-Microsoft Visual Studio Solution File, Format Version 9.00
-# Visual Studio 2005
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.IocQuickStart.EventRegistry.2005", "src/Spring.IocQuickStart.EventRegistry.2005.csproj", "{0D35F19E-308E-4A0B-88B1-7E7C2D665053}"
-EndProject
-Global
-	GlobalSection(SolutionConfigurationPlatforms) = preSolution
-		Debug|Any CPU = Debug|Any CPU
-		Release|Any CPU = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(ProjectConfigurationPlatforms) = postSolution
-		{0D35F19E-308E-4A0B-88B1-7E7C2D665053}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{0D35F19E-308E-4A0B-88B1-7E7C2D665053}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{0D35F19E-308E-4A0B-88B1-7E7C2D665053}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{0D35F19E-308E-4A0B-88B1-7E7C2D665053}.Release|Any CPU.Build.0 = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(SolutionProperties) = preSolution
-		HideSolutionNode = FALSE
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/Spring.IoCQuickStart.EventRegistry/src/Spring.IocQuickStart.EventRegistry.2003.csproj b/examples/Spring/Spring.IoCQuickStart.EventRegistry/src/Spring.IocQuickStart.EventRegistry.2003.csproj
deleted file mode 100644
index 044e447d..00000000
--- a/examples/Spring/Spring.IoCQuickStart.EventRegistry/src/Spring.IocQuickStart.EventRegistry.2003.csproj
+++ /dev/null
@@ -1,109 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.3077"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{0D35F19E-308E-4A0B-88B1-7E7C2D665053}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.IocQuickStart.EventRegistry"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Exe"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring.IocQuickStart"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "App.config"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "EventRegistry\MyClientEventArgs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "EventRegistry\MyEventPublisher.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "EventRegistry\MyEventSubscriber.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "EventRegistry\Program.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.IoCQuickStart.EventRegistry/src/Spring.IocQuickStart.EventRegistry.2005.csproj b/examples/Spring/Spring.IoCQuickStart.EventRegistry/src/Spring.IocQuickStart.EventRegistry.2005.csproj
deleted file mode 100644
index e9400aed..00000000
--- a/examples/Spring/Spring.IoCQuickStart.EventRegistry/src/Spring.IocQuickStart.EventRegistry.2005.csproj
+++ /dev/null
@@ -1,100 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{0D35F19E-308E-4A0B-88B1-7E7C2D665053}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.IocQuickStart.EventRegistry</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Exe</OutputType>
-    <RootNamespace>Spring.IocQuickStart</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>Spring.IocQuickStart.EventRegistry.Program</StartupObject>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>bin\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>bin\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Spring.Core, Version=2.0.0.0, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="System">
-      <Name>System</Name>
-    </Reference>
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="App.config" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="EventRegistry\MyClientEventArgs.cs" />
-    <Compile Include="EventRegistry\MyEventPublisher.cs" />
-    <Compile Include="EventRegistry\MyEventSubscriber.cs" />
-    <Compile Include="EventRegistry\Program.cs" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>
-    </PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.IoCQuickStart.MovieFinder/Spring.IocQuickStart.MovieFinder.2003.sln b/examples/Spring/Spring.IoCQuickStart.MovieFinder/Spring.IocQuickStart.MovieFinder.2003.sln
deleted file mode 100644
index c686ef4b..00000000
--- a/examples/Spring/Spring.IoCQuickStart.MovieFinder/Spring.IocQuickStart.MovieFinder.2003.sln
+++ /dev/null
@@ -1,21 +0,0 @@
-Microsoft Visual Studio Solution File, Format Version 8.00
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.IocQuickStart.MovieFinder.2003", "src/Spring.IocQuickStart.MovieFinder.2003.csproj", "{C261D9ED-85C3-4B35-BE48-7156F5B17430}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfiguration) = preSolution
-		Debug = Debug
-		Release = Release
-	EndGlobalSection
-	GlobalSection(ProjectConfiguration) = postSolution
-		{C261D9ED-85C3-4B35-BE48-7156F5B17430}.Debug.ActiveCfg = Debug|.NET
-		{C261D9ED-85C3-4B35-BE48-7156F5B17430}.Debug.Build.0 = Debug|.NET
-		{C261D9ED-85C3-4B35-BE48-7156F5B17430}.Release.ActiveCfg = Release|.NET
-		{C261D9ED-85C3-4B35-BE48-7156F5B17430}.Release.Build.0 = Release|.NET
-	EndGlobalSection
-	GlobalSection(ExtensibilityGlobals) = postSolution
-	EndGlobalSection
-	GlobalSection(ExtensibilityAddIns) = postSolution
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/Spring.IoCQuickStart.MovieFinder/Spring.IocQuickStart.MovieFinder.2005.sln b/examples/Spring/Spring.IoCQuickStart.MovieFinder/Spring.IocQuickStart.MovieFinder.2005.sln
deleted file mode 100644
index 42faff40..00000000
--- a/examples/Spring/Spring.IoCQuickStart.MovieFinder/Spring.IocQuickStart.MovieFinder.2005.sln
+++ /dev/null
@@ -1,19 +0,0 @@
-Microsoft Visual Studio Solution File, Format Version 9.00
-# Visual Studio 2005
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.IocQuickStart.MovieFinder.2005", "src/Spring.IocQuickStart.MovieFinder.2005.csproj", "{C261D9ED-85C3-4B35-BE48-7156F5B17430}"
-EndProject
-Global
-	GlobalSection(SolutionConfigurationPlatforms) = preSolution
-		Debug|Any CPU = Debug|Any CPU
-		Release|Any CPU = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(ProjectConfigurationPlatforms) = postSolution
-		{C261D9ED-85C3-4B35-BE48-7156F5B17430}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{C261D9ED-85C3-4B35-BE48-7156F5B17430}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{C261D9ED-85C3-4B35-BE48-7156F5B17430}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{C261D9ED-85C3-4B35-BE48-7156F5B17430}.Release|Any CPU.Build.0 = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(SolutionProperties) = preSolution
-		HideSolutionNode = FALSE
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/Spring.IoCQuickStart.MovieFinder/src/Spring.IocQuickStart.MovieFinder.2003.csproj b/examples/Spring/Spring.IoCQuickStart.MovieFinder/src/Spring.IocQuickStart.MovieFinder.2003.csproj
deleted file mode 100644
index ee640811..00000000
--- a/examples/Spring/Spring.IoCQuickStart.MovieFinder/src/Spring.IocQuickStart.MovieFinder.2003.csproj
+++ /dev/null
@@ -1,142 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.3077"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{C261D9ED-85C3-4B35-BE48-7156F5B17430}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.IocQuickStart.MovieFinder"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Exe"
-                PreBuildEvent = ""
-                PostBuildEvent = 'echo "Copying movies.txt file for MovieFinder"&#xd;&#xa;copy "$(ProjectDir)MovieFinder\movies.txt" "$(TargetDir)" /y '
-                RootNamespace = "Spring.IocQuickStart"
-                RunPostBuildEvent = "OnOutputUpdated"
-                StartupObject = "Spring.IocQuickStart.MovieFinder.Program"
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\..\bin\net\1.1\debug\Common.Logging.dll"
-                />
-                <Reference
-                    Name = "log4net"
-                    AssemblyName = "log4net"
-                    HintPath = "..\lib\net\1.1\log4net.dll"
-                />
-                <Reference
-                    Name = "Common.Logging.Log4Net"
-                    AssemblyName = "Common.Logging.Log4Net"
-                    HintPath = "..\lib\net\1.1\Common.Logging.Log4Net.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "App.config"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "MovieFinder\AppContext.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "MovieFinder\ColonDelimitedMovieFinder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "MovieFinder\IMovieFinder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "MovieFinder\Movie.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "MovieFinder\MovieLister.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "MovieFinder\movies.txt"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "MovieFinder\Program.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "MovieFinder\SimpleMovieFinder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.IoCQuickStart.MovieFinder/src/Spring.IocQuickStart.MovieFinder.2005.csproj b/examples/Spring/Spring.IoCQuickStart.MovieFinder/src/Spring.IocQuickStart.MovieFinder.2005.csproj
deleted file mode 100644
index 16137bd7..00000000
--- a/examples/Spring/Spring.IoCQuickStart.MovieFinder/src/Spring.IocQuickStart.MovieFinder.2005.csproj
+++ /dev/null
@@ -1,119 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{C261D9ED-85C3-4B35-BE48-7156F5B17430}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.IocQuickStart.MovieFinder</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Exe</OutputType>
-    <RootNamespace>Spring.IocQuickStart</RootNamespace>
-    <RunPostBuildEvent>Always</RunPostBuildEvent>
-    <StartupObject>Spring.IocQuickStart.MovieFinder.Program</StartupObject>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>bin\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>DEBUG;TRACE</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>bin\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=2.1.0.0, Culture=neutral, PublicKeyToken=65e474d141e25e07, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\bin\net\2.0\debug\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="Common.Logging.Log4Net, Version=0.0.0.0, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\lib\net\2.0\Common.Logging.Log4Net.dll</HintPath>
-    </Reference>
-    <Reference Include="log4net, Version=1.2.10.0, Culture=neutral, PublicKeyToken=1b44e1d426115821, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\lib\net\2.0\log4net.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Core, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="System">
-      <Name>System</Name>
-    </Reference>
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="App.config" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="MovieFinder\AppContext.xml" />
-    <EmbeddedResource Include="MovieFinder\AppContextContribution.xml" />
-    <Content Include="MovieFinder\movies.txt" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="MovieFinder\ColonDelimitedMovieFinder.cs" />
-    <Compile Include="MovieFinder\IMovieFinder.cs" />
-    <Compile Include="MovieFinder\Movie.cs" />
-    <Compile Include="MovieFinder\Program.cs" />
-    <Compile Include="MovieFinder\MovieLister.cs" />
-    <Compile Include="MovieFinder\SimpleMovieFinder.cs" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>echo "Copying movies.txt file for MovieFinder"
-copy "$(ProjectDir)MovieFinder\movies.txt" "$(TargetDir)" /y </PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.MsmqQuickStart/Spring.MsmqQuickStart.2005.sln b/examples/Spring/Spring.MsmqQuickStart/Spring.MsmqQuickStart.2005.sln
deleted file mode 100644
index 46083979..00000000
--- a/examples/Spring/Spring.MsmqQuickStart/Spring.MsmqQuickStart.2005.sln
+++ /dev/null
@@ -1,104 +0,0 @@
-
-Microsoft Visual Studio Solution File, Format Version 9.00
-# Visual Studio 2005
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.MsmqQuickStart.Integration.Tests.2005", "test\Spring\Spring.MsmqQuickStart.Integration.Tests\Spring.MsmqQuickStart.Integration.Tests.2005.csproj", "{E641F51F-1B51-4B94-B419-F902EABCE4D4}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.MsmqQuickStart.Tests.2005", "test\Spring\Spring.MsmqQuickStart.Tests\Spring.MsmqQuickStart.Tests.2005.csproj", "{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.MsmqQuickStart.Common", "src\Spring\Spring.MsmqQuickStart.Common\Spring.MsmqQuickStart.Common.csproj", "{AC5A3035-75DD-48E5-ABCA-38FBC8193F22}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.MsmqQuickStart.Server", "src\Spring\Spring.MsmqQuickStart.Server\Spring.MsmqQuickStart.Server.csproj", "{85E7B947-8153-45E4-B572-BEDB191F1FB2}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.MsmqQuickStart.Client", "src\Spring\Spring.MsmqQuickStart.Client\Spring.MsmqQuickStart.Client.csproj", "{87D0B725-A652-4A6B-A95F-197F7155769F}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Core.2005", "..\..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj", "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Aop.2005", "..\..\..\src\Spring\Spring.Aop\Spring.Aop.2005.csproj", "{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.2005", "..\..\..\src\Spring\Spring.Data\Spring.Data.2005.csproj", "{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Messaging.2005", "..\..\..\src\Spring\Spring.Messaging\Spring.Messaging.2005.csproj", "{0E23AE41-D8D8-41C2-84A2-D35564049F0D}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfigurationPlatforms) = preSolution
-		Debug|Any CPU = Debug|Any CPU
-		Release|Any CPU = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(ProjectConfigurationPlatforms) = postSolution
-		{E641F51F-1B51-4B94-B419-F902EABCE4D4}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{E641F51F-1B51-4B94-B419-F902EABCE4D4}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{E641F51F-1B51-4B94-B419-F902EABCE4D4}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{E641F51F-1B51-4B94-B419-F902EABCE4D4}.Release|Any CPU.Build.0 = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Any CPU.Build.0 = Release|Any CPU
-		{AC5A3035-75DD-48E5-ABCA-38FBC8193F22}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{AC5A3035-75DD-48E5-ABCA-38FBC8193F22}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{AC5A3035-75DD-48E5-ABCA-38FBC8193F22}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{AC5A3035-75DD-48E5-ABCA-38FBC8193F22}.Release|Any CPU.Build.0 = Release|Any CPU
-		{85E7B947-8153-45E4-B572-BEDB191F1FB2}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{85E7B947-8153-45E4-B572-BEDB191F1FB2}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{85E7B947-8153-45E4-B572-BEDB191F1FB2}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{85E7B947-8153-45E4-B572-BEDB191F1FB2}.Release|Any CPU.Build.0 = Release|Any CPU
-		{87D0B725-A652-4A6B-A95F-197F7155769F}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{87D0B725-A652-4A6B-A95F-197F7155769F}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{87D0B725-A652-4A6B-A95F-197F7155769F}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{87D0B725-A652-4A6B-A95F-197F7155769F}.Release|Any CPU.Build.0 = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Any CPU.Build.0 = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Any CPU.Build.0 = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Any CPU.Build.0 = Release|Any CPU
-		{0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{0E23AE41-D8D8-41C2-84A2-D35564049F0D}.Release|Any CPU.Build.0 = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(SolutionProperties) = preSolution
-		HideSolutionNode = FALSE
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/Spring.MsmqQuickStart/test/Spring/Spring.MsmqQuickStart.Integration.Tests/Spring.MsmqQuickStart.Integration.Tests.2005.csproj b/examples/Spring/Spring.MsmqQuickStart/test/Spring/Spring.MsmqQuickStart.Integration.Tests/Spring.MsmqQuickStart.Integration.Tests.2005.csproj
deleted file mode 100644
index 3b4b9014..00000000
--- a/examples/Spring/Spring.MsmqQuickStart/test/Spring/Spring.MsmqQuickStart.Integration.Tests/Spring.MsmqQuickStart.Integration.Tests.2005.csproj
+++ /dev/null
@@ -1,44 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{E641F51F-1B51-4B94-B419-F902EABCE4D4}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.MsmqQuickStart.Integration.Tests</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.NmsQuickStart.Integration.Tests\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.NmsQuickStart.Integration.Tests\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="System" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="AssemblyInfo.cs" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.MsmqQuickStart/test/Spring/Spring.MsmqQuickStart.Tests/Spring.MsmqQuickStart.Tests.2005.csproj b/examples/Spring/Spring.MsmqQuickStart/test/Spring/Spring.MsmqQuickStart.Tests/Spring.MsmqQuickStart.Tests.2005.csproj
deleted file mode 100644
index 9209952d..00000000
--- a/examples/Spring/Spring.MsmqQuickStart/test/Spring/Spring.MsmqQuickStart.Tests/Spring.MsmqQuickStart.Tests.2005.csproj
+++ /dev/null
@@ -1,44 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.MsmqQuickStart.Tests</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.NmsQuickStart.Tests\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.NmsQuickStart.Tests\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="System" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="AssemblyInfo.cs" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.NmsQuickStart/Spring.NmsQuickStart.2005.sln b/examples/Spring/Spring.NmsQuickStart/Spring.NmsQuickStart.2005.sln
deleted file mode 100644
index 8816c89e..00000000
--- a/examples/Spring/Spring.NmsQuickStart/Spring.NmsQuickStart.2005.sln
+++ /dev/null
@@ -1,104 +0,0 @@
-
-Microsoft Visual Studio Solution File, Format Version 9.00
-# Visual Studio 2005
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.NmsQuickStart.Integration.Tests.2005", "test\Spring\Spring.NmsQuickStart.Integration.Tests\Spring.NmsQuickStart.Integration.Tests.2005.csproj", "{E641F51F-1B51-4B94-B419-F902EABCE4D4}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.NmsQuickStart.Tests.2005", "test\Spring\Spring.NmsQuickStart.Tests\Spring.NmsQuickStart.Tests.2005.csproj", "{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.NmsQuickStart.Common", "src\Spring\Spring.NmsQuickStart.Common\Spring.NmsQuickStart.Common.csproj", "{AC5A3035-75DD-48E5-ABCA-38FBC8193F22}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.NmsQuickStart.Server", "src\Spring\Spring.NmsQuickStart.Server\Spring.NmsQuickStart.Server.csproj", "{85E7B947-8153-45E4-B572-BEDB191F1FB2}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.NmsQuickStart.Client", "src\Spring\Spring.NmsQuickStart.Client\Spring.NmsQuickStart.Client.csproj", "{87D0B725-A652-4A6B-A95F-197F7155769F}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Core.2005", "..\..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj", "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Aop.2005", "..\..\..\src\Spring\Spring.Aop\Spring.Aop.2005.csproj", "{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Data.2005", "..\..\..\src\Spring\Spring.Data\Spring.Data.2005.csproj", "{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Messaging.Nms.2005", "..\..\..\src\Spring\Spring.Messaging.Nms\Spring.Messaging.Nms.2005.csproj", "{AEB1578C-9018-4D49-B440-789F38DD2F29}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfigurationPlatforms) = preSolution
-		Debug|Any CPU = Debug|Any CPU
-		Release|Any CPU = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(ProjectConfigurationPlatforms) = postSolution
-		{E641F51F-1B51-4B94-B419-F902EABCE4D4}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{E641F51F-1B51-4B94-B419-F902EABCE4D4}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{E641F51F-1B51-4B94-B419-F902EABCE4D4}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{E641F51F-1B51-4B94-B419-F902EABCE4D4}.Release|Any CPU.Build.0 = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Any CPU.Build.0 = Release|Any CPU
-		{AC5A3035-75DD-48E5-ABCA-38FBC8193F22}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{AC5A3035-75DD-48E5-ABCA-38FBC8193F22}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{AC5A3035-75DD-48E5-ABCA-38FBC8193F22}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{AC5A3035-75DD-48E5-ABCA-38FBC8193F22}.Release|Any CPU.Build.0 = Release|Any CPU
-		{85E7B947-8153-45E4-B572-BEDB191F1FB2}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{85E7B947-8153-45E4-B572-BEDB191F1FB2}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{85E7B947-8153-45E4-B572-BEDB191F1FB2}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{85E7B947-8153-45E4-B572-BEDB191F1FB2}.Release|Any CPU.Build.0 = Release|Any CPU
-		{87D0B725-A652-4A6B-A95F-197F7155769F}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{87D0B725-A652-4A6B-A95F-197F7155769F}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{87D0B725-A652-4A6B-A95F-197F7155769F}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{87D0B725-A652-4A6B-A95F-197F7155769F}.Release|Any CPU.Build.0 = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Any CPU.Build.0 = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Any CPU.Build.0 = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}.Release|Any CPU.Build.0 = Release|Any CPU
-		{AEB1578C-9018-4D49-B440-789F38DD2F29}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{AEB1578C-9018-4D49-B440-789F38DD2F29}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{AEB1578C-9018-4D49-B440-789F38DD2F29}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{AEB1578C-9018-4D49-B440-789F38DD2F29}.Release|Any CPU.Build.0 = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(SolutionProperties) = preSolution
-		HideSolutionNode = FALSE
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/Spring.NmsQuickStart/test/Spring/Spring.NmsQuickStart.Integration.Tests/Spring.NmsQuickStart.Integration.Tests.2005.csproj b/examples/Spring/Spring.NmsQuickStart/test/Spring/Spring.NmsQuickStart.Integration.Tests/Spring.NmsQuickStart.Integration.Tests.2005.csproj
deleted file mode 100644
index fd57c389..00000000
--- a/examples/Spring/Spring.NmsQuickStart/test/Spring/Spring.NmsQuickStart.Integration.Tests/Spring.NmsQuickStart.Integration.Tests.2005.csproj
+++ /dev/null
@@ -1,44 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{E641F51F-1B51-4B94-B419-F902EABCE4D4}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.NmsQuickStart.Integration.Tests</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.NmsQuickStart.Integration.Tests\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.NmsQuickStart.Integration.Tests\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="System" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="AssemblyInfo.cs" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.NmsQuickStart/test/Spring/Spring.NmsQuickStart.Tests/Spring.NmsQuickStart.Tests.2005.csproj b/examples/Spring/Spring.NmsQuickStart/test/Spring/Spring.NmsQuickStart.Tests/Spring.NmsQuickStart.Tests.2005.csproj
deleted file mode 100644
index 9375d297..00000000
--- a/examples/Spring/Spring.NmsQuickStart/test/Spring/Spring.NmsQuickStart.Tests/Spring.NmsQuickStart.Tests.2005.csproj
+++ /dev/null
@@ -1,44 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.NmsQuickStart.Tests</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.NmsQuickStart.Tests\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.NmsQuickStart.Tests\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="System" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="AssemblyInfo.cs" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.Scheduling.Quartz.Example/Spring.Scheduling.Quartz.Example.2003.sln b/examples/Spring/Spring.Scheduling.Quartz.Example/Spring.Scheduling.Quartz.Example.2003.sln
deleted file mode 100644
index 14678849..00000000
--- a/examples/Spring/Spring.Scheduling.Quartz.Example/Spring.Scheduling.Quartz.Example.2003.sln
+++ /dev/null
@@ -1,23 +0,0 @@
-Microsoft Visual Studio Solution File, Format Version 8.00
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Scheduling.Quartz.Example.2003", "src\Spring.Scheduling.Quartz.Example.2003.csproj", "{0C0D8C65-90DE-4914-9940-4C684C54971B}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfiguration) = preSolution
-		Debug = Debug
-		Release = Release
-	EndGlobalSection
-	GlobalSection(ProjectDependencies) = postSolution
-	EndGlobalSection
-	GlobalSection(ProjectConfiguration) = postSolution
-		{0C0D8C65-90DE-4914-9940-4C684C54971B}.Debug.ActiveCfg = Debug|.NET
-		{0C0D8C65-90DE-4914-9940-4C684C54971B}.Debug.Build.0 = Debug|.NET
-		{0C0D8C65-90DE-4914-9940-4C684C54971B}.Release.ActiveCfg = Release|.NET
-		{0C0D8C65-90DE-4914-9940-4C684C54971B}.Release.Build.0 = Release|.NET
-	EndGlobalSection
-	GlobalSection(ExtensibilityGlobals) = postSolution
-	EndGlobalSection
-	GlobalSection(ExtensibilityAddIns) = postSolution
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/Spring.Scheduling.Quartz.Example/Spring.Scheduling.Quartz.Example.2005.sln b/examples/Spring/Spring.Scheduling.Quartz.Example/Spring.Scheduling.Quartz.Example.2005.sln
deleted file mode 100644
index 52a7437b..00000000
--- a/examples/Spring/Spring.Scheduling.Quartz.Example/Spring.Scheduling.Quartz.Example.2005.sln
+++ /dev/null
@@ -1,24 +0,0 @@
-
-Microsoft Visual Studio Solution File, Format Version 9.00
-# Visual Studio 2005
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Scheduling.Quartz.Example.2005", "src\Spring.Scheduling.Quartz.Example.2005.csproj", "{0C0D8C65-90DE-4914-9940-4C684C54971B}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfigurationPlatforms) = preSolution
-		Debug|Any CPU = Debug|Any CPU
-		Release|Any CPU = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(ProjectConfigurationPlatforms) = postSolution
-		{0C0D8C65-90DE-4914-9940-4C684C54971B}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{0C0D8C65-90DE-4914-9940-4C684C54971B}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{0C0D8C65-90DE-4914-9940-4C684C54971B}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{0C0D8C65-90DE-4914-9940-4C684C54971B}.Release|Any CPU.Build.0 = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(SolutionProperties) = preSolution
-		HideSolutionNode = FALSE
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/Spring.Scheduling.Quartz.Example/src/Spring.Scheduling.Quartz.Example.2003.csproj b/examples/Spring/Spring.Scheduling.Quartz.Example/src/Spring.Scheduling.Quartz.Example.2003.csproj
deleted file mode 100644
index 094f009f..00000000
--- a/examples/Spring/Spring.Scheduling.Quartz.Example/src/Spring.Scheduling.Quartz.Example.2003.csproj
+++ /dev/null
@@ -1,128 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{0C0D8C65-90DE-4914-9940-4C684C54971B}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Scheduling.Quartz.Example"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Exe"
-                PreBuildEvent = ""
-                PostBuildEvent = "cmd /c copy $(ProjectDir)spring-objects.xml $(OutDir)&#xd;&#xa;cmd /c copy $(ProjectDir)App.config $(OutDir)Spring.Scheduling.Quartz.Example.exe.config"
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = "Spring.Scheduling.Quartz.Example.xml"
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "..\..\..\..\build\VS.NET.2003\Spring.Scheduling.Quartz.Example\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\..\build\VS.NET.2003\Spring.Scheduling.Quartz.Example\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\..\lib\net\1.1\Common.Logging.dll"
-                />
-                <Reference
-                    Name = "Quartz"
-                    AssemblyName = "Quartz"
-                    HintPath = "..\..\..\..\lib\net\1.1\Quartz.dll"
-                />
-                <Reference
-                    Name = "Nullables"
-                    AssemblyName = "Nullables"
-                    HintPath = "..\..\..\..\lib\net\1.1\Nullables.dll"
-                />
-                <Reference
-                    Name = "Spring.Scheduling.Quartz"
-                    AssemblyName = "Spring.Scheduling.Quartz"
-                    HintPath = "..\..\..\..\bin\net\1.1\debug\Spring.Scheduling.Quartz.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AdminService.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "App.config"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "ExampleJob.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Program.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "spring-objects.xml"
-                    BuildAction = "Content"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.Scheduling.Quartz.Example/src/Spring.Scheduling.Quartz.Example.2005.csproj b/examples/Spring/Spring.Scheduling.Quartz.Example/src/Spring.Scheduling.Quartz.Example.2005.csproj
deleted file mode 100644
index df2f751d..00000000
--- a/examples/Spring/Spring.Scheduling.Quartz.Example/src/Spring.Scheduling.Quartz.Example.2005.csproj
+++ /dev/null
@@ -1,116 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{0C0D8C65-90DE-4914-9940-4C684C54971B}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.Scheduling.Quartz.Example</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Exe</OutputType>
-    <RootNamespace>Spring</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>..\..\..\..\build\VS.NET.2005\Spring.Scheduling.Quartz.Example\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>DEBUG;TRACE</DefineConstants>
-    <DocumentationFile>Spring.Scheduling.Quartz.Example.xml</DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>..\..\..\..\build\VS.NET.2005\Spring.Scheduling.Quartz.Example\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging">
-      <Name>Common.Logging</Name>
-      <HintPath>..\..\..\..\lib\net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="Quartz">
-      <Name>Quartz</Name>
-      <HintPath>..\..\..\..\lib\net\2.0\Quartz.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Core">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Scheduling.Quartz, Version=1.1.2.20220, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\bin\net\2.0\debug\Spring.Scheduling.Quartz.dll</HintPath>
-    </Reference>
-    <Reference Include="System">
-      <Name>System</Name>
-    </Reference>
-  </ItemGroup>
-  <ItemGroup>
-    <Content Include="App.config" />
-    <Content Include="spring-objects.xml">
-      <CopyToOutputDirectory>Always</CopyToOutputDirectory>
-    </Content>
-    <Compile Include="AdminService.cs" />
-    <Compile Include="ExampleJob.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Program.cs">
-      <SubType>Code</SubType>
-    </Compile>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>
-    </PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.TxQuickStart/Spring.TxQuickStart.2003.sln b/examples/Spring/Spring.TxQuickStart/Spring.TxQuickStart.2003.sln
deleted file mode 100644
index c6153c7c..00000000
--- a/examples/Spring/Spring.TxQuickStart/Spring.TxQuickStart.2003.sln
+++ /dev/null
@@ -1,41 +0,0 @@
-Microsoft Visual Studio Solution File, Format Version 8.00
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.TxQuickStart.2003", "src\Spring\Spring.TxQuickStart\Spring.TxQuickStart.2003.csproj", "{B3C676F7-52DA-41D7-953C-38C9E62FFDF6}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.TxQuickStart.Tests.2003", "test\Spring\Spring.TxQuickStart.Tests\Spring.TxQuickStart.Tests.2003.csproj", "{026EED0B-267B-4518-AD3B-B3D4291CC2F8}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfiguration) = preSolution
-		Debug = Debug
-		Debug-1.1 = Debug-1.1
-		Release = Release
-		Release-1.1 = Release-1.1
-	EndGlobalSection
-	GlobalSection(ProjectDependencies) = postSolution
-	EndGlobalSection
-	GlobalSection(ProjectConfiguration) = postSolution
-		{B3C676F7-52DA-41D7-953C-38C9E62FFDF6}.Debug.ActiveCfg = Debug|.NET
-		{B3C676F7-52DA-41D7-953C-38C9E62FFDF6}.Debug.Build.0 = Debug|.NET
-		{B3C676F7-52DA-41D7-953C-38C9E62FFDF6}.Debug-1.1.ActiveCfg = Debug|.NET
-		{B3C676F7-52DA-41D7-953C-38C9E62FFDF6}.Debug-1.1.Build.0 = Debug|.NET
-		{B3C676F7-52DA-41D7-953C-38C9E62FFDF6}.Release.ActiveCfg = Release|.NET
-		{B3C676F7-52DA-41D7-953C-38C9E62FFDF6}.Release.Build.0 = Release|.NET
-		{B3C676F7-52DA-41D7-953C-38C9E62FFDF6}.Release-1.1.ActiveCfg = Release|.NET
-		{B3C676F7-52DA-41D7-953C-38C9E62FFDF6}.Release-1.1.Build.0 = Release|.NET
-		{026EED0B-267B-4518-AD3B-B3D4291CC2F8}.Debug.ActiveCfg = Debug|.NET
-		{026EED0B-267B-4518-AD3B-B3D4291CC2F8}.Debug.Build.0 = Debug|.NET
-		{026EED0B-267B-4518-AD3B-B3D4291CC2F8}.Debug-1.1.ActiveCfg = Debug|.NET
-		{026EED0B-267B-4518-AD3B-B3D4291CC2F8}.Debug-1.1.Build.0 = Debug|.NET
-		{026EED0B-267B-4518-AD3B-B3D4291CC2F8}.Release.ActiveCfg = Release|.NET
-		{026EED0B-267B-4518-AD3B-B3D4291CC2F8}.Release.Build.0 = Release|.NET
-		{026EED0B-267B-4518-AD3B-B3D4291CC2F8}.Release-1.1.ActiveCfg = Release|.NET
-		{026EED0B-267B-4518-AD3B-B3D4291CC2F8}.Release-1.1.Build.0 = Release|.NET
-	EndGlobalSection
-	GlobalSection(ExtensibilityGlobals) = postSolution
-	EndGlobalSection
-	GlobalSection(ExtensibilityAddIns) = postSolution
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/Spring.TxQuickStart/Spring.TxQuickStart.2005.sln b/examples/Spring/Spring.TxQuickStart/Spring.TxQuickStart.2005.sln
deleted file mode 100644
index 82fa5f6d..00000000
--- a/examples/Spring/Spring.TxQuickStart/Spring.TxQuickStart.2005.sln
+++ /dev/null
@@ -1,26 +0,0 @@
-
-Microsoft Visual Studio Solution File, Format Version 9.00
-# Visual Studio 2005
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.TxQuickStart.2005", "src\Spring\Spring.TxQuickStart\Spring.TxQuickStart.2005.csproj", "{EDDC48D5-4F25-4476-9BA3-12F2E8BB5A8C}"
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.TxQuickStart.Tests.2005", "test\Spring\Spring.TxQuickStart.Tests\Spring.TxQuickStart.Tests.2005.csproj", "{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}"
-EndProject
-Global
-	GlobalSection(SolutionConfigurationPlatforms) = preSolution
-		Debug|Any CPU = Debug|Any CPU
-		Release|Any CPU = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(ProjectConfigurationPlatforms) = postSolution
-		{EDDC48D5-4F25-4476-9BA3-12F2E8BB5A8C}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{EDDC48D5-4F25-4476-9BA3-12F2E8BB5A8C}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{EDDC48D5-4F25-4476-9BA3-12F2E8BB5A8C}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{EDDC48D5-4F25-4476-9BA3-12F2E8BB5A8C}.Release|Any CPU.Build.0 = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}.Release|Any CPU.Build.0 = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(SolutionProperties) = preSolution
-		HideSolutionNode = FALSE
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/Spring.TxQuickStart/src/Spring/Spring.TxQuickStart/Spring.TxQuickStart.2003.csproj b/examples/Spring/Spring.TxQuickStart/src/Spring/Spring.TxQuickStart/Spring.TxQuickStart.2003.csproj
deleted file mode 100644
index 7d21df98..00000000
--- a/examples/Spring/Spring.TxQuickStart/src/Spring/Spring.TxQuickStart/Spring.TxQuickStart.2003.csproj
+++ /dev/null
@@ -1,138 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{B3C676F7-52DA-41D7-953C-38C9E62FFDF6}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.TxQuickStart"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = "Spring.TxQuickStart.xml"
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "1"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "Spring.Data"
-                    AssemblyName = "Spring.Data"
-                    HintPath = "..\..\..\..\..\..\bin\net\1.1\debug\Spring.Data.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "TxQuickStart\application-config.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "TxQuickStart\CreditsDebitsSchema.sql"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "TxQuickStart\Dao\IAccountCreditDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "TxQuickStart\Dao\IAccountDebitDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "TxQuickStart\Dao\Ado\AccountCreditDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "TxQuickStart\Dao\Ado\AccountDebitDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "TxQuickStart\Services\AccountManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "TxQuickStart\Services\IAccountManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.TxQuickStart/src/Spring/Spring.TxQuickStart/Spring.TxQuickStart.2005.csproj b/examples/Spring/Spring.TxQuickStart/src/Spring/Spring.TxQuickStart/Spring.TxQuickStart.2005.csproj
deleted file mode 100644
index f57f59bb..00000000
--- a/examples/Spring/Spring.TxQuickStart/src/Spring/Spring.TxQuickStart/Spring.TxQuickStart.2005.csproj
+++ /dev/null
@@ -1,73 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{EDDC48D5-4F25-4476-9BA3-12F2E8BB5A8C}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.TxQuickStart</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>bin\Debug\</OutputPath>
-    <DefineConstants>DEBUG;TRACE</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-    <DocumentationFile>
-    </DocumentationFile>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>bin\Release\</OutputPath>
-    <DefineConstants>TRACE</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=1.1.0.2, Culture=neutral, PublicKeyToken=65e474d141e25e07, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\..\bin\net\2.0\debug\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Aop, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\..\bin\net\2.0\debug\Spring.Aop.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Core, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Data, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\..\bin\net\2.0\debug\Spring.Data.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="TxQuickStart\Dao\Ado\AccountCreditDao.cs" />
-    <Compile Include="TxQuickStart\Dao\Ado\AccountDebitDao.cs" />
-    <Compile Include="TxQuickStart\Services\AccountManager.cs" />
-    <Compile Include="TxQuickStart\Dao\IAccountCreditDao.cs" />
-    <Compile Include="TxQuickStart\Dao\IAccountDebitDao.cs" />
-    <Compile Include="TxQuickStart\Services\IAccountManager.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="TxQuickStart\application-config.xml" />
-    <Content Include="TxQuickStart\CreditsDebitsSchema.sql" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.TxQuickStart/test/Spring/Spring.TxQuickStart.Tests/Spring.TxQuickStart.Tests.2003.csproj b/examples/Spring/Spring.TxQuickStart/test/Spring/Spring.TxQuickStart.Tests/Spring.TxQuickStart.Tests.2003.csproj
deleted file mode 100644
index f8874be9..00000000
--- a/examples/Spring/Spring.TxQuickStart/test/Spring/Spring.TxQuickStart.Tests/Spring.TxQuickStart.Tests.2003.csproj
+++ /dev/null
@@ -1,166 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{026EED0B-267B-4518-AD3B-B3D4291CC2F8}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.TxQuickStart.Tests"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = 'echo copy /y  "$(ProjectDir)Spring.TxQuickStart.Tests.dll.config" "$(TargetDir)Spring.TxQuickStart.Tests.dll.config"&#xd;&#xa;copy /y  "$(ProjectDir)Spring.TxQuickStart.Tests.dll.config" "$(TargetDir)Spring.TxQuickStart.Tests.dll.config"'
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "Spring.TxQuickStart.2003"
-                    Project = "{B3C676F7-52DA-41D7-953C-38C9E62FFDF6}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "nunit.framework"
-                    AssemblyName = "nunit.framework"
-                    HintPath = "..\..\..\..\..\..\lib\Net\1.1\nunit.framework.dll"
-                />
-                <Reference
-                    Name = "Common.Logging.Log4Net"
-                    AssemblyName = "Common.Logging.Log4Net"
-                    HintPath = "..\..\..\..\..\..\lib\Net\1.1\Common.Logging.Log4Net.dll"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\..\..\..\lib\Net\1.1\Common.Logging.dll"
-                />
-                <Reference
-                    Name = "Spring.Data"
-                    AssemblyName = "Spring.Data"
-                    HintPath = "..\..\..\..\..\..\bin\net\1.1\debug\Spring.Data.dll"
-                />
-                <Reference
-                    Name = "Spring.Aop"
-                    AssemblyName = "Spring.Aop"
-                    HintPath = "..\..\..\..\..\..\bin\net\1.1\debug\Spring.Aop.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Spring.TxQuickStart.Tests.dll.config"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "TxQuickStart\AccountManagerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "TxQuickStart\aspects-config.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "TxQuickStart\system-test-dtc-es-config.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "TxQuickStart\system-test-local-config.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "TxQuickStart\Services\AccountManagerUnitTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "TxQuickStart\Services\StubAccountCreditDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "TxQuickStart\Services\StubAccountDebitDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/Spring.TxQuickStart/test/Spring/Spring.TxQuickStart.Tests/Spring.TxQuickStart.Tests.2005.csproj b/examples/Spring/Spring.TxQuickStart/test/Spring/Spring.TxQuickStart.Tests/Spring.TxQuickStart.Tests.2005.csproj
deleted file mode 100644
index e5775b4d..00000000
--- a/examples/Spring/Spring.TxQuickStart/test/Spring/Spring.TxQuickStart.Tests/Spring.TxQuickStart.Tests.2005.csproj
+++ /dev/null
@@ -1,98 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.TxQuickStart.Tests</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>bin\Debug\</OutputPath>
-    <DefineConstants>DEBUG;TRACE</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>bin\Release\</OutputPath>
-    <DefineConstants>TRACE</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=1.1.0.2, Culture=neutral, PublicKeyToken=65e474d141e25e07, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\..\bin\net\2.0\debug\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="Common.Logging.Log4Net, Version=1.2.0.2, Culture=neutral, PublicKeyToken=af08829b84f0328e, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\..\lib\Net\2.0\Common.Logging.Log4Net.dll</HintPath>
-    </Reference>
-    <Reference Include="log4net, Version=1.2.10.0, Culture=neutral, PublicKeyToken=1b44e1d426115821, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\..\lib\Net\2.0\log4net.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.framework, Version=2.2.8.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\..\lib\Net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Aop, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\..\bin\net\2.0\debug\Spring.Aop.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Core, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Data, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\..\bin\net\2.0\debug\Spring.Data.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.TxQuickStart\Spring.TxQuickStart.2005.csproj">
-      <Project>{EDDC48D5-4F25-4476-9BA3-12F2E8BB5A8C}</Project>
-      <Name>Spring.TxQuickStart.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="TxQuickStart\system-test-local-config.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="TxQuickStart\AccountManagerTests.cs" />
-    <Compile Include="TxQuickStart\Services\AccountManagerUnitTests.cs" />
-    <Compile Include="TxQuickStart\Services\StubAccountCreditDao.cs" />
-    <Compile Include="TxQuickStart\Services\StubAccountDebitDao.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="Spring.TxQuickStart.Tests.dll.config">
-      <CopyToOutputDirectory>Always</CopyToOutputDirectory>
-    </None>
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="TxQuickStart\aspects-config.xml" />
-    <EmbeddedResource Include="TxQuickStart\system-test-dtc-config.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="TxQuickStart\system-test-dtc-es-config.xml" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/Spring.Web.Extensions.Example/Spring.Web.Extensions.Example.2005.sln b/examples/Spring/Spring.Web.Extensions.Example/Spring.Web.Extensions.Example.2005.sln
deleted file mode 100644
index dd4c233e..00000000
--- a/examples/Spring/Spring.Web.Extensions.Example/Spring.Web.Extensions.Example.2005.sln
+++ /dev/null
@@ -1,48 +0,0 @@
-
-Microsoft Visual Studio Solution File, Format Version 9.00
-# Visual Studio 2005
-Project("{E24C65DC-7377-472B-9ABA-BC803B73C61A}") = "L:\...\Spring.Web.Extensions.Example.2005\", "src\Spring.Web.Extensions.Example.2005\", "{DE2A587C-01A4-49E2-A3CD-664B293A8A6F}"
-	ProjectSection(WebsiteProperties) = preProject
-		ProjectReferences = ""
-		Debug.AspNetCompiler.VirtualPath = "/Spring.Web.Extensions.Example.2005"
-		Debug.AspNetCompiler.PhysicalPath = "src\Spring.Web.Extensions.Example.2005\"
-		Debug.AspNetCompiler.TargetPath = "PrecompiledWeb\Spring.Web.Extensions.Example.2005\"
-		Debug.AspNetCompiler.Updateable = "true"
-		Debug.AspNetCompiler.ForceOverwrite = "true"
-		Debug.AspNetCompiler.FixedNames = "false"
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.VirtualPath = "/Spring.Web.Extensions.Example.2005"
-		Release.AspNetCompiler.PhysicalPath = "src\Spring.Web.Extensions.Example.2005\"
-		Release.AspNetCompiler.TargetPath = "PrecompiledWeb\Spring.Web.Extensions.Example.2005\"
-		Release.AspNetCompiler.Updateable = "true"
-		Release.AspNetCompiler.ForceOverwrite = "true"
-		Release.AspNetCompiler.FixedNames = "false"
-		Release.AspNetCompiler.Debug = "False"
-		VWDPort = "3792"
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfigurationPlatforms) = preSolution
-		Debug|.NET = Debug|.NET
-		Debug|Any CPU = Debug|Any CPU
-		Debug|Mixed Platforms = Debug|Mixed Platforms
-		Release|.NET = Release|.NET
-		Release|Any CPU = Release|Any CPU
-		Release|Mixed Platforms = Release|Mixed Platforms
-	EndGlobalSection
-	GlobalSection(ProjectConfigurationPlatforms) = postSolution
-		{DE2A587C-01A4-49E2-A3CD-664B293A8A6F}.Debug|.NET.ActiveCfg = Debug|.NET
-		{DE2A587C-01A4-49E2-A3CD-664B293A8A6F}.Debug|.NET.Build.0 = Debug|.NET
-		{DE2A587C-01A4-49E2-A3CD-664B293A8A6F}.Debug|Any CPU.ActiveCfg = Debug|.NET
-		{DE2A587C-01A4-49E2-A3CD-664B293A8A6F}.Debug|Mixed Platforms.ActiveCfg = Debug|.NET
-		{DE2A587C-01A4-49E2-A3CD-664B293A8A6F}.Debug|Mixed Platforms.Build.0 = Debug|.NET
-		{DE2A587C-01A4-49E2-A3CD-664B293A8A6F}.Release|.NET.ActiveCfg = Debug|.NET
-		{DE2A587C-01A4-49E2-A3CD-664B293A8A6F}.Release|.NET.Build.0 = Debug|.NET
-		{DE2A587C-01A4-49E2-A3CD-664B293A8A6F}.Release|Any CPU.ActiveCfg = Debug|.NET
-		{DE2A587C-01A4-49E2-A3CD-664B293A8A6F}.Release|Mixed Platforms.ActiveCfg = Debug|.NET
-		{DE2A587C-01A4-49E2-A3CD-664B293A8A6F}.Release|Mixed Platforms.Build.0 = Debug|.NET
-	EndGlobalSection
-	GlobalSection(SolutionProperties) = preSolution
-		HideSolutionNode = FALSE
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/Spring.WebQuickStart/Spring.WebQuickStart.2005.sln b/examples/Spring/Spring.WebQuickStart/Spring.WebQuickStart.2005.sln
deleted file mode 100644
index 5ac8977a..00000000
--- a/examples/Spring/Spring.WebQuickStart/Spring.WebQuickStart.2005.sln
+++ /dev/null
@@ -1,159 +0,0 @@
-
-Microsoft Visual Studio Solution File, Format Version 9.00
-# Visual Studio 2005
-Project("{E24C65DC-7377-472B-9ABA-BC803B73C61A}") = "L:\...\Spring.WebQuickStart.2005\", "src\Spring.WebQuickStart.2005\", "{B4F56253-6425-4065-8A93-EF88F8730E57}"
-	ProjectSection(WebsiteProperties) = preProject
-		ProjectReferences = "{BA4789EB-281A-48EA-8763-28B9F0596A18}|Spring.Web.dll;"
-		Debug.AspNetCompiler.VirtualPath = "/Spring.WebQuickStart.2005"
-		Debug.AspNetCompiler.PhysicalPath = "Spring.WebQuickStart.2005\"
-		Debug.AspNetCompiler.TargetPath = "PrecompiledWeb\Spring.WebQuickStart.2005\"
-		Debug.AspNetCompiler.Updateable = "true"
-		Debug.AspNetCompiler.ForceOverwrite = "true"
-		Debug.AspNetCompiler.FixedNames = "false"
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.VirtualPath = "/Spring.WebQuickStart.2005"
-		Release.AspNetCompiler.PhysicalPath = "Spring.WebQuickStart.2005\"
-		Release.AspNetCompiler.TargetPath = "PrecompiledWeb\Spring.WebQuickStart.2005\"
-		Release.AspNetCompiler.Updateable = "true"
-		Release.AspNetCompiler.ForceOverwrite = "true"
-		Release.AspNetCompiler.FixedNames = "false"
-		Release.AspNetCompiler.Debug = "False"
-		VWDPort = "4112"
-		DefaultWebSiteLanguage = "Visual C#"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Web.2005", "..\..\..\src\Spring\Spring.Web\Spring.Web.2005.csproj", "{BA4789EB-281A-48EA-8763-28B9F0596A18}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Core.2005", "..\..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj", "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Core.Tests.2005", "..\..\..\test\Spring\Spring.Core.Tests\Spring.Core.Tests.2005.csproj", "{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{E24C65DC-7377-472B-9ABA-BC803B73C61A}") = "L:\...\Spring.WebQuickStart.Providers\", "src\Spring.WebQuickStart.Providers\", "{F42A333D-D305-4649-8B5A-6F5862F0F62A}"
-	ProjectSection(WebsiteProperties) = preProject
-		ProjectReferences = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}|Spring.Core.dll;{BA4789EB-281A-48EA-8763-28B9F0596A18}|Spring.Web.dll;"
-		Debug.AspNetCompiler.VirtualPath = "/Spring.WebQuickStart.Providers"
-		Debug.AspNetCompiler.PhysicalPath = "src\Spring.WebQuickStart.Providers\"
-		Debug.AspNetCompiler.TargetPath = "PrecompiledWeb\Spring.WebQuickStart.Providers\"
-		Debug.AspNetCompiler.Updateable = "true"
-		Debug.AspNetCompiler.ForceOverwrite = "true"
-		Debug.AspNetCompiler.FixedNames = "false"
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.VirtualPath = "/Spring.WebQuickStart.Providers"
-		Release.AspNetCompiler.PhysicalPath = "src\Spring.WebQuickStart.Providers\"
-		Release.AspNetCompiler.TargetPath = "PrecompiledWeb\Spring.WebQuickStart.Providers\"
-		Release.AspNetCompiler.Updateable = "true"
-		Release.AspNetCompiler.ForceOverwrite = "true"
-		Release.AspNetCompiler.FixedNames = "false"
-		Release.AspNetCompiler.Debug = "False"
-		VWDPort = "4828"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Web.Tests.2005", "..\..\..\test\Spring\Spring.Web.Tests\Spring.Web.Tests.2005.csproj", "{C67E47AA-1ACD-41B4-A465-4D336A2319CA}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "Spring.Aop.2005", "..\..\..\src\Spring\Spring.Aop\Spring.Aop.2005.csproj", "{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfigurationPlatforms) = preSolution
-		Debug|.NET = Debug|.NET
-		Debug|Any CPU = Debug|Any CPU
-		Debug|Mixed Platforms = Debug|Mixed Platforms
-		Release|.NET = Release|.NET
-		Release|Any CPU = Release|Any CPU
-		Release|Mixed Platforms = Release|Mixed Platforms
-	EndGlobalSection
-	GlobalSection(ProjectConfigurationPlatforms) = postSolution
-		{B4F56253-6425-4065-8A93-EF88F8730E57}.Debug|.NET.ActiveCfg = Debug|.NET
-		{B4F56253-6425-4065-8A93-EF88F8730E57}.Debug|.NET.Build.0 = Debug|.NET
-		{B4F56253-6425-4065-8A93-EF88F8730E57}.Debug|Any CPU.ActiveCfg = Debug|.NET
-		{B4F56253-6425-4065-8A93-EF88F8730E57}.Debug|Mixed Platforms.ActiveCfg = Debug|.NET
-		{B4F56253-6425-4065-8A93-EF88F8730E57}.Debug|Mixed Platforms.Build.0 = Debug|.NET
-		{B4F56253-6425-4065-8A93-EF88F8730E57}.Release|.NET.ActiveCfg = Debug|.NET
-		{B4F56253-6425-4065-8A93-EF88F8730E57}.Release|.NET.Build.0 = Debug|.NET
-		{B4F56253-6425-4065-8A93-EF88F8730E57}.Release|Any CPU.ActiveCfg = Debug|.NET
-		{B4F56253-6425-4065-8A93-EF88F8730E57}.Release|Mixed Platforms.ActiveCfg = Debug|.NET
-		{B4F56253-6425-4065-8A93-EF88F8730E57}.Release|Mixed Platforms.Build.0 = Debug|.NET
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Release|.NET.ActiveCfg = Release|Any CPU
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Release|Any CPU.Build.0 = Release|Any CPU
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{BA4789EB-281A-48EA-8763-28B9F0596A18}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|.NET.ActiveCfg = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Any CPU.Build.0 = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{710961A3-0DF4-49E4-A26E-F5B9C044AC84}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|.NET.ActiveCfg = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Any CPU.Build.0 = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{F42A333D-D305-4649-8B5A-6F5862F0F62A}.Debug|.NET.ActiveCfg = Debug|.NET
-		{F42A333D-D305-4649-8B5A-6F5862F0F62A}.Debug|.NET.Build.0 = Debug|.NET
-		{F42A333D-D305-4649-8B5A-6F5862F0F62A}.Debug|Any CPU.ActiveCfg = Debug|.NET
-		{F42A333D-D305-4649-8B5A-6F5862F0F62A}.Debug|Mixed Platforms.ActiveCfg = Debug|.NET
-		{F42A333D-D305-4649-8B5A-6F5862F0F62A}.Debug|Mixed Platforms.Build.0 = Debug|.NET
-		{F42A333D-D305-4649-8B5A-6F5862F0F62A}.Release|.NET.ActiveCfg = Debug|.NET
-		{F42A333D-D305-4649-8B5A-6F5862F0F62A}.Release|.NET.Build.0 = Debug|.NET
-		{F42A333D-D305-4649-8B5A-6F5862F0F62A}.Release|Any CPU.ActiveCfg = Debug|.NET
-		{F42A333D-D305-4649-8B5A-6F5862F0F62A}.Release|Mixed Platforms.ActiveCfg = Debug|.NET
-		{F42A333D-D305-4649-8B5A-6F5862F0F62A}.Release|Mixed Platforms.Build.0 = Debug|.NET
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Release|.NET.ActiveCfg = Release|Any CPU
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Release|Any CPU.Build.0 = Release|Any CPU
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{C67E47AA-1ACD-41B4-A465-4D336A2319CA}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|.NET.ActiveCfg = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Any CPU.Build.0 = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(SolutionProperties) = preSolution
-		HideSolutionNode = FALSE
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/SpringAir/SpringAir.2003.sln b/examples/Spring/SpringAir/SpringAir.2003.sln
deleted file mode 100644
index f3681514..00000000
--- a/examples/Spring/SpringAir/SpringAir.2003.sln
+++ /dev/null
@@ -1,53 +0,0 @@
-Microsoft Visual Studio Solution File, Format Version 8.00
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "SpringAir.Core.2003", "src\SpringAir.Core\SpringAir.Core.2003.csproj", "{5E3427D8-62FC-483F-A86B-B44A79A46BCC}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "SpringAir.Core.Tests.2003", "test\SpringAir.Core.Tests\SpringAir.Core.Tests.2003.csproj", "{BB9AFE5E-7785-43AC-86ED-CF0A073F006E}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "SpringAir.Data.Ado.2003", "src\SpringAir.Data.Ado\SpringAir.Data.Ado.2003.csproj", "{78B285FE-27F3-44F4-84B1-7A589AB48EF3}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "SpringAir.Web.2003", "http://localhost/SpringAir.2003/SpringAir.Web.2003.csproj", "{B29E702D-DC32-42B4-8A15-AC7C07CFC48D}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "SpringAir.Data.Ado.Tests.2003", "test\SpringAir.Data.Ado.Tests\SpringAir.Data.Ado.Tests.2003.csproj", "{B0A6F98E-5363-4575-BB6B-A84E91895468}"
-	ProjectSection(ProjectDependencies) = postProject
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfiguration) = preSolution
-		Debug = Debug
-		Release = Release
-	EndGlobalSection
-	GlobalSection(ProjectConfiguration) = postSolution
-		{5E3427D8-62FC-483F-A86B-B44A79A46BCC}.Debug.ActiveCfg = Debug|.NET
-		{5E3427D8-62FC-483F-A86B-B44A79A46BCC}.Debug.Build.0 = Debug|.NET
-		{5E3427D8-62FC-483F-A86B-B44A79A46BCC}.Release.ActiveCfg = Release|.NET
-		{5E3427D8-62FC-483F-A86B-B44A79A46BCC}.Release.Build.0 = Release|.NET
-		{BB9AFE5E-7785-43AC-86ED-CF0A073F006E}.Debug.ActiveCfg = Debug|.NET
-		{BB9AFE5E-7785-43AC-86ED-CF0A073F006E}.Debug.Build.0 = Debug|.NET
-		{BB9AFE5E-7785-43AC-86ED-CF0A073F006E}.Release.ActiveCfg = Release|.NET
-		{BB9AFE5E-7785-43AC-86ED-CF0A073F006E}.Release.Build.0 = Release|.NET
-		{78B285FE-27F3-44F4-84B1-7A589AB48EF3}.Debug.ActiveCfg = Debug|.NET
-		{78B285FE-27F3-44F4-84B1-7A589AB48EF3}.Debug.Build.0 = Debug|.NET
-		{78B285FE-27F3-44F4-84B1-7A589AB48EF3}.Release.ActiveCfg = Release|.NET
-		{78B285FE-27F3-44F4-84B1-7A589AB48EF3}.Release.Build.0 = Release|.NET
-		{B29E702D-DC32-42B4-8A15-AC7C07CFC48D}.Debug.ActiveCfg = Debug|.NET
-		{B29E702D-DC32-42B4-8A15-AC7C07CFC48D}.Debug.Build.0 = Debug|.NET
-		{B29E702D-DC32-42B4-8A15-AC7C07CFC48D}.Release.ActiveCfg = Release|.NET
-		{B29E702D-DC32-42B4-8A15-AC7C07CFC48D}.Release.Build.0 = Release|.NET
-		{B0A6F98E-5363-4575-BB6B-A84E91895468}.Debug.ActiveCfg = Debug|.NET
-		{B0A6F98E-5363-4575-BB6B-A84E91895468}.Debug.Build.0 = Debug|.NET
-		{B0A6F98E-5363-4575-BB6B-A84E91895468}.Release.ActiveCfg = Release|.NET
-		{B0A6F98E-5363-4575-BB6B-A84E91895468}.Release.Build.0 = Release|.NET
-	EndGlobalSection
-	GlobalSection(ExtensibilityGlobals) = postSolution
-	EndGlobalSection
-	GlobalSection(ExtensibilityAddIns) = postSolution
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/SpringAir/SpringAir.2005.sln b/examples/Spring/SpringAir/SpringAir.2005.sln
deleted file mode 100644
index 7e02c9af..00000000
--- a/examples/Spring/SpringAir/SpringAir.2005.sln
+++ /dev/null
@@ -1,129 +0,0 @@
-
-Microsoft Visual Studio Solution File, Format Version 9.00
-# Visual Studio 2005
-Project("{E24C65DC-7377-472B-9ABA-BC803B73C61A}") = "D:\...\SpringAir.Web.2005\", "src\SpringAir.Web.2005\", "{839602F5-8077-497D-9CCB-C9F02741CA55}"
-	ProjectSection(WebsiteProperties) = preProject
-		ProjectReferences = "{5E3427D8-62FC-483F-A86B-B44A79A46BCC}|SpringAir.Core.dll;{78B285FE-27F3-44F4-84B1-7A589AB48EF3}|SpringAir.Data.Ado.dll;{0925F8C7-B2AB-4DD7-AF6D-10DD028C5910}|SpringAir.Web.2005.References.dll;"
-		Debug.AspNetCompiler.VirtualPath = "/SpringAir.Web.2005"
-		Debug.AspNetCompiler.PhysicalPath = "src\SpringAir.Web.2005\"
-		Debug.AspNetCompiler.TargetPath = "PrecompiledWeb\SpringAir.Web.2005\"
-		Debug.AspNetCompiler.Updateable = "true"
-		Debug.AspNetCompiler.ForceOverwrite = "true"
-		Debug.AspNetCompiler.FixedNames = "false"
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.VirtualPath = "/SpringAir.Web.2005"
-		Release.AspNetCompiler.PhysicalPath = "src\SpringAir.Web.2005\"
-		Release.AspNetCompiler.TargetPath = "PrecompiledWeb\SpringAir.Web.2005\"
-		Release.AspNetCompiler.Updateable = "true"
-		Release.AspNetCompiler.ForceOverwrite = "true"
-		Release.AspNetCompiler.FixedNames = "false"
-		Release.AspNetCompiler.Debug = "False"
-		VWDPort = "4816"
-		DefaultWebSiteLanguage = "Visual C#"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "SpringAir.Core.2005", "src\SpringAir.Core\SpringAir.Core.2005.csproj", "{5E3427D8-62FC-483F-A86B-B44A79A46BCC}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "SpringAir.Core.Tests.2005", "test\SpringAir.Core.Tests\SpringAir.Core.Tests.2005.csproj", "{BB9AFE5E-7785-43AC-86ED-CF0A073F006E}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "SpringAir.Data.Ado.2005", "src\SpringAir.Data.Ado\SpringAir.Data.Ado.2005.csproj", "{78B285FE-27F3-44F4-84B1-7A589AB48EF3}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "SpringAir.Data.Ado.Tests.2005", "test\SpringAir.Data.Ado.Tests\SpringAir.Data.Ado.Tests.2005.csproj", "{B0A6F98E-5363-4575-BB6B-A84E91895468}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Project("{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}") = "SpringAir.Web.2005.References", "src\SpringAir.Web.2005.References\SpringAir.Web.2005.References.csproj", "{0925F8C7-B2AB-4DD7-AF6D-10DD028C5910}"
-	ProjectSection(WebsiteProperties) = preProject
-		Debug.AspNetCompiler.Debug = "True"
-		Release.AspNetCompiler.Debug = "False"
-	EndProjectSection
-EndProject
-Global
-	GlobalSection(SolutionConfigurationPlatforms) = preSolution
-		Debug|.NET = Debug|.NET
-		Debug|Any CPU = Debug|Any CPU
-		Debug|Mixed Platforms = Debug|Mixed Platforms
-		Release|.NET = Release|.NET
-		Release|Any CPU = Release|Any CPU
-		Release|Mixed Platforms = Release|Mixed Platforms
-	EndGlobalSection
-	GlobalSection(ProjectConfigurationPlatforms) = postSolution
-		{839602F5-8077-497D-9CCB-C9F02741CA55}.Debug|.NET.ActiveCfg = Debug|.NET
-		{839602F5-8077-497D-9CCB-C9F02741CA55}.Debug|.NET.Build.0 = Debug|.NET
-		{839602F5-8077-497D-9CCB-C9F02741CA55}.Debug|Any CPU.ActiveCfg = Debug|.NET
-		{839602F5-8077-497D-9CCB-C9F02741CA55}.Debug|Mixed Platforms.ActiveCfg = Debug|.NET
-		{839602F5-8077-497D-9CCB-C9F02741CA55}.Debug|Mixed Platforms.Build.0 = Debug|.NET
-		{839602F5-8077-497D-9CCB-C9F02741CA55}.Release|.NET.ActiveCfg = Debug|.NET
-		{839602F5-8077-497D-9CCB-C9F02741CA55}.Release|.NET.Build.0 = Debug|.NET
-		{839602F5-8077-497D-9CCB-C9F02741CA55}.Release|Any CPU.ActiveCfg = Debug|.NET
-		{839602F5-8077-497D-9CCB-C9F02741CA55}.Release|Mixed Platforms.ActiveCfg = Debug|.NET
-		{839602F5-8077-497D-9CCB-C9F02741CA55}.Release|Mixed Platforms.Build.0 = Debug|.NET
-		{5E3427D8-62FC-483F-A86B-B44A79A46BCC}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{5E3427D8-62FC-483F-A86B-B44A79A46BCC}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{5E3427D8-62FC-483F-A86B-B44A79A46BCC}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{5E3427D8-62FC-483F-A86B-B44A79A46BCC}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{5E3427D8-62FC-483F-A86B-B44A79A46BCC}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{5E3427D8-62FC-483F-A86B-B44A79A46BCC}.Release|.NET.ActiveCfg = Release|Any CPU
-		{5E3427D8-62FC-483F-A86B-B44A79A46BCC}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{5E3427D8-62FC-483F-A86B-B44A79A46BCC}.Release|Any CPU.Build.0 = Release|Any CPU
-		{5E3427D8-62FC-483F-A86B-B44A79A46BCC}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{5E3427D8-62FC-483F-A86B-B44A79A46BCC}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{BB9AFE5E-7785-43AC-86ED-CF0A073F006E}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{BB9AFE5E-7785-43AC-86ED-CF0A073F006E}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{BB9AFE5E-7785-43AC-86ED-CF0A073F006E}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{BB9AFE5E-7785-43AC-86ED-CF0A073F006E}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{BB9AFE5E-7785-43AC-86ED-CF0A073F006E}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{BB9AFE5E-7785-43AC-86ED-CF0A073F006E}.Release|.NET.ActiveCfg = Release|Any CPU
-		{BB9AFE5E-7785-43AC-86ED-CF0A073F006E}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{BB9AFE5E-7785-43AC-86ED-CF0A073F006E}.Release|Any CPU.Build.0 = Release|Any CPU
-		{BB9AFE5E-7785-43AC-86ED-CF0A073F006E}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{BB9AFE5E-7785-43AC-86ED-CF0A073F006E}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{78B285FE-27F3-44F4-84B1-7A589AB48EF3}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{78B285FE-27F3-44F4-84B1-7A589AB48EF3}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{78B285FE-27F3-44F4-84B1-7A589AB48EF3}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{78B285FE-27F3-44F4-84B1-7A589AB48EF3}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{78B285FE-27F3-44F4-84B1-7A589AB48EF3}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{78B285FE-27F3-44F4-84B1-7A589AB48EF3}.Release|.NET.ActiveCfg = Release|Any CPU
-		{78B285FE-27F3-44F4-84B1-7A589AB48EF3}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{78B285FE-27F3-44F4-84B1-7A589AB48EF3}.Release|Any CPU.Build.0 = Release|Any CPU
-		{78B285FE-27F3-44F4-84B1-7A589AB48EF3}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{78B285FE-27F3-44F4-84B1-7A589AB48EF3}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{B0A6F98E-5363-4575-BB6B-A84E91895468}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{B0A6F98E-5363-4575-BB6B-A84E91895468}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{B0A6F98E-5363-4575-BB6B-A84E91895468}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{B0A6F98E-5363-4575-BB6B-A84E91895468}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{B0A6F98E-5363-4575-BB6B-A84E91895468}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{B0A6F98E-5363-4575-BB6B-A84E91895468}.Release|.NET.ActiveCfg = Release|Any CPU
-		{B0A6F98E-5363-4575-BB6B-A84E91895468}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{B0A6F98E-5363-4575-BB6B-A84E91895468}.Release|Any CPU.Build.0 = Release|Any CPU
-		{B0A6F98E-5363-4575-BB6B-A84E91895468}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{B0A6F98E-5363-4575-BB6B-A84E91895468}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-		{0925F8C7-B2AB-4DD7-AF6D-10DD028C5910}.Debug|.NET.ActiveCfg = Debug|Any CPU
-		{0925F8C7-B2AB-4DD7-AF6D-10DD028C5910}.Debug|Any CPU.ActiveCfg = Debug|Any CPU
-		{0925F8C7-B2AB-4DD7-AF6D-10DD028C5910}.Debug|Any CPU.Build.0 = Debug|Any CPU
-		{0925F8C7-B2AB-4DD7-AF6D-10DD028C5910}.Debug|Mixed Platforms.ActiveCfg = Debug|Any CPU
-		{0925F8C7-B2AB-4DD7-AF6D-10DD028C5910}.Debug|Mixed Platforms.Build.0 = Debug|Any CPU
-		{0925F8C7-B2AB-4DD7-AF6D-10DD028C5910}.Release|.NET.ActiveCfg = Release|Any CPU
-		{0925F8C7-B2AB-4DD7-AF6D-10DD028C5910}.Release|Any CPU.ActiveCfg = Release|Any CPU
-		{0925F8C7-B2AB-4DD7-AF6D-10DD028C5910}.Release|Any CPU.Build.0 = Release|Any CPU
-		{0925F8C7-B2AB-4DD7-AF6D-10DD028C5910}.Release|Mixed Platforms.ActiveCfg = Release|Any CPU
-		{0925F8C7-B2AB-4DD7-AF6D-10DD028C5910}.Release|Mixed Platforms.Build.0 = Release|Any CPU
-	EndGlobalSection
-	GlobalSection(SolutionProperties) = preSolution
-		HideSolutionNode = FALSE
-	EndGlobalSection
-EndGlobal
diff --git a/examples/Spring/SpringAir/src/SpringAir.Core/SpringAir.Core.2003.csproj b/examples/Spring/SpringAir/src/SpringAir.Core/SpringAir.Core.2003.csproj
deleted file mode 100644
index 8228a2a2..00000000
--- a/examples/Spring/SpringAir/src/SpringAir.Core/SpringAir.Core.2003.csproj
+++ /dev/null
@@ -1,224 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{5E3427D8-62FC-483F-A86B-B44A79A46BCC}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "SpringAir.Core"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "SpringAir"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "SpringAir.Core.build"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Data\IAircraftDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\IAirportDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\IFlightDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\Aircraft.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\Airport.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\AirportCollection.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\Cabin.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\CabinClass.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\Entity.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\Flight.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\FlightCollection.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\FlightSuggestions.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\Itinerary.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\Passenger.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\Reservation.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\ReservationConfirmation.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\Seat.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\TimeRange.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\Trip.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\TripMode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\TripPoint.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Service\CannotConfirmReservationException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Service\DefaultBookingAgent.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Service\IBookingAgent.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/SpringAir/src/SpringAir.Core/SpringAir.Core.2005.csproj b/examples/Spring/SpringAir/src/SpringAir.Core/SpringAir.Core.2005.csproj
deleted file mode 100644
index e5430cbc..00000000
--- a/examples/Spring/SpringAir/src/SpringAir.Core/SpringAir.Core.2005.csproj
+++ /dev/null
@@ -1,170 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{5E3427D8-62FC-483F-A86B-B44A79A46BCC}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>SpringAir.Core</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Library</OutputType>
-    <RootNamespace>SpringAir</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>bin\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>bin\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Spring.Core, Version=1.1.1.20001, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="System">
-      <Name>System</Name>
-    </Reference>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="AssemblyInfo.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Data\IAircraftDao.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Data\IAirportDao.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Data\IFlightDao.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\Aircraft.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\Airport.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\AirportCollection.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\Cabin.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\CabinClass.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\Entity.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\Flight.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\FlightCollection.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\FlightSuggestions.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\Itinerary.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\Passenger.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\Reservation.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\ReservationConfirmation.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\Seat.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\TimeRange.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\Trip.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\TripMode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\TripPoint.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Service\CannotConfirmReservationException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Service\DefaultBookingAgent.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Service\IBookingAgent.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <None Include="SpringAir.Core.build" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>
-    </PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/SpringAir/src/SpringAir.Data.Ado/SpringAir.Data.Ado.2003.csproj b/examples/Spring/SpringAir/src/SpringAir.Data.Ado/SpringAir.Data.Ado.2003.csproj
deleted file mode 100644
index 1e435b9b..00000000
--- a/examples/Spring/SpringAir/src/SpringAir.Data.Ado/SpringAir.Data.Ado.2003.csproj
+++ /dev/null
@@ -1,139 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.3077"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{78B285FE-27F3-44F4-84B1-7A589AB48EF3}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "SpringAir.Data.Ado"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "SpringAir"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "..\..\..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "..\..\..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "..\..\..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "SpringAir.Core.2003"
-                    Project = "{5E3427D8-62FC-483F-A86B-B44A79A46BCC}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Data"
-                    AssemblyName = "Spring.Data"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Data.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "SpringAir.Data.Ado.build"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Data\Ado\AircraftDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Ado\AircraftMapper.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Ado\AirportDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Ado\AirportMapper.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Ado\FlightDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/SpringAir/src/SpringAir.Data.Ado/SpringAir.Data.Ado.2005.csproj b/examples/Spring/SpringAir/src/SpringAir.Data.Ado/SpringAir.Data.Ado.2005.csproj
deleted file mode 100644
index 5a8e881b..00000000
--- a/examples/Spring/SpringAir/src/SpringAir.Data.Ado/SpringAir.Data.Ado.2005.csproj
+++ /dev/null
@@ -1,129 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{78B285FE-27F3-44F4-84B1-7A589AB48EF3}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>SpringAir.Data.Ado</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Library</OutputType>
-    <RootNamespace>SpringAir</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>bin\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>bin\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Spring.Core, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Data, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Data.dll</HintPath>
-    </Reference>
-    <Reference Include="System">
-      <Name>System</Name>
-    </Reference>
-    <Reference Include="System.Data">
-      <Name>System.Data</Name>
-    </Reference>
-    <Reference Include="System.Xml">
-      <Name>System.XML</Name>
-    </Reference>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="AssemblyInfo.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Data\Ado\AircraftDao.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Data\Ado\AircraftMapper.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Data\Ado\AirportDao.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Data\Ado\AirportMapper.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Data\Ado\FlightDao.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <None Include="SpringAir.Data.Ado.build" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\SpringAir.Core\SpringAir.Core.2005.csproj">
-      <Project>{5E3427D8-62FC-483F-A86B-B44A79A46BCC}</Project>
-      <Name>SpringAir.Core.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>
-    </PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/SpringAir/src/SpringAir.Web.2003/SpringAir.Web.2003.csproj b/examples/Spring/SpringAir/src/SpringAir.Web.2003/SpringAir.Web.2003.csproj
deleted file mode 100644
index 7ea0e450..00000000
--- a/examples/Spring/SpringAir/src/SpringAir.Web.2003/SpringAir.Web.2003.csproj
+++ /dev/null
@@ -1,636 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Web"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{B29E702D-DC32-42B4-8A15-AC7C07CFC48D}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "SpringAir.Web"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "SpringAir"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "..\..\..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Drawing"
-                    AssemblyName = "System.Drawing"
-                    HintPath = "..\..\..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Drawing.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "..\..\..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.Web"
-                    AssemblyName = "System.Web"
-                    HintPath = "..\..\..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Web.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "..\..\..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "SpringAir.Core.2003"
-                    Project = "{5E3427D8-62FC-483F-A86B-B44A79A46BCC}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "SpringAir.Data.Ado.2003"
-                    Project = "{78B285FE-27F3-44F4-84B1-7A589AB48EF3}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\..\..\lib\Net\1.1\Common.Logging.dll"
-                />
-                <Reference
-                    Name = "Spring.Web"
-                    AssemblyName = "Spring.Web"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Web.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Constants.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Global.asax"
-                    SubType = "Component"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Global.asax.cs"
-                    DependentUpon = "Global.asax"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Global.asax.resx"
-                    DependentUpon = "Global.asax.cs"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "SpringAir.Web.build"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Web.config"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Config\Aspects.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Config\Log4Net.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Config\Services.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Config\Web.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Config\Production\Dao.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Config\Production\Services.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Config\Test\Dao.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Config\Test\Services.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Resources\Strings.en.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\Strings.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\Strings.sr-SP-Cyrl.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\Strings.sr-SP-Latn.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\calendar.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\calendar-blue.css"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\calendar-blue2.css"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\calendar-brown.css"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\calendar-green.css"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\calendar-setup.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\calendar-system.css"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\calendar-tas.css"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\calendar-win2k-1.css"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\calendar-win2k-2.css"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\calendar-win2k-cold-1.css"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\calendar-win2k-cold-2.css"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\img.gif"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-af.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-al.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-bg.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-big5.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-big5-utf8.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-br.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-ca.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-cs-utf8.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-cs-win.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-da.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-de.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-du.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-el.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-en.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-en-US.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-es.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-fi.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-fr.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-he-utf8.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-hr.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-hr-utf8.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-hu.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-it.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-jp.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-ko.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-ko-utf8.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-lt.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-lt-utf8.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-lv.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-nl.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-no.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-pl.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-pl-utf8.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-pt.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-ro.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-ru.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-ru_win_.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-si.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-sk.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-sp.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-sr-SP-Cyrl.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-sr-SP-Latn.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-sv.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-tr.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\calendar-zh.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Scripts\Calendar\lang\cn_utf8.js"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\Home.aspx"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\Home.aspx.cs"
-                    DependentUpon = "Home.aspx"
-                    SubType = "ASPXCodeBehind"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Home.aspx.resx"
-                    DependentUpon = "Home.aspx.cs"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Web\StandardTemplate.ascx"
-                    SubType = "Form"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\StandardTemplate.ascx.cs"
-                    DependentUpon = "StandardTemplate.ascx"
-                    SubType = "ASPXCodeBehind"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\StandardTemplate.ascx.resx"
-                    DependentUpon = "StandardTemplate.ascx.cs"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Web\Web.config"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\BookTrip\ReservationConfirmationPage.aspx"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\BookTrip\ReservationConfirmationPage.aspx.cs"
-                    DependentUpon = "ReservationConfirmationPage.aspx"
-                    SubType = "ASPXCodeBehind"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\BookTrip\ReservationConfirmationPage.aspx.resx"
-                    DependentUpon = "ReservationConfirmationPage.aspx.cs"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Web\BookTrip\ReservationConfirmationPage.en.resx"
-                    DependentUpon = "ReservationConfirmationPage.aspx.cs"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Web\BookTrip\ReservationConfirmationPage.sr-SP-Cyrl.resx"
-                    DependentUpon = "ReservationConfirmationPage.aspx.cs"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Web\BookTrip\ReservationConfirmationPage.sr-SP-Latn.resx"
-                    DependentUpon = "ReservationConfirmationPage.aspx.cs"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Web\BookTrip\SuggestedFlights.aspx"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\BookTrip\SuggestedFlights.aspx.cs"
-                    DependentUpon = "SuggestedFlights.aspx"
-                    SubType = "ASPXCodeBehind"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\BookTrip\SuggestedFlights.aspx.resx"
-                    DependentUpon = "SuggestedFlights.aspx.cs"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Web\BookTrip\SuggestedFlights.en.resx"
-                    DependentUpon = "SuggestedFlights.aspx.cs"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Web\BookTrip\SuggestedFlights.sr-SP-Cyrl.resx"
-                    DependentUpon = "SuggestedFlights.aspx.cs"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Web\BookTrip\SuggestedFlights.sr-SP-Latn.resx"
-                    DependentUpon = "SuggestedFlights.aspx.cs"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Web\BookTrip\TripForm.aspx"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\BookTrip\TripForm.aspx.cs"
-                    DependentUpon = "TripForm.aspx"
-                    SubType = "ASPXCodeBehind"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\BookTrip\TripForm.aspx.resx"
-                    DependentUpon = "TripForm.aspx.cs"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Web\BookTrip\TripForm.en.resx"
-                    DependentUpon = "TripForm.aspx.cs"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Web\BookTrip\TripForm.sr-SP-Cyrl.resx"
-                    DependentUpon = "TripForm.aspx.cs"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Web\BookTrip\TripForm.sr-SP-Latn.resx"
-                    DependentUpon = "TripForm.aspx.cs"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Web\BookTrip\Web.config"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\CSS\default.css"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\Images\calendar-1.gif"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\Images\calendar-2.gif"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\Images\line.jpg"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\Images\panel-bottom-left.gif"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\Images\panel-bottom-middle.gif"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\Images\panel-bottom-right.gif"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\Images\panel-left-middle.gif"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\Images\panel-right-middle.gif"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\Images\panel-top-left.gif"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\Images\panel-top-middle.gif"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\Images\panel-top-right.gif"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\Images\spring-air-logo.jpg"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\Images\en\spring-air-logo.jpg"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\Images\sr-SP-Cyrl\spring-air-logo.jpg"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Web\Images\sr-SP-Latn\spring-air-logo.jpg"
-                    BuildAction = "Content"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/SpringAir/test/SpringAir.Core.Tests/SpringAir.Core.Tests.2003.csproj b/examples/Spring/SpringAir/test/SpringAir.Core.Tests/SpringAir.Core.Tests.2003.csproj
deleted file mode 100644
index 33189840..00000000
--- a/examples/Spring/SpringAir/test/SpringAir.Core.Tests/SpringAir.Core.Tests.2003.csproj
+++ /dev/null
@@ -1,149 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.3077"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{BB9AFE5E-7785-43AC-86ED-CF0A073F006E}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "SpringAir.Core.Tests"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "SpringAir"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "DotNetMock"
-                    AssemblyName = "DotNetMock"
-                    HintPath = "..\..\..\..\..\lib\Net\1.1\DotNetMock.dll"
-                />
-                <Reference
-                    Name = "nunit.framework"
-                    AssemblyName = "nunit.framework"
-                    HintPath = "..\..\..\..\..\lib\Net\1.1\nunit.framework.dll"
-                />
-                <Reference
-                    Name = "SpringAir.Core.2003"
-                    Project = "{5E3427D8-62FC-483F-A86B-B44A79A46BCC}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "SpringAir.Core.Tests.build"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Domain\FlightCollectionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\FlightSuggestionsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\FlightTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\ReservationConfirmationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Domain\TimeRangeTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Service\BookingAgentIntegrationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Service\DefaultBookingAgentIntegrationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/SpringAir/test/SpringAir.Core.Tests/SpringAir.Core.Tests.2005.csproj b/examples/Spring/SpringAir/test/SpringAir.Core.Tests/SpringAir.Core.Tests.2005.csproj
deleted file mode 100644
index 2b877fe7..00000000
--- a/examples/Spring/SpringAir/test/SpringAir.Core.Tests/SpringAir.Core.Tests.2005.csproj
+++ /dev/null
@@ -1,130 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{BB9AFE5E-7785-43AC-86ED-CF0A073F006E}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>SpringAir.Core.Tests</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Library</OutputType>
-    <RootNamespace>SpringAir</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>bin\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>bin\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="DotNetMock, Version=0.7.4.0, Culture=neutral, PublicKeyToken=805ea88df19095f6">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\lib\Net\2.0\DotNetMock.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.framework, Version=2.2.7.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\lib\Net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="System">
-      <Name>System</Name>
-    </Reference>
-    <Reference Include="System.XML" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="AssemblyInfo.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\FlightCollectionTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\FlightSuggestionsTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\FlightTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\ReservationConfirmationTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Domain\TimeRangeTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Service\BookingAgentIntegrationTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Service\DefaultBookingAgentIntegrationTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <None Include="SpringAir.Core.Tests.build" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\..\src\SpringAir.Core\SpringAir.Core.2005.csproj">
-      <Project>{5E3427D8-62FC-483F-A86B-B44A79A46BCC}</Project>
-      <Name>SpringAir.Core.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>
-    </PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/examples/Spring/SpringAir/test/SpringAir.Data.Ado.Tests/SpringAir.Data.Ado.Tests.2003.csproj b/examples/Spring/SpringAir/test/SpringAir.Data.Ado.Tests/SpringAir.Data.Ado.Tests.2003.csproj
deleted file mode 100644
index ae26cc6f..00000000
--- a/examples/Spring/SpringAir/test/SpringAir.Data.Ado.Tests/SpringAir.Data.Ado.Tests.2003.csproj
+++ /dev/null
@@ -1,144 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.3077"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{B0A6F98E-5363-4575-BB6B-A84E91895468}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "SpringAir.Data.Ado.Tests"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "SpringAir"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "..\..\..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "..\..\..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "..\..\..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "SpringAir.Data.Ado.2003"
-                    Project = "{78B285FE-27F3-44F4-84B1-7A589AB48EF3}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "SpringAir.Core.2003"
-                    Project = "{5E3427D8-62FC-483F-A86B-B44A79A46BCC}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "nunit.framework"
-                    AssemblyName = "nunit.framework"
-                    HintPath = "..\..\..\..\..\lib\Net\1.1\nunit.framework.dll"
-                />
-                <Reference
-                    Name = "DotNetMock"
-                    AssemblyName = "DotNetMock"
-                    HintPath = "..\..\..\..\..\lib\Net\1.1\DotNetMock.dll"
-                />
-                <Reference
-                    Name = "Spring.Data"
-                    AssemblyName = "Spring.Data"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Data.dll"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\..\..\bin\net\1.1\debug\Spring.Core.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "SpringAir.Data.Ado.Tests.build"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Data\Ado\AircraftDaoTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Ado\AirportDaoTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Ado\FlightDaoTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/examples/Spring/SpringAir/test/SpringAir.Data.Ado.Tests/SpringAir.Data.Ado.Tests.2005.csproj b/examples/Spring/SpringAir/test/SpringAir.Data.Ado.Tests/SpringAir.Data.Ado.Tests.2005.csproj
deleted file mode 100644
index 4ba3e73e..00000000
--- a/examples/Spring/SpringAir/test/SpringAir.Data.Ado.Tests/SpringAir.Data.Ado.Tests.2005.csproj
+++ /dev/null
@@ -1,135 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{B0A6F98E-5363-4575-BB6B-A84E91895468}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>SpringAir.Data.Ado.Tests</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Library</OutputType>
-    <RootNamespace>SpringAir</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>bin\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>bin\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="DotNetMock, Version=0.7.4.0, Culture=neutral, PublicKeyToken=805ea88df19095f6">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\lib\Net\2.0\DotNetMock.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.framework, Version=2.2.7.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\lib\Net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Core, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="Spring.Data, Version=1.1.0.2, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\..\..\bin\net\2.0\debug\Spring.Data.dll</HintPath>
-    </Reference>
-    <Reference Include="System">
-      <Name>System</Name>
-    </Reference>
-    <Reference Include="System.Data">
-      <Name>System.Data</Name>
-    </Reference>
-    <Reference Include="System.Xml">
-      <Name>System.XML</Name>
-    </Reference>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="AssemblyInfo.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Data\Ado\AircraftDaoTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Data\Ado\AirportDaoTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Data\Ado\FlightDaoTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <None Include="SpringAir.Data.Ado.Tests.build" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\..\src\SpringAir.Core\SpringAir.Core.2005.csproj">
-      <Project>{5E3427D8-62FC-483F-A86B-B44A79A46BCC}</Project>
-      <Name>SpringAir.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\src\SpringAir.Data.Ado\SpringAir.Data.Ado.2005.csproj">
-      <Project>{78B285FE-27F3-44F4-84B1-7A589AB48EF3}</Project>
-      <Name>SpringAir.Data.Ado.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>
-    </PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/src/Spring/Spring.Aop/Spring.Aop.2002.csproj b/src/Spring/Spring.Aop/Spring.Aop.2002.csproj
deleted file mode 100644
index 5b8f1249..00000000
--- a/src/Spring/Spring.Aop/Spring.Aop.2002.csproj
+++ /dev/null
@@ -1,785 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.0.9955"
-        SchemaVersion = "1.0"
-        ProjectGuid = "{828F16E3-20A4-4EC4-A8F4-CD95B8ED44C9}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Aop"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                RootNamespace = "Spring"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;NET_1_0"
-                    DocumentationFile = "Spring.Aop.xml"
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.Net.2002\Spring.Aop\Debug-1.0\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "3"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.Net.2002\Spring.Aop\Release-1.0\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.0.3705\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.0.3705\System.XML.dll"
-                />
-                <Reference
-                    Name = "system.web"
-                    AssemblyName = "System.Web"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.0.3705\system.web.dll"
-                />
-                <Reference
-                    Name = "System.Drawing"
-                    AssemblyName = "System.Drawing"
-                    HintPath = "..\..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.0.3705\System.Drawing.dll"
-                />
-                <Reference
-                    Name = "antlr.runtime"
-                    AssemblyName = "antlr.runtime"
-                    HintPath = "..\..\..\lib\Net\1.0\antlr.runtime.dll"
-                />
-                <Reference
-                    Name = "Spring.Core.2002"
-                    Project = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\lib\Net\1.0\Common.Logging.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\IAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\IAdvisors.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\IAfterReturningAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\IBeforeAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\IIntroductionAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\IIntroductionInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\IMethodBeforeAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\IMethodMatcher.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\IPointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\IPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\ITargetSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\IThrowsAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\ITypeFilter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\TrueMethodMatcher.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\TruePointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\TrueTypeFilter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Config\AopNamespaceParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Config\AopNamespaceUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Config\ConfigObjectDefinitionParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Config\spring-aop-1.1.xsd"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Aop\Framework\AbstractMethodInvocation.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AdvisedSupport.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AdvisorChainFactoryUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AopConfigException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AopContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AopUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicMethodInvocation.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\HashtableCachingAdvisorChainFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\IAdvised.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\IAdvisedSupportListener.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\IAdvisorChainFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\IAopProxy.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\IAopProxyFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\InterceptorAndDynamicMethodMatcher.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\ITargetAware.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\ProxyConfig.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\ProxyFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\ProxyFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\ReflectiveMethodInvocation.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\AdvisorAdapterRegistrationManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\AfterReturningAdviceAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\AfterReturningAdviceInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\BeforeAdviceAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\DefaultAdvisorAdapterRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\GlobalAdvisorAdapterRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\IAdvisorAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\IAdvisorAdapterRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\MethodBeforeAdviceInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\ThrowsAdviceAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\ThrowsAdviceInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\UnknownAdviceTypeException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\AbstractAdvisorAutoProxyCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\AbstractAutoProxyCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\DefaultAdvisorAutoProxyCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\ITargetSourceCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\ObjectNameAutoProxyCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\Target\AbstractPrototypeTargetSourceCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\AbstractAopProxyMethodBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\AbstractAopProxyTypeBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\AdvisedProxy.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\BaseCompositionAopProxy.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\CompositionAopProxyTypeBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\DecoratorAopProxyTypeBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\IAdvisedProxyMethodBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\IAopProxyTypeGenerator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\IntroductionProxyMethodBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\TargetAopProxyMethodBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\AbstractGenericPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\AbstractObjectFactoryPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\AbstractPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\AbstractRegularExpressionMethodPointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\AttributeMatchMethodPointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\AttributeMatchMethodPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\ComposablePointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\ControlFlowPointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\DefaultIntroductionAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\DefaultObjectFactoryPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\DefaultPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\DynamicMethodMatcher.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\DynamicMethodMatcherPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\MethodMatchers.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\NameMatchMethodPointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\NameMatchMethodPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\Pointcuts.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\RegularExpressionMethodPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\RootTypeFilter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\SdkRegularExpressionMethodPointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\StaticMethodMatcher.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\StaticMethodMatcherPointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\StaticMethodMatcherPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\TypeFilters.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\UnionPointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\.cvsignore"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Aop\Target\AbstractPoolingTargetSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\AbstractPrototypeTargetSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\EmptyTargetSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\HotSwappableTargetSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\IThreadLocalTargetSourceStats.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\PoolingConfig.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\PrototypeTargetSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\SimplePoolTargetSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\SingletonTargetSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\ThreadLocalTargetSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AopAlliance\Aop\AspectException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AopAlliance\Aop\IAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AopAlliance\Intercept\IConstructorInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AopAlliance\Intercept\IConstructorInvocation.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AopAlliance\Intercept\IInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AopAlliance\Intercept\IInvocation.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AopAlliance\Intercept\IJoinpoint.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AopAlliance\Intercept\IMethodInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AopAlliance\Intercept\IMethodInvocation.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\AbstractExceptionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\AbstractExceptionHandlerAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\IExceptionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\ParsedAdviceExpression.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\RetryAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\RetryExceptionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\BaseCacheAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\CacheAspect.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\CacheParameterAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\CacheParameterAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\CacheResultAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\CacheResultAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\InvalidateCacheAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\InvalidateCacheAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Exceptions\ExceptionHandlerAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Exceptions\LogExceptionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Exceptions\ReturnValueExceptionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Exceptions\SwallowExceptionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Exceptions\TranslationExceptionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Logging\AbstractLoggingAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Logging\SimpleLoggingAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Validation\ParameterValidationAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Validation\ParameterValidationAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/src/Spring/Spring.Aop/Spring.Aop.2003.csproj b/src/Spring/Spring.Aop/Spring.Aop.2003.csproj
deleted file mode 100644
index 191e9400..00000000
--- a/src/Spring/Spring.Aop/Spring.Aop.2003.csproj
+++ /dev/null
@@ -1,955 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Aop"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;NET_1_1;DEBUG_DYNAMIC"
-                    DocumentationFile = "Spring.Aop.xml"
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Aop\Debug-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "true"
-                    WarningLevel = "1"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Aop\Release-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\lib\Net\1.1\Common.Logging.dll"
-                />
-                <Reference
-                    Name = "Spring.Core.2003"
-                    Project = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "CommonAssemblyInfo.cs"
-                    Link = "..\CommonAssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Spring.Aop.build"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Aop\IAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\IAdvisors.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\IAfterReturningAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\IBeforeAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\IIntroductionAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\IIntroductionInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\IMethodBeforeAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\IMethodMatcher.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\IPointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\IPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\ITargetSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\IThrowsAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\ITypeFilter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\TrueMethodMatcher.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\TruePointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\TrueTypeFilter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Config\AopNamespaceParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Config\AopNamespaceUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Config\ConfigObjectDefinitionParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Config\spring-aop-1.1.xsd"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Aop\Framework\AbstractMethodInvocation.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AdvisedSupport.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AdvisorChainFactoryUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AopConfigException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AopContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AopUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicMethodInvocation.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\HashtableCachingAdvisorChainFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\IAdvised.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\IAdvisedSupportListener.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\IAdvisorChainFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\IAopProxy.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\IAopProxyFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\InterceptorAndDynamicMethodMatcher.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\ITargetAware.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\ProxyConfig.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\ProxyFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\ProxyFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\ReflectiveMethodInvocation.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\AdvisorAdapterRegistrationManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\AfterReturningAdviceAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\AfterReturningAdviceInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\BeforeAdviceAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\DefaultAdvisorAdapterRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\GlobalAdvisorAdapterRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\IAdvisorAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\IAdvisorAdapterRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\MethodBeforeAdviceInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\ThrowsAdviceAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\ThrowsAdviceInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\UnknownAdviceTypeException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\AbstractAdvisorAutoProxyCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\AbstractAutoProxyCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\AbstractFilteringAutoProxyCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\AttributeAutoProxyCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\DefaultAdvisorAutoProxyCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\IAdvisorRetrievalHelper.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\InfrastructureAdvisorAutoProxyCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\InheritanceBasedAopConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\ITargetSourceCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\ObjectFactoryAdvisorRetrievalHelper.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\ObjectNameAutoProxyCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\PointcutFilteringAutoProxyCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\TypeNameAutoProxyCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\.svn\all-wcprops"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\.svn\entries"
-                    BuildAction = "None"
-                />
-                <Folder RelPath = "Aop\Framework\AutoProxy\.svn\prop-base\" />
-                <Folder RelPath = "Aop\Framework\AutoProxy\.svn\props\" />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\.svn\text-base\AbstractAdvisorAutoProxyCreator.cs.svn-base"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\.svn\text-base\AbstractAutoProxyCreator.cs.svn-base"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\.svn\text-base\AbstractFilteringAutoProxyCreator.cs.svn-base"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\.svn\text-base\AttributeAutoProxyCreator.cs.svn-base"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\.svn\text-base\DefaultAdvisorAutoProxyCreator.cs.svn-base"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\.svn\text-base\IAdvisorRetrievalHelper.cs.svn-base"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\.svn\text-base\InfrastructureAdvisorAutoProxyCreator.cs.svn-base"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\.svn\text-base\InheritanceBasedAopConfigurer.cs.svn-base"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\.svn\text-base\ITargetSourceCreator.cs.svn-base"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\.svn\text-base\ObjectFactoryAdvisorRetrievalHelper.cs.svn-base"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\.svn\text-base\ObjectNameAutoProxyCreator.cs.svn-base"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\.svn\text-base\PointcutFilteringAutoProxyCreator.cs.svn-base"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\.svn\text-base\TypeNameAutoProxyCreator.cs.svn-base"
-                    BuildAction = "None"
-                />
-                <Folder RelPath = "Aop\Framework\AutoProxy\.svn\tmp\prop-base\" />
-                <Folder RelPath = "Aop\Framework\AutoProxy\.svn\tmp\props\" />
-                <Folder RelPath = "Aop\Framework\AutoProxy\.svn\tmp\text-base\" />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\Target\AbstractPrototypeTargetSourceCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\Target\.svn\all-wcprops"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\Target\.svn\entries"
-                    BuildAction = "None"
-                />
-                <Folder RelPath = "Aop\Framework\AutoProxy\Target\.svn\prop-base\" />
-                <Folder RelPath = "Aop\Framework\AutoProxy\Target\.svn\props\" />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\Target\.svn\text-base\AbstractPrototypeTargetSourceCreator.cs.svn-base"
-                    BuildAction = "None"
-                />
-                <Folder RelPath = "Aop\Framework\AutoProxy\Target\.svn\tmp\prop-base\" />
-                <Folder RelPath = "Aop\Framework\AutoProxy\Target\.svn\tmp\props\" />
-                <Folder RelPath = "Aop\Framework\AutoProxy\Target\.svn\tmp\text-base\" />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\AbstractAopProxyFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\AbstractAopProxyMethodBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\AbstractAopProxyTypeBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\AdvisedProxy.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\BaseAopProxyMethodBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\BaseCompositionAopProxy.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\CachedAopProxyFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\CompositionAopProxyTypeBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\DecoratorAopProxyTypeBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\DefaultAopProxyFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\IAdvisedProxyMethodBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\IAopProxyTypeGenerator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\InheritanceAopProxyTypeBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\IntroductionProxyMethodBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\TargetAopProxyMethodBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\AbstractGenericPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\AbstractObjectFactoryPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\AbstractPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\AbstractRegularExpressionMethodPointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\AttributeMatchingPointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\AttributeMatchMethodPointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\AttributeMatchMethodPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\AttributeMethodMatcher.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\AttributeTypeFilter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\ComposablePointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\ControlFlowPointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\DefaultIntroductionAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\DefaultObjectFactoryPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\DefaultPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\DynamicMethodMatcher.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\DynamicMethodMatcherPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\MethodMatchers.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\NameMatchMethodPointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\NameMatchMethodPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\Pointcuts.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\RegularExpressionMethodPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\RootTypeFilter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\SdkRegularExpressionMethodPointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\StaticMethodMatcher.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\StaticMethodMatcherPointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\StaticMethodMatcherPointcutAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\TypeFilters.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\TypeNameTypeFilter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\UnionPointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\AbstractPoolingTargetSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\AbstractPrototypeTargetSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\EmptyTargetSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\HotSwappableTargetSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\IThreadLocalTargetSourceStats.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\PoolingConfig.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\PrototypeTargetSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\SimplePoolTargetSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\SingletonTargetSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\ThreadLocalTargetSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AopAlliance\Aop\AspectException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AopAlliance\Aop\IAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AopAlliance\Intercept\IConstructorInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AopAlliance\Intercept\IConstructorInvocation.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AopAlliance\Intercept\IInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AopAlliance\Intercept\IInvocation.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AopAlliance\Intercept\IJoinpoint.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AopAlliance\Intercept\IMethodInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AopAlliance\Intercept\IMethodInvocation.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\AbstractExceptionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\AbstractExceptionHandlerAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\IExceptionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\ParsedAdviceExpression.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\RetryAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\RetryExceptionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\BaseCacheAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\CacheAspect.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\CacheParameterAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\CacheParameterAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\CacheResultAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\CacheResultAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\InvalidateCacheAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\InvalidateCacheAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Exceptions\ExceptionHandlerAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Exceptions\ExecuteSpelExceptionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Exceptions\LogExceptionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Exceptions\ReturnValueExceptionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Exceptions\SwallowExceptionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Exceptions\TranslationExceptionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Logging\AbstractLoggingAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Logging\SimpleLoggingAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Validation\ParameterValidationAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Validation\ParameterValidationAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/src/Spring/Spring.Aop/Spring.Aop.2005.csproj b/src/Spring/Spring.Aop/Spring.Aop.2005.csproj
deleted file mode 100644
index f7a41dbb..00000000
--- a/src/Spring/Spring.Aop/Spring.Aop.2005.csproj
+++ /dev/null
@@ -1,442 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003" ToolsVersion="3.5">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.Aop</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Library</OutputType>
-    <RootNamespace>Spring</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-    <SignAssembly>false</SignAssembly>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <OldToolsVersion>2.0</OldToolsVersion>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Aop\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG;NET_2_0;DEBUG_DYNAMIC</DefineConstants>
-    <DocumentationFile>Spring.Aop.xml</DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>true</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Aop\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=1.1.0.0, Culture=neutral, PublicKeyToken=65e474d141e25e07, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="System">
-      <Name>System</Name>
-    </Reference>
-    <Reference Include="System.Data">
-      <Name>System.Data</Name>
-    </Reference>
-    <Reference Include="System.Xml">
-      <Name>System.XML</Name>
-    </Reference>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="AopAlliance\Aop\AspectException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="AopAlliance\Aop\IAdvice.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="AopAlliance\Intercept\IConstructorInterceptor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="AopAlliance\Intercept\IConstructorInvocation.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="AopAlliance\Intercept\IInterceptor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="AopAlliance\Intercept\IInvocation.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="AopAlliance\Intercept\IJoinpoint.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="AopAlliance\Intercept\IMethodInterceptor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="AopAlliance\Intercept\IMethodInvocation.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Config\AopNamespaceParser.cs" />
-    <Compile Include="Aop\Config\AopNamespaceUtils.cs" />
-    <Compile Include="Aop\Config\ConfigObjectDefinitionParser.cs" />
-    <Compile Include="Aop\Framework\AopUtils.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\AbstractFilteringAutoProxyCreator.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\AttributeAutoProxyCreator.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\IAdvisorRetrievalHelper.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\InfrastructureAdvisorAutoProxyCreator.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\InheritanceBasedAopConfigurer.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\ObjectFactoryAdvisorRetrievalHelper.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\PointcutFilteringAutoProxyCreator.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\TypeNameAutoProxyCreator.cs" />
-    <Compile Include="Aop\Framework\DynamicMethodInvocation.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\AbstractAopProxyFactory.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\CachedAopProxyFactory.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\DefaultAopProxyFactory.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\InheritanceAopProxyTypeBuilder.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\BaseAopProxyMethodBuilder.cs" />
-    <Compile Include="Aop\IAdvisors.cs" />
-    <Compile Include="Aop\Framework\AbstractMethodInvocation.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\Adapter\AdvisorAdapterRegistrationManager.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\Adapter\AfterReturningAdviceAdapter.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\Adapter\AfterReturningAdviceInterceptor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\Adapter\BeforeAdviceAdapter.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\Adapter\DefaultAdvisorAdapterRegistry.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\Adapter\GlobalAdvisorAdapterRegistry.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\Adapter\IAdvisorAdapter.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\Adapter\IAdvisorAdapterRegistry.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\Adapter\MethodBeforeAdviceInterceptor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\Adapter\ThrowsAdviceAdapter.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\Adapter\ThrowsAdviceInterceptor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\Adapter\UnknownAdviceTypeException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\AdvisedSupport.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\AdvisorChainFactoryUtils.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\AopConfigException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\AopContext.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\AutoProxy\AbstractAdvisorAutoProxyCreator.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\AbstractAutoProxyCreator.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\DefaultAdvisorAutoProxyCreator.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\ITargetSourceCreator.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\ObjectNameAutoProxyCreator.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\Target\AbstractPrototypeTargetSourceCreator.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\AbstractAopProxyMethodBuilder.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\AbstractAopProxyTypeBuilder.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\AdvisedProxy.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\CompositionAopProxyTypeBuilder.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\BaseCompositionAopProxy.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\IAdvisedProxyMethodBuilder.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\IAopProxyTypeGenerator.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\DecoratorAopProxyTypeBuilder.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\IntroductionProxyMethodBuilder.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\DynamicProxy\TargetAopProxyMethodBuilder.cs" />
-    <Compile Include="Aop\Framework\HashtableCachingAdvisorChainFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\IAdvised.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\IAdvisedSupportListener.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\IAdvisorChainFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\IAopProxy.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\IAopProxyFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\InterceptorAndDynamicMethodMatcher.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\ITargetAware.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\ProxyConfig.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\ProxyFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\ProxyFactoryObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\ReflectiveMethodInvocation.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\IAdvisor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\IAfterReturningAdvice.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\IBeforeAdvice.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\IIntroductionAdvisor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\IIntroductionInterceptor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\IMethodBeforeAdvice.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\IMethodMatcher.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\IPointcut.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\IPointcutAdvisor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\ITargetSource.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\IThrowsAdvice.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\ITypeFilter.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\AbstractGenericPointcutAdvisor.cs" />
-    <Compile Include="Aop\Support\AbstractObjectFactoryPointcutAdvisor.cs" />
-    <Compile Include="Aop\Support\AbstractPointcutAdvisor.cs" />
-    <Compile Include="Aop\Support\AbstractRegularExpressionMethodPointcut.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\AttributeMatchingPointcut.cs" />
-    <Compile Include="Aop\Support\AttributeMatchMethodPointcut.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\AttributeMatchMethodPointcutAdvisor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\AttributeMethodMatcher.cs" />
-    <Compile Include="Aop\Support\AttributeTypeFilter.cs" />
-    <Compile Include="Aop\Support\ComposablePointcut.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\ControlFlowPointcut.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\DefaultIntroductionAdvisor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\DefaultObjectFactoryPointcutAdvisor.cs" />
-    <Compile Include="Aop\Support\DefaultPointcutAdvisor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\DynamicMethodMatcher.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\DynamicMethodMatcherPointcutAdvisor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\MethodMatchers.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\NameMatchMethodPointcut.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\NameMatchMethodPointcutAdvisor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\Pointcuts.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\RegularExpressionMethodPointcutAdvisor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\RootTypeFilter.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\SdkRegularExpressionMethodPointcut.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\StaticMethodMatcher.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\StaticMethodMatcherPointcut.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\StaticMethodMatcherPointcutAdvisor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\TypeFilters.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\TypeNameTypeFilter.cs" />
-    <Compile Include="Aop\Support\UnionPointcut.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Target\AbstractPoolingTargetSource.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Target\AbstractPrototypeTargetSource.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Target\EmptyTargetSource.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Target\HotSwappableTargetSource.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Target\IThreadLocalTargetSourceStats.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Target\PoolingConfig.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Target\PrototypeTargetSource.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Target\SimplePoolTargetSource.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Target\SingletonTargetSource.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Target\ThreadLocalTargetSource.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\TrueMethodMatcher.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\TruePointcut.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\TrueTypeFilter.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aspects\AbstractExceptionHandlerAdvice.cs" />
-    <Compile Include="Aspects\Cache\CacheAspect.cs" />
-    <Compile Include="Aspects\Cache\BaseCacheAdvice.cs" />
-    <Compile Include="Aspects\Cache\CacheResultAdvice.cs" />
-    <Compile Include="Aspects\Cache\CacheParameterAdvice.cs" />
-    <Compile Include="Aspects\Cache\CacheResultAdvisor.cs" />
-    <Compile Include="Aspects\Cache\CacheParameterAdvisor.cs" />
-    <Compile Include="Aspects\Cache\InvalidateCacheAdvisor.cs" />
-    <Compile Include="Aspects\Cache\InvalidateCacheAdvice.cs" />
-    <Compile Include="Aspects\Exceptions\ExceptionHandlerAdvice.cs" />
-    <Compile Include="Aspects\Exceptions\ExecuteSpelExceptionHandler.cs" />
-    <Compile Include="Aspects\Exceptions\LogExceptionHandler.cs" />
-    <Compile Include="Aspects\Exceptions\ReturnValueExceptionHandler.cs" />
-    <Compile Include="Aspects\Exceptions\SwallowExceptionHandler.cs" />
-    <Compile Include="Aspects\Exceptions\TranslationExceptionHandler.cs" />
-    <Compile Include="Aspects\Logging\AbstractLoggingAdvice.cs" />
-    <Compile Include="Aspects\Logging\SimpleLoggingAdvice.cs" />
-    <Compile Include="Aspects\ParsedAdviceExpression.cs" />
-    <Compile Include="Aspects\RetryAdvice.cs" />
-    <Compile Include="Aspects\AbstractExceptionHandler.cs" />
-    <Compile Include="Aspects\IExceptionHandler.cs" />
-    <Compile Include="Aspects\RetryExceptionHandler.cs" />
-    <Compile Include="Aspects\Validation\ParameterValidationAdvisor.cs" />
-    <Compile Include="Aspects\Validation\ParameterValidationAdvice.cs" />
-    <Compile Include="AssemblyInfo.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="..\CommonAssemblyInfo.cs">
-      <Link>CommonAssemblyInfo.cs</Link>
-      <SubType>Code</SubType>
-    </Compile>
-    <EmbeddedResource Include="Aop\Config\spring-aop-1.1.xsd">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <None Include="Aop\Config\spring-aop-1.1.xsx">
-      <DependentUpon>spring-aop-1.1.xsd</DependentUpon>
-    </None>
-    <None Include="Spring.Aop.build" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>
-    </PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/src/Spring/Spring.Core/Spring.Core.2002.csproj b/src/Spring/Spring.Core/Spring.Core.2002.csproj
deleted file mode 100644
index ac237d0a..00000000
--- a/src/Spring/Spring.Core/Spring.Core.2002.csproj
+++ /dev/null
@@ -1,2393 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.0.9955"
-        SchemaVersion = "1.0"
-        ProjectGuid = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Core"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                RootNamespace = "Spring"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;NET_1_0"
-                    DocumentationFile = "Spring.Core.xml"
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.Net.2002\Spring.Core\Debug-1.0\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "3"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.Net.2002\Spring.Core\Release-1.0\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.0.3705\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.0.3705\System.XML.dll"
-                />
-                <Reference
-                    Name = "system.web"
-                    AssemblyName = "System.Web"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.0.3705\system.web.dll"
-                />
-                <Reference
-                    Name = "System.Drawing"
-                    AssemblyName = "System.Drawing"
-                    HintPath = "..\..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.0.3705\System.Drawing.dll"
-                />
-                <Reference
-                    Name = "antlr.runtime"
-                    AssemblyName = "antlr.runtime"
-                    HintPath = "..\..\..\lib\Net\1.0\antlr.runtime.dll"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\lib\Net\1.0\Common.Logging.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Spring.Core.build"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Caching\AbstractCache.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Caching\BaseCacheAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Caching\CacheParameterAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Caching\CacheResultAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Caching\CacheResultItemsAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Caching\ICache.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Caching\InvalidateCacheAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Caching\NonExpiringCache.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\AbstractQueue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\DictionarySet.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\HashedSet.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\HybridSet.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\ImmutableSet.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\IQueue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\ISet.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\LinkedList.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\ListSet.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\NoElementsException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\PriorityQueue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\Set.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\SortedSet.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\SynchronizedDictionaryEnumerator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\SynchronizedEnumerator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\SynchronizedHashtable.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\SynchronizedSet.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\ApplicationContextException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\ApplicationEventArgs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\EventListenerAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\IApplicationContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\IApplicationContextAware.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\IApplicationEventListener.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\IApplicationEventPublisher.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\IConfigurableApplicationContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\IHierarchicalMessageSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\IMessageSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\IMessageSourceAware.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\IMessageSourceResolvable.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\IResourceLoaderAware.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\NoSuchMessageException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Events\ConsoleListener.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Events\ContextEventArgs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\AbstractApplicationContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\AbstractMessageSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\AbstractXmlApplicationContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\ApplicationContextAwareProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\ApplicationObjectSupport.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\ContextHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\ContextRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\DefaultMessageSourceResolvable.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\DefaultSectionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\DelegatingMessageSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\GenericApplicationContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\MessageSourceAccessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\MessageSourceResolvableVisitor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\NamespaceParsersSectionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\NullMessageSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\ResourceHandlersSectionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\ResourceSetMessageSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\StaticApplicationContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\StaticMessageSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\TypeAliasesSectionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\TypeConvertersSectionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\XmlApplicationContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\CannotLoadObjectTypeException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\ComposedCriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\ControlFlowFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\Conventions.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\CriteriaMemberFilter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IControlFlow.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\ICriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IErrorCoded.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\InvalidPropertyException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IOrdered.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodArgumentsCriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodGenericArgumentsCountCriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodInvocationException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodNameMatchCriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodParametersCountCriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodParametersCriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodReturnTypeCriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\NotReadablePropertyException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\NotWritablePropertyException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\NullValueInNestedPathException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\OrderComparator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\PropertyAccessException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\PropertyChangeEventArgs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\RegularExpressionCriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\RegularExpressionEventNameCriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\RegularExpressionMethodNameCriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeMismatchException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\AbstractResource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\AssemblyResource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\ConfigSectionResource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\ConfigurableResourceLoader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\FileSystemResource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\IInputStreamSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\InputStreamResource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\IResource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\IResourceLoader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\ResourceConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\ResourceHandlerRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\UrlResource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\CredentialConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\CustomNumberConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\FileInfoConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\NameValueConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\RegexConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\RegistryKeyConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\ResourceManagerConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\RGBColorConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\RuntimeTypeConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\StreamConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\StringArrayConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\TimeSpanConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\TypeConversionUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\TypeConverterRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\UriConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\CachedTypeResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\GenericArgumentsHolder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\GenericTypeResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\ITypeResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\TypeAssemblyHolder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\TypeRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\TypeResolutionUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\TypeResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\AbstractBinding.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\AbstractSimpleBinding.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\BaseBindingContainer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\BaseBindingManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\BindingDirection.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\IBinding.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\IBindingContainer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\IDataBound.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\ListBinding.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\SimpleExpressionBinding.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\.cvsignore"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Expressions\ArrayConstructorNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\AssignNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\AttributeNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\BaseNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\BinaryOperator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\BooleanLiteralNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\ConstructorNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\DateLiteralNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\DefaultNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Expression.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Expression.g"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Expressions\ExpressionConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\ExpressionEvaluator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\ExpressionListNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\FunctionNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\HexLiteralNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\IExpression.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\IndexerNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\IntLiteralNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\LambdaExpressionNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\ListInitializerNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\LocalFunctionNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\LocalVariableNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\MapEntryNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\MapInitializerNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\MethodNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\NamedArgumentNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\NodeWithArguments.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\NullLiteralNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpADD.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpAND.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpBetween.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpDIVIDE.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpEqual.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpGreater.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpGreaterOrEqual.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpIn.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpIs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpLess.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpLessOrEqual.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpLike.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpMatches.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpMODULUS.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpMULTIPLY.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpNOT.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpNotEqual.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpOR.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpPOWER.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpSUBTRACT.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpUnaryMinus.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpUnaryPlus.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\ProjectionNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\PropertyOrFieldNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\QualifiedIdentifier.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\RealLiteralNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\ReferenceNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\SelectionFirstNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\SelectionLastNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\SelectionNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\SpringAST.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\StringLiteralNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\TernaryNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\TypeNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\UnaryOperator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\VariableNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\ExpressionLexer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\ExpressionParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\ExpressionParserTokenTypes.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\ExpressionParserTokenTypes.txt"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Expressions\Processors\AverageAggregator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\CountAggregator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\DistinctProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\ICollectionProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\MaxAggregator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\MinAggregator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\NonNullProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\OrderByProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\SortProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\SumAggregator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\AbstractLocalizer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\AbstractResourceCache.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\ICultureResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\IFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\ILocalizer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\IResourceCache.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\NullResourceCache.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Resource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\CurrencyFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\DateTimeFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\FloatFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\IntegerFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\NumberFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\PercentFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Localizers\ResourceSetLocalizer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Resolvers\DefaultCultureResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\FatalObjectException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\IEventHandlerValue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\IObjectWrapper.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\IPropertyValues.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\MutablePropertyValues.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\ObjectsException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\ObjectWrapper.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\PropertyAccessExceptionsException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\PropertyValue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Events\IEventRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Events\IEventRegistryAware.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Events\Support\EventManipulationUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Events\Support\EventRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\FactoryObjectNotInitializedException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\IFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\IGenericObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\IHierarchicalObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\IInitializingObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\IListableObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\IObjectDefinitionFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\IObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\IObjectFactoryAware.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\IObjectNameAware.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\NoSuchObjectDefinitionException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ObjectCreationException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ObjectCurrentlyInCreationException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ObjectDefinitionException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ObjectDefinitionStoreException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ObjectFactoryUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ObjectInitializationException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ObjectIsNotAFactoryException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ObjectNotOfRequiredTypeException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\UnsatisfiedDependencyException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\AbstractConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\AbstractFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\AutoWiringMode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\CommandLineArgsVariableSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ConfigSectionVariableSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ConfigurationReader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ConnectionStringsVariableSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ConfigurableVariableSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ConstructorArgumentValues.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\CustomConverterConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\DelegateFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\DictionaryFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\EnvironmentVariableMode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\EnvironmentVariableSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\EventValues.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ExpressionHolder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\FieldRetrievingFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\IAutowireCapableObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\IConfigurableFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\IConfigurableListableObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\IConfigurableObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\IDestructionAwareObjectPostProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\IInstantiationAwareObjectPostProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\IObjectDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\IObjectFactoryPostProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\IObjectPostProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\IVariableSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ListFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\LogFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\MethodInvokingFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ObjectDefinitionHolder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ObjectDefinitionVisitor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ObjectFactoryCreatingFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ObjectReferenceFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyFileVariableSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyOverrideConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyPathFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyPlaceholderConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyResourceConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyRetrievingFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\RegistryVariableSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ResourceHandlerConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ResourceManagerFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\RuntimeObjectReference.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\SetFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\SpecialFolderVariableSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\TypeAliasConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\TypedStringValue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\VariablePlaceholderConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Parsing\ReaderContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\AbstractAutowireCapableObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\AbstractMethodReplacer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\AbstractObjectDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\AbstractObjectDefinitionReader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\AbstractObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\AutowireUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ChildObjectDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\DefaultListableObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\DefaultObjectDefinitionFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\DefaultObjectNameGenerator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\DelegatingMethodReplacer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\DependencyCheckingMode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\IConfigurableObjectDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\IInstantiationStrategy.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\IManagedCollection.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\IMethodReplacer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\IObjectDefinitionReader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\IObjectDefinitionRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\IObjectNameGenerator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\LookupMethodOverride.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\LookupMethodReplacer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ManagedDictionary.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ManagedList.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ManagedSet.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\MethodInjectingInstantiationStrategy.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\MethodOverride.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\MethodOverrides.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ObjectDefinitionBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ObjectDefinitionReaderUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ObjectDefinitionValidationException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\PropertiesObjectDefinitionReader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ReplacedMethodOverride.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\RootObjectDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\SimpleInstantiationStrategy.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\StaticListableObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\AbstractObjectDefinitionParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\AbstractSimpleObjectDefinitionParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\AbstractSingleObjectDefinitionParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\DefaultObjectDefinitionDocumentReader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\DocumentDefaultsDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\INamespaceParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\IObjectDefinitionDocumentReader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\IObjectDefinitionParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\NamespaceParserAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\NamespaceParserRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\NamespaceParserSupport.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\ObjectDefinitionConstants.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\ObjectDefinitionParserHelper.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\ObjectFactorySectionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\ObjectsNamespaceParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\ParserContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\spring-objects-1.1.xsd"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\spring-objects-1.1.xsx"
-                    DependentUpon = "spring-objects-1.1.xsd"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\spring-tool-1.1.xsd"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\XmlObjectDefinitionReader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\XmlObjectDefinitionStoreException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\XmlObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\XmlReaderContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\AbstractEventHandlerValue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\AbstractWiringEventHandlerValue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\ArgumentConvertingMethodInvoker.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\AutoWiringEventHandlerValue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\InstanceEventHandlerValue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\ISortDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\MethodInvoker.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\MutableSortDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\PropertyComparator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\StaticEventHandlerValue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Pool\IObjectPool.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Pool\IPoolableObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Pool\PoolException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Pool\Support\SimplePool.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\AbstractProxyMethodBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\AbstractProxyTypeBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\BaseProxyMethodBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\CompositionProxyTypeBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\DynamicProxyManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\InheritanceProxyTypeBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\IProxyMethodBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\IProxyTypeBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\IProxyTypeGenerator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\ProxyIgnoreAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\TargetProxyMethodBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\BaseDynamicMember.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicConstructor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicField.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicIndexer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicMethod.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicProperty.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicReflectionManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Resources\Strings.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Threading\CallContextStorage.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\ISync.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\IThreadStorage.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\Latch.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\LogicalThreadContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\Semaphore.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\SyncHolder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\ThreadStaticStorage.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\TimeoutException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\TimeoutSync.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\Utils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ArrayUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\AssertUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\CollectionUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\CompareUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ConfigurationUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\DelegateInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\DynamicCodeManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\EventUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\FatalReflectionException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\NumberUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ObjectUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\PathMatcher.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\PatternMatchUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\Properties.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ReflectionException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ReflectionUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\StringUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\SystemUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\XmlUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\.cvsignore"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Validation\AnyValidatorGroup.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\BaseValidationAction.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\BaseValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\CollectionValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ErrorMessage.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ExclusiveValidatorGroup.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\IValidationAction.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\IValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ValidationErrors.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ValidatorGroup.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ValidatorReference.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Actions\ErrorMessageAction.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Actions\ExpressionAction.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Config\spring-validation-1.1.xsd"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Validation\Config\ValidationNamespaceParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\ConditionValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\CreditCardValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\EmailValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\ISBNValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\RegularExpressionValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\RequiredValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\UrlValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/src/Spring/Spring.Core/Spring.Core.2003.csproj b/src/Spring/Spring.Core/Spring.Core.2003.csproj
deleted file mode 100644
index 193fd3ba..00000000
--- a/src/Spring/Spring.Core/Spring.Core.2003.csproj
+++ /dev/null
@@ -1,3263 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Core"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = "rem $(ProjectDir)..\..\..\tools\antlr-2.7.6\antlr-2.7.6.exe -o $(ProjectDir)\Expressions\Parser $(ProjectDir)\Expressions\Expression.g"
-                PostBuildEvent = "rem"
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;NET_1_1;DEBUG_DYNAMIC"
-                    DocumentationFile = "Spring.Core.xml"
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = "219, 162, 675,1591,618"
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Core\Debug-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Core\Release-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "System.Drawing"
-                    AssemblyName = "System.Drawing"
-                    HintPath = "..\..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Drawing.dll"
-                />
-                <Reference
-                    Name = "System.Web"
-                    AssemblyName = "System.Web"
-                    HintPath = "..\..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Web.dll"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\lib\Net\1.1\Common.Logging.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "CommonAssemblyInfo.cs"
-                    Link = "..\CommonAssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Spring.Core.build"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Caching\AbstractCache.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Caching\BaseCacheAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Caching\CacheParameterAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Caching\CacheResultAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Caching\CacheResultItemsAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Caching\ICache.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Caching\InvalidateCacheAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Caching\NonExpiringCache.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\AbstractQueue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\CaseInsensitiveHashtable.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\DictionarySet.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\HashedSet.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\HybridSet.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\ImmutableSet.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\IQueue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\ISet.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\LinkedList.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\ListSet.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\NoElementsException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\PriorityQueue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\Set.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\SortedSet.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\SynchronizedDictionaryEnumerator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\SynchronizedEnumerator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\SynchronizedHashtable.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\SynchronizedSet.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\ApplicationContextException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\ApplicationEventArgs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\EventListenerAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\IApplicationContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\IApplicationContextAware.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\IApplicationEventListener.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\IApplicationEventPublisher.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\IConfigurableApplicationContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\IHierarchicalMessageSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\ILifecycle.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\IMessageSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\IMessageSourceAware.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\IMessageSourceResolvable.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\IResourceLoaderAware.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\NoSuchMessageException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Events\ConsoleListener.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Events\ContextEventArgs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\AbstractApplicationContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\AbstractMessageSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\AbstractXmlApplicationContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\AbstractXmlApplicationContextArgs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\ApplicationContextAwareProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\ApplicationObjectSupport.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\ContextHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\ContextRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\DefaultMessageSourceResolvable.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\DefaultSectionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\DelegatingMessageSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\GenericApplicationContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\MessageSourceAccessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\MessageSourceResolvableVisitor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\NamespaceParsersSectionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\NullMessageSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\ResourceHandlersSectionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\ResourceSetMessageSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\StaticApplicationContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\StaticMessageSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\TypeAliasesSectionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\TypeConvertersSectionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\XmlApplicationContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\XmlApplicationContextArgs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\CannotLoadObjectTypeException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\ComposedCriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\ControlFlowFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\Conventions.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\CriteriaMemberFilter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IControlFlow.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\ICriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IErrorCoded.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\InvalidPropertyException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IOrdered.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IPriorityOrdered.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodArgumentsCriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodGenericArgumentsCountCriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodInvocationException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodNameMatchCriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodParameter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodParametersCountCriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodParametersCriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodReturnTypeCriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\NotReadablePropertyException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\NotWritablePropertyException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\NullValueInNestedPathException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\OrderComparator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\PropertyAccessException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\PropertyChangeEventArgs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\RegularExpressionCriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\RegularExpressionEventNameCriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\RegularExpressionMethodNameCriteria.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeMismatchException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\AbstractResource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\AssemblyResource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\ConfigSectionResource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\ConfigurableResourceLoader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\EncodedResource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\FileSystemResource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\IInputStreamSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\InputStreamResource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\IResource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\IResourceLoader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\ResourceConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\ResourceHandlerRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\StringResource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\UrlResource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\CredentialConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\CustomNumberConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\FileInfoConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\NameValueConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\RegexConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\RegistryKeyConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\ResourceManagerConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\RGBColorConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\RuntimeTypeConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\StreamConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\StringArrayConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\TimeSpanConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\TypeConversionUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\TypeConverterRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\UniqueKeyConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\UriConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\CachedTypeResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\GenericArgumentsHolder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\GenericTypeResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\ITypeResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\TypeAssemblyHolder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\TypeRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\TypeResolutionUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\TypeResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\AbstractBinding.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\AbstractSimpleBinding.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\BaseBindingContainer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\BaseBindingManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\BindingDirection.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\BindingErrorMessage.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\IBinding.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\IBindingContainer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\IDataBound.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\ListBinding.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\SimpleExpressionBinding.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\ArrayConstructorNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\AssignNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\AttributeNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\BaseNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\BinaryOperator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\BooleanLiteralNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\ConstructorNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\DefaultNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Expression.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Expression.g"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Expressions\ExpressionConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\ExpressionEvaluator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\ExpressionListNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\FunctionNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\HexLiteralNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\IExpression.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\IndexerNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\IntLiteralNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\LambdaExpressionNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\ListInitializerNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\LocalFunctionNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\LocalVariableNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\MapEntryNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\MapInitializerNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\MethodNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\NamedArgumentNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\NodeWithArguments.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\NullLiteralNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpADD.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpAND.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpBetween.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpDIVIDE.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpEqual.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpGreater.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpGreaterOrEqual.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpIn.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpIs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpLess.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpLessOrEqual.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpLike.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpMatches.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpMODULUS.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpMULTIPLY.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpNOT.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpNotEqual.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpOR.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpPOWER.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpSUBTRACT.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpUnaryMinus.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpUnaryPlus.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpXOR.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\ProjectionNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\PropertyOrFieldNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\QualifiedIdentifier.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\RealLiteralNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\ReferenceNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\SelectionFirstNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\SelectionLastNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\SelectionNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\SpringAST.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\StringLiteralNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\SyntaxErrorException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\TernaryNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\TypeNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\UnaryOperator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\VariableNode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\ExpressionLexer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\ExpressionParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\ExpressionParserTokenTypes.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\ExpressionParserTokenTypes.txt"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\ANTLRException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\ANTLRPanicException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\ASTFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\ASTNodeCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\ASTNULLType.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\ASTPair.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\ASTVisitor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\BaseAST.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\ByteBuffer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\CharBuffer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\CharQueue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\CharScanner.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\CharStreamException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\CharStreamIOException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\CommonAST.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\CommonASTWithHiddenTokens.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\CommonHiddenStreamToken.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\CommonToken.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\DefaultFileLineFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\DumpASTVisitor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\FileLineFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\IHiddenStreamToken.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\InputBuffer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\IToken.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\LexerSharedInputState.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\LLkParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\MismatchedCharException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\MismatchedTokenException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\NoViableAltException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\NoViableAltForCharException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\Parser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\ParserSharedInputState.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\ParseTree.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\ParseTreeRule.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\ParseTreeToken.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\RecognitionException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\SemanticException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\StringUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\SupportClass.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\Token.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\TokenBuffer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\TokenCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\TokenQueue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\TokenStream.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\TokenStreamBasicFilter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\TokenStreamException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\TokenStreamHiddenTokenFilter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\TokenStreamIOException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\TokenStreamRecognitionException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\TokenStreamRetryException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\TokenStreamRewriteEngine.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\TokenStreamSelector.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\TokenWithIndex.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\TreeParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\TreeParserSharedInputState.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\collections\AST.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\collections\impl\ASTArray.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\collections\impl\BitSet.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\ANTLREventArgs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\DebuggingCharScanner.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\DebuggingInputBuffer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\DebuggingParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\GuessingEventArgs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\ICharScannerDebugSubject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\IDebugSubject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\InputBufferEventArgs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\InputBufferEventSupport.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\InputBufferListener.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\InputBufferListenerBase.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\InputBufferReporter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\IParserDebugSubject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\Listener.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\LLkDebuggingParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\MessageEventArgs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\MessageListener.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\MessageListenerBase.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\NewLineEventArgs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\NewLineListener.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\ParserController.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\ParserEventSupport.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\ParserListener.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\ParserListenerBase.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\ParserMatchEventArgs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\ParserMatchListener.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\ParserMatchListenerBase.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\ParserReporter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\ParserTokenEventArgs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\ParserTokenListener.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\ParserTokenListenerBase.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\ParseTreeDebugParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\ScannerEventSupport.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\SemanticPredicateEventArgs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\SemanticPredicateListener.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\SemanticPredicateListenerBase.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\SyntacticPredicateEventArgs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\SyntacticPredicateListener.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\SyntacticPredicateListenerBase.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\TraceEventArgs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\TraceListener.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\TraceListenerBase.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Parser\antlr\debug\Tracer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\AverageAggregator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\ConversionProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\CountAggregator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\DateConversionProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\DistinctProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\ICollectionProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\IMethodCallProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\MaxAggregator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\MinAggregator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\NonNullProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\OrderByProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\ReverseProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\SortProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\SumAggregator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\AbstractLocalizer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\AbstractResourceCache.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\ICultureResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\IFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\ILocalizer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\IResourceCache.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\NullResourceCache.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Resource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\BooleanFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\CurrencyFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\DateTimeFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\FilteringFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\FloatFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\HasTextFilteringFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\IntegerFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\NullFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\NumberFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\PercentFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Localizers\ResourceSetLocalizer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Resolvers\DefaultCultureResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\FatalObjectException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\IEventHandlerValue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\IMergable.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\IObjectWrapper.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\IPropertyValues.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\ISharedStateAware.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\ISharedStateFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\MutablePropertyValues.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\ObjectsException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\ObjectWrapper.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\PropertyAccessExceptionsException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\PropertyValue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Events\IEventRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Events\IEventRegistryAware.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Events\Support\EventManipulationUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Events\Support\EventRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\FactoryObjectNotInitializedException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\IFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\IGenericObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\IHierarchicalObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\IInitializingObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\IListableObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\IObjectDefinitionFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\IObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\IObjectFactoryAware.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\IObjectNameAware.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\NoSuchObjectDefinitionException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ObjectCreationException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ObjectCurrentlyInCreationException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ObjectDefinitionException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ObjectDefinitionStoreException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ObjectFactoryUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ObjectInitializationException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ObjectIsNotAFactoryException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ObjectNotOfRequiredTypeException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\UnsatisfiedDependencyException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Attributes\RequiredAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Attributes\RequiredAttributeObjectPostProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\AbstractConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\AbstractFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\AutoWiringMode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\CommandLineArgsVariableSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ConfigSectionVariableSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ConfigurableVariableSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ConfigurationReader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ConnectionStringsVariableSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ConstructorArgumentValues.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\CustomConverterConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\DelegateFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\DelegateObjectFactoryConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\DependencyDescriptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\DictionaryFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\DictionaryVariableSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\EnvironmentVariableMode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\EnvironmentVariableSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\EventValues.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ExpressionHolder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\FieldRetrievingFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\IAutowireCapableObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\IConfigurableFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\IConfigurableListableObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\IConfigurableObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ICustomValueReferenceHolder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\IDestructionAwareObjectPostProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\IInstantiationAwareObjectPostProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\IManagedCollection.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\InstantiationAwareObjectPostProcessorAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\IObjectDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\IObjectFactoryPostProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\IObjectPostProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ISingletonObjectRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\IVariableSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ListFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\LogFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ManagedDictionary.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ManagedList.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ManagedNameValueCollection.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ManagedSet.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\MethodInvokingFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ObjectDefinitionHolder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ObjectDefinitionVisitor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ObjectFactoryCreatingFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ObjectReferenceFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ObjectRole.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyFileVariableSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyOverrideConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyPathFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyPlaceholderConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyResourceConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyRetrievingFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\RegistryVariableSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ResourceHandlerConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ResourceManagerFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\RuntimeObjectReference.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\SetFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\SharedStateAwareProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\SmartInstantiationAwareObjectPostProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\SpecialFolderVariableSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\TypeAliasConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\TypedStringValue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\VariableAccessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\VariablePlaceholderConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Parsing\FailFastProblemReporter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Parsing\IProblemReporter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Parsing\Location.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Parsing\ObjectDefinitionParsingException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Parsing\Problem.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Parsing\ReaderContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\AbstractAutowireCapableObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\AbstractMethodReplacer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\AbstractObjectDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\AbstractObjectDefinitionReader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\AbstractObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\AutowireUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ChildObjectDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ConstructorResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\DefaultListableObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\DefaultObjectDefinitionFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\DefaultObjectNameGenerator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\DelegatingMethodReplacer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\DependencyCheckingMode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\GenericObjectDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\IAutowireCandidateResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\IConfigurableObjectDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\IInstantiationStrategy.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\IMethodReplacer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\IObjectDefinitionReader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\IObjectDefinitionRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\IObjectDefinitionRegistryPostProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\IObjectNameGenerator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\LookupMethodOverride.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\LookupMethodReplacer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\MethodInjectingInstantiationStrategy.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\MethodOverride.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\MethodOverrides.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ObjectDefinitionBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ObjectDefinitionReaderUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ObjectDefinitionValidationException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ObjectDefinitionValueResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ObjectScope.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\PropertiesObjectDefinitionReader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\RootObjectDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\SimpleAutowireCandidateResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\SimpleInstantiationStrategy.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\StaticListableObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\AbstractObjectDefinitionParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\AbstractSimpleObjectDefinitionParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\AbstractSingleObjectDefinitionParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\DefaultNamespaceHandlerResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\DefaultObjectDefinitionDocumentReader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\DocumentDefaultsDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\INamespaceParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\INamespaceParserResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\IObjectDefinitionDocumentReader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\IObjectDefinitionParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\NamespaceParserAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\NamespaceParserRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\NamespaceParserSupport.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\ObjectDefinitionConstants.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\ObjectDefinitionParserHelper.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\ObjectFactorySectionHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\ObjectsNamespaceParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\ParserContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\ReplacedMethodOverride.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\spring-objects-1.3.xsd"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\spring-objects-1.3.xsx"
-                    DependentUpon = "spring-objects-1.3.xsd"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\spring-tool-1.1.xsd"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\XmlObjectDefinitionReader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\XmlObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\XmlReaderContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\AbstractEventHandlerValue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\AbstractSharedStateFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\AbstractWiringEventHandlerValue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\ArgumentConvertingMethodInvoker.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\AutoWiringEventHandlerValue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\ByTypeSharedStateFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\InstanceEventHandlerValue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\ISortDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\MethodInvoker.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\MutableSortDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\PropertyComparator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\StaticEventHandlerValue.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Pool\IObjectPool.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Pool\IPoolableObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Pool\PoolException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Pool\Support\SimplePool.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\AbstractProxyMethodBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\AbstractProxyTypeBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\BaseProxyMethodBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\CompositionProxyTypeBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\DynamicProxyManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\InheritanceProxyTypeBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\IProxyMethodBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\IProxyTypeBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\IProxyTypeGenerator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\ProxyIgnoreAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\TargetProxyMethodBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\BaseDynamicMember.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicConstructor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicField.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicIndexer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicMethod.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicProperty.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicReflectionManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Resources\Strings.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Stereotype\ComponentAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Stereotype\RepositoryAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Stereotype\ServiceAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\CallContextStorage.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\ISync.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\IThreadStorage.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\Latch.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\LogicalThreadContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\Semaphore.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\SyncHolder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\ThreadStaticStorage.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\TimeoutException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\TimeoutSync.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\Utils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ArrayUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\AssertUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\AttributeUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\CollectionUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\CompareUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ConfigurationUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ConfigXmlAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ConfigXmlDocument.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ConfigXmlElement.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ConstructorInstantiationInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\DelegateInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\DynamicCodeManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\EventUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\FatalReflectionException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\IChainableConfigSystem.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\IErrorHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\IEventExceptionsCollector.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\IoUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ITextPosition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\NumberUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ObjectUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\PathMatcher.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\PatternMatchUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\Properties.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ReflectionException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ReflectionUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\SecurityCritical.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\StringUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\SystemUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\TextPositionInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\UniqueKey.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\XmlUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\Generic\CollectionUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\AnyValidatorGroup.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\BaseSimpleValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\BaseValidationAction.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\BaseValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\BaseValidatorGroup.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\CollectionValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ErrorMessage.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ExclusiveValidatorGroup.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\IValidationAction.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\IValidationErrors.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\IValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ValidatedAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ValidationErrors.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ValidationException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ValidatorGroup.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ValidatorReference.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Actions\ErrorMessageAction.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Actions\ExceptionAction.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Actions\ExpressionAction.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Config\spring-validation-1.3.xsd"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Validation\Config\ValidationNamespaceParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\ConditionValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\CreditCardValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\EmailValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\ISBNValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\RegularExpressionValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\RequiredValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\UrlValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/src/Spring/Spring.Core/Spring.Core.2005.csproj b/src/Spring/Spring.Core/Spring.Core.2005.csproj
deleted file mode 100644
index 0e5dd673..00000000
--- a/src/Spring/Spring.Core/Spring.Core.2005.csproj
+++ /dev/null
@@ -1,1231 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003" ToolsVersion="3.5">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.Core</AssemblyName>
-    <AssemblyOriginatorKeyFile>..\..\..\Spring.Net.snk</AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Library</OutputType>
-    <RootNamespace>Spring</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-    <SignAssembly>false</SignAssembly>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <OldToolsVersion>2.0</OldToolsVersion>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Core\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG;NET_2_0;DEBUG_DYNAMIC</DefineConstants>
-    <DocumentationFile>Spring.Core.xml</DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>219, 162, 618, 1591</NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningsAsErrors>1591</WarningsAsErrors>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Core\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=1.1.0.0, Culture=neutral, PublicKeyToken=65e474d141e25e07, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="Microsoft.VisualBasic" />
-    <Reference Include="System" />
-    <Reference Include="System.configuration" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Drawing" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="..\CommonAssemblyInfo.cs">
-      <Link>CommonAssemblyInfo.cs</Link>
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="AssemblyInfo.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Caching\BaseCacheAttribute.cs" />
-    <Compile Include="Caching\AbstractCache.cs" />
-    <Compile Include="Caching\CacheResultAttribute.cs" />
-    <Compile Include="Caching\CacheResultItemsAttribute.cs" />
-    <Compile Include="Caching\CacheParameterAttribute.cs" />
-    <Compile Include="Caching\InvalidateCacheAttribute.cs" />
-    <Compile Include="Caching\NonExpiringCache.cs" />
-    <Compile Include="Caching\ICache.cs" />
-    <Compile Include="Collections\AbstractQueue.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Collections\CaseInsensitiveHashtable.cs" />
-    <Compile Include="Collections\DictionarySet.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Collections\Generic\DictionarySet.cs" />
-    <Compile Include="Collections\Generic\HashedSet.cs" />
-    <Compile Include="Collections\Generic\ImmutableSet.cs" />
-    <Compile Include="Collections\Generic\ISet.cs" />
-    <Compile Include="Collections\Generic\OrderedSet.cs" />
-    <Compile Include="Collections\Generic\ReadOnlyDictionary.cs" />
-    <Compile Include="Collections\Generic\Set.cs" />
-    <Compile Include="Collections\Generic\SortedSet.cs" />
-    <Compile Include="Collections\Generic\SynchronizedSet.cs" />
-    <Compile Include="Collections\HashedSet.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Collections\HybridSet.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Collections\ImmutableSet.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Collections\IQueue.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Collections\ISet.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Collections\LinkedList.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Collections\ListSet.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Collections\NoElementsException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Collections\PriorityQueue.cs" />
-    <Compile Include="Collections\Set.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Collections\SortedSet.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Collections\SynchronizedDictionaryEnumerator.cs" />
-    <Compile Include="Collections\SynchronizedEnumerator.cs" />
-    <Compile Include="Collections\SynchronizedHashtable.cs" />
-    <Compile Include="Collections\SynchronizedSet.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\ApplicationContextException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\ApplicationEventArgs.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\EventListenerAttribute.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Events\ConsoleListener.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Events\ContextEventArgs.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\IApplicationContext.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\IApplicationContextAware.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\IApplicationEventListener.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\IApplicationEventPublisher.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\IConfigurableApplicationContext.cs" />
-    <Compile Include="Context\IHierarchicalMessageSource.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\ILifecycle.cs" />
-    <Compile Include="Context\IMessageSource.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\IMessageSourceAware.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\IMessageSourceResolvable.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\IResourceLoaderAware.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\NoSuchMessageException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\AbstractApplicationContext.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\AbstractMessageSource.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\AbstractXmlApplicationContext.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\AbstractXmlApplicationContextArgs.cs" />
-    <Compile Include="Context\Support\ApplicationContextAwareProcessor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\ApplicationObjectSupport.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\ContextHandler.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\ContextRegistry.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\NamespaceParsersSectionHandler.cs" />
-    <Compile Include="Context\Support\GenericApplicationContext.cs" />
-    <Compile Include="Context\Support\TypeConvertersSectionHandler.cs" />
-    <Compile Include="Context\Support\DefaultMessageSourceResolvable.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\DefaultSectionHandler.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\DelegatingMessageSource.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\MessageSourceAccessor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\MessageSourceResolvableVisitor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\NullMessageSource.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\ResourceSetMessageSource.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\ResourceHandlersSectionHandler.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\StaticApplicationContext.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\StaticMessageSource.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\TypeAliasesSectionHandler.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\XmlApplicationContext.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\XmlApplicationContextArgs.cs" />
-    <Compile Include="Core\CannotLoadObjectTypeException.cs" />
-    <Compile Include="Core\ComposedCriteria.cs" />
-    <Compile Include="Core\ControlFlowFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Core\Conventions.cs" />
-    <Compile Include="Core\IO\EncodedResource.cs" />
-    <Compile Include="Core\IPriorityOrdered.cs" />
-    <Compile Include="Core\MethodArgumentsCriteria.cs" />
-    <Compile Include="Core\IO\AbstractResource.cs" />
-    <Compile Include="Core\IO\AssemblyResource.cs" />
-    <Compile Include="Core\IO\ConfigSectionResource.cs" />
-    <Compile Include="Core\IO\ConfigurableResourceLoader.cs" />
-    <Compile Include="Core\IO\FileSystemResource.cs" />
-    <Compile Include="Core\IO\IInputStreamSource.cs" />
-    <Compile Include="Core\IO\InputStreamResource.cs" />
-    <Compile Include="Core\IO\IResource.cs" />
-    <Compile Include="Core\IO\IResourceLoader.cs" />
-    <Compile Include="Core\IO\ResourceConverter.cs" />
-    <Compile Include="Core\IO\ResourceHandlerRegistry.cs" />
-    <Compile Include="Core\IO\StringResource.cs" />
-    <Compile Include="Core\IO\UrlResource.cs" />
-    <Compile Include="Core\MethodNameMatchCriteria.cs" />
-    <Compile Include="Core\MethodGenericArgumentsCountCriteria.cs" />
-    <Compile Include="Core\CriteriaMemberFilter.cs" />
-    <Compile Include="Core\IControlFlow.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Core\ICriteria.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Core\IErrorCoded.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Core\InvalidPropertyException.cs" />
-    <Compile Include="Core\IOrdered.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Core\MethodInvocationException.cs" />
-    <Compile Include="Core\MethodParameter.cs" />
-    <Compile Include="Core\MethodParametersCountCriteria.cs" />
-    <Compile Include="Core\MethodParametersCriteria.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Core\MethodReturnTypeCriteria.cs" />
-    <Compile Include="Core\NotReadablePropertyException.cs" />
-    <Compile Include="Core\NotWritablePropertyException.cs" />
-    <Compile Include="Core\NullValueInNestedPathException.cs" />
-    <Compile Include="Core\OrderComparator.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Core\PropertyAccessException.cs" />
-    <Compile Include="Core\PropertyChangeEventArgs.cs" />
-    <Compile Include="Core\RegularExpressionCriteria.cs" />
-    <Compile Include="Core\RegularExpressionEventNameCriteria.cs" />
-    <Compile Include="Core\RegularExpressionMethodNameCriteria.cs" />
-    <Compile Include="Core\TypeConversion\TypeConversionUtils.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Core\TypeConversion\CredentialConverter.cs" />
-    <Compile Include="Core\TypeConversion\CustomNumberConverter.cs" />
-    <Compile Include="Core\TypeConversion\FileInfoConverter.cs" />
-    <Compile Include="Core\TypeConversion\NameValueConverter.cs" />
-    <Compile Include="Core\TypeConversion\RegexConverter.cs" />
-    <Compile Include="Core\TypeConversion\RegistryKeyConverter.cs" />
-    <Compile Include="Core\TypeConversion\ResourceManagerConverter.cs" />
-    <Compile Include="Core\TypeConversion\RGBColorConverter.cs" />
-    <Compile Include="Core\TypeConversion\RuntimeTypeConverter.cs" />
-    <Compile Include="Core\TypeConversion\StreamConverter.cs" />
-    <Compile Include="Core\TypeConversion\StringArrayConverter.cs" />
-    <Compile Include="Core\TypeConversion\TimeSpanConverter.cs" />
-    <Compile Include="Core\TypeConversion\TypeConverterRegistry.cs" />
-    <Compile Include="Core\TypeConversion\UriConverter.cs" />
-    <Compile Include="Core\TypeMismatchException.cs" />
-    <Compile Include="Core\TypeResolution\CachedTypeResolver.cs" />
-    <Compile Include="Core\TypeResolution\GenericArgumentsHolder.cs" />
-    <Compile Include="Core\TypeResolution\TypeAssemblyHolder.cs" />
-    <Compile Include="Core\TypeResolution\GenericTypeResolver.cs" />
-    <Compile Include="Core\TypeResolution\ITypeResolver.cs" />
-    <Compile Include="Core\TypeResolution\TypeResolutionUtils.cs" />
-    <Compile Include="Core\TypeResolution\TypeRegistry.cs" />
-    <Compile Include="Core\TypeResolution\TypeResolver.cs" />
-    <Compile Include="DataBinding\AbstractBinding.cs" />
-    <Compile Include="DataBinding\AbstractSimpleBinding.cs" />
-    <Compile Include="DataBinding\BaseBindingContainer.cs" />
-    <Compile Include="DataBinding\BindingErrorMessage.cs" />
-    <Compile Include="DataBinding\IBindingContainer.cs" />
-    <Compile Include="DataBinding\ListBinding.cs" />
-    <Compile Include="DataBinding\SimpleExpressionBinding.cs" />
-    <Compile Include="DataBinding\BindingDirection.cs" />
-    <Compile Include="DataBinding\BaseBindingManager.cs" />
-    <Compile Include="DataBinding\IBinding.cs" />
-    <Compile Include="DataBinding\IDataBound.cs" />
-    <Compile Include="Expressions\DefaultNode.cs" />
-    <Compile Include="Expressions\ExpressionConverter.cs" />
-    <Compile Include="Expressions\OpXOR.cs" />
-    <Compile Include="Expressions\Parser\antlr\ANTLRException.cs" />
-    <Compile Include="Expressions\Parser\antlr\ANTLRPanicException.cs" />
-    <Compile Include="Expressions\Parser\antlr\ASTFactory.cs" />
-    <Compile Include="Expressions\Parser\antlr\ASTNodeCreator.cs" />
-    <Compile Include="Expressions\Parser\antlr\ASTNULLType.cs" />
-    <Compile Include="Expressions\Parser\antlr\ASTPair.cs" />
-    <Compile Include="Expressions\Parser\antlr\ASTVisitor.cs" />
-    <Compile Include="Expressions\Parser\antlr\BaseAST.cs" />
-    <Compile Include="Expressions\Parser\antlr\ByteBuffer.cs" />
-    <Compile Include="Expressions\Parser\antlr\CharBuffer.cs" />
-    <Compile Include="Expressions\Parser\antlr\CharQueue.cs" />
-    <Compile Include="Expressions\Parser\antlr\CharScanner.cs" />
-    <Compile Include="Expressions\Parser\antlr\CharStreamException.cs" />
-    <Compile Include="Expressions\Parser\antlr\CharStreamIOException.cs" />
-    <Compile Include="Expressions\Parser\antlr\collections\AST.cs" />
-    <Compile Include="Expressions\Parser\antlr\collections\impl\ASTArray.cs" />
-    <Compile Include="Expressions\Parser\antlr\collections\impl\BitSet.cs" />
-    <Compile Include="Expressions\Parser\antlr\CommonAST.cs" />
-    <Compile Include="Expressions\Parser\antlr\CommonASTWithHiddenTokens.cs" />
-    <Compile Include="Expressions\Parser\antlr\CommonHiddenStreamToken.cs" />
-    <Compile Include="Expressions\Parser\antlr\CommonToken.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\ANTLREventArgs.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\DebuggingCharScanner.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\DebuggingInputBuffer.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\DebuggingParser.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\GuessingEventArgs.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\ICharScannerDebugSubject.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\IDebugSubject.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\InputBufferEventArgs.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\InputBufferEventSupport.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\InputBufferListener.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\InputBufferListenerBase.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\InputBufferReporter.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\IParserDebugSubject.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\Listener.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\LLkDebuggingParser.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\MessageEventArgs.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\MessageListener.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\MessageListenerBase.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\NewLineEventArgs.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\NewLineListener.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\ParserController.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\ParserEventSupport.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\ParserListener.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\ParserListenerBase.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\ParserMatchEventArgs.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\ParserMatchListener.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\ParserMatchListenerBase.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\ParserReporter.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\ParserTokenEventArgs.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\ParserTokenListener.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\ParserTokenListenerBase.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\ParseTreeDebugParser.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\ScannerEventSupport.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\SemanticPredicateEventArgs.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\SemanticPredicateListener.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\SemanticPredicateListenerBase.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\SyntacticPredicateEventArgs.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\SyntacticPredicateListener.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\SyntacticPredicateListenerBase.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\TraceEventArgs.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\TraceListener.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\TraceListenerBase.cs" />
-    <Compile Include="Expressions\Parser\antlr\debug\Tracer.cs" />
-    <Compile Include="Expressions\Parser\antlr\DefaultFileLineFormatter.cs" />
-    <Compile Include="Expressions\Parser\antlr\DumpASTVisitor.cs" />
-    <Compile Include="Expressions\Parser\antlr\FileLineFormatter.cs" />
-    <Compile Include="Expressions\Parser\antlr\IHiddenStreamToken.cs" />
-    <Compile Include="Expressions\Parser\antlr\InputBuffer.cs" />
-    <Compile Include="Expressions\Parser\antlr\IToken.cs" />
-    <Compile Include="Expressions\Parser\antlr\LexerSharedInputState.cs" />
-    <Compile Include="Expressions\Parser\antlr\LLkParser.cs" />
-    <Compile Include="Expressions\Parser\antlr\MismatchedCharException.cs" />
-    <Compile Include="Expressions\Parser\antlr\MismatchedTokenException.cs" />
-    <Compile Include="Expressions\Parser\antlr\NoViableAltException.cs" />
-    <Compile Include="Expressions\Parser\antlr\NoViableAltForCharException.cs" />
-    <Compile Include="Expressions\Parser\antlr\Parser.cs" />
-    <Compile Include="Expressions\Parser\antlr\ParserSharedInputState.cs" />
-    <Compile Include="Expressions\Parser\antlr\ParseTree.cs" />
-    <Compile Include="Expressions\Parser\antlr\ParseTreeRule.cs" />
-    <Compile Include="Expressions\Parser\antlr\ParseTreeToken.cs" />
-    <Compile Include="Expressions\Parser\antlr\RecognitionException.cs" />
-    <Compile Include="Expressions\Parser\antlr\SemanticException.cs" />
-    <Compile Include="Expressions\Parser\antlr\StringUtils.cs" />
-    <Compile Include="Expressions\Parser\antlr\SupportClass.cs" />
-    <Compile Include="Expressions\Parser\antlr\Token.cs" />
-    <Compile Include="Expressions\Parser\antlr\TokenBuffer.cs" />
-    <Compile Include="Expressions\Parser\antlr\TokenCreator.cs" />
-    <Compile Include="Expressions\Parser\antlr\TokenQueue.cs" />
-    <Compile Include="Expressions\Parser\antlr\TokenStream.cs" />
-    <Compile Include="Expressions\Parser\antlr\TokenStreamBasicFilter.cs" />
-    <Compile Include="Expressions\Parser\antlr\TokenStreamException.cs" />
-    <Compile Include="Expressions\Parser\antlr\TokenStreamHiddenTokenFilter.cs" />
-    <Compile Include="Expressions\Parser\antlr\TokenStreamIOException.cs" />
-    <Compile Include="Expressions\Parser\antlr\TokenStreamRecognitionException.cs" />
-    <Compile Include="Expressions\Parser\antlr\TokenStreamRetryException.cs" />
-    <Compile Include="Expressions\Parser\antlr\TokenStreamRewriteEngine.cs" />
-    <Compile Include="Expressions\Parser\antlr\TokenStreamSelector.cs" />
-    <Compile Include="Expressions\Parser\antlr\TokenWithIndex.cs" />
-    <Compile Include="Expressions\Parser\antlr\TreeParser.cs" />
-    <Compile Include="Expressions\Parser\antlr\TreeParserSharedInputState.cs" />
-    <Compile Include="Expressions\SyntaxErrorException.cs" />
-    <Compile Include="Expressions\Parser\ExpressionLexer.cs" />
-    <Compile Include="Expressions\Parser\ExpressionParser.cs" />
-    <Compile Include="Expressions\Processors\AverageAggregator.cs" />
-    <Compile Include="Expressions\Processors\ConversionProcessor.cs" />
-    <Compile Include="Expressions\Processors\NonNullProcessor.cs" />
-    <Compile Include="Expressions\Processors\OrderByProcessor.cs" />
-    <Compile Include="Expressions\Processors\DistinctProcessor.cs" />
-    <Compile Include="Expressions\Processors\ReverseProcessor.cs" />
-    <Compile Include="Expressions\Processors\SortProcessor.cs" />
-    <Compile Include="Expressions\Processors\CountAggregator.cs" />
-    <Compile Include="Expressions\Processors\SumAggregator.cs" />
-    <Compile Include="Expressions\Processors\MinAggregator.cs" />
-    <Compile Include="Expressions\Processors\MaxAggregator.cs" />
-    <Compile Include="Expressions\Processors\ICollectionProcessor.cs" />
-    <Compile Include="Expressions\Processors\DateConversionProcessor.cs" />
-    <Compile Include="Expressions\Processors\IMethodCallProcessor.cs" />
-    <Compile Include="Expressions\ArrayConstructorNode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\AssignNode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\BaseNode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\BinaryOperator.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\BooleanLiteralNode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\ConstructorNode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\AttributeNode.cs" />
-    <Compile Include="Expressions\LocalFunctionNode.cs" />
-    <Compile Include="Expressions\FunctionNode.cs" />
-    <Compile Include="Expressions\LocalVariableNode.cs" />
-    <Compile Include="Expressions\LambdaExpressionNode.cs" />
-    <Compile Include="Expressions\OpBetween.cs" />
-    <Compile Include="Expressions\OpMatches.cs" />
-    <Compile Include="Expressions\OpLike.cs" />
-    <Compile Include="Expressions\OpIs.cs" />
-    <Compile Include="Expressions\SelectionLastNode.cs" />
-    <Compile Include="Expressions\SelectionFirstNode.cs" />
-    <Compile Include="Expressions\SelectionNode.cs" />
-    <Compile Include="Expressions\MapEntryNode.cs" />
-    <Compile Include="Expressions\MapInitializerNode.cs" />
-    <Compile Include="Expressions\ListInitializerNode.cs" />
-    <Compile Include="Expressions\OpIn.cs" />
-    <Compile Include="Expressions\QualifiedIdentifier.cs" />
-    <Compile Include="Expressions\NamedArgumentNode.cs" />
-    <Compile Include="Expressions\Expression.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\ExpressionEvaluator.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\ExpressionListNode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\HexLiteralNode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\IExpression.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\IndexerNode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\IntLiteralNode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\MethodNode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\NodeWithArguments.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\NullLiteralNode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\OpADD.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\OpAND.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\OpDIVIDE.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\OpEqual.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\OpGreater.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\OpGreaterOrEqual.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\OpLess.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\OpLessOrEqual.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\OpMODULUS.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\OpMULTIPLY.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\OpNOT.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\OpNotEqual.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\OpOR.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\OpPOWER.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\OpSUBTRACT.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\OpUnaryMinus.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\OpUnaryPlus.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\ProjectionNode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\PropertyOrFieldNode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\RealLiteralNode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\ReferenceNode.cs" />
-    <Compile Include="Expressions\SpringAST.cs" />
-    <Compile Include="Expressions\StringLiteralNode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\TernaryNode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\TypeNode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\UnaryOperator.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\VariableNode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Globalization\AbstractLocalizer.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Globalization\AbstractResourceCache.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Globalization\Formatters\BooleanFormatter.cs" />
-    <Compile Include="Globalization\Formatters\CurrencyFormatter.cs" />
-    <Compile Include="Globalization\Formatters\DateTimeFormatter.cs" />
-    <Compile Include="Globalization\Formatters\FilteringFormatter.cs" />
-    <Compile Include="Globalization\Formatters\FloatFormatter.cs" />
-    <Compile Include="Globalization\Formatters\HasTextFilteringFormatter.cs" />
-    <Compile Include="Globalization\Formatters\IntegerFormatter.cs" />
-    <Compile Include="Globalization\Formatters\NullFormatter.cs" />
-    <Compile Include="Globalization\Formatters\NumberFormatter.cs" />
-    <Compile Include="Globalization\Formatters\PercentFormatter.cs" />
-    <Compile Include="Globalization\ICultureResolver.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Globalization\IFormatter.cs" />
-    <Compile Include="Globalization\ILocalizer.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Globalization\IResourceCache.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Globalization\Localizers\ResourceSetLocalizer.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Globalization\NullResourceCache.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Globalization\Resolvers\DefaultCultureResolver.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Globalization\Resource.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Attributes\RequiredAttribute.cs" />
-    <Compile Include="Objects\Factory\Attributes\RequiredAttributeObjectPostProcessor.cs" />
-    <Compile Include="Objects\Factory\Config\AbstractConfigurer.cs" />
-    <Compile Include="Objects\Factory\Config\CommandLineArgsVariableSource.cs" />
-    <Compile Include="Objects\Factory\Config\ConfigSectionVariableSource.cs" />
-    <Compile Include="Objects\Factory\Config\ConnectionStringsVariableSource.cs" />
-    <Compile Include="Objects\Factory\Config\ConfigurableVariableSource.cs" />
-    <Compile Include="Objects\Factory\Config\ICustomValueReferenceHolder.cs" />
-    <Compile Include="Objects\Factory\Config\DelegateObjectFactoryConfigurer.cs" />
-    <Compile Include="Objects\Factory\Config\DependencyDescriptor.cs" />
-    <Compile Include="Objects\Factory\Config\DictionaryVariableSource.cs" />
-    <Compile Include="Objects\Factory\Config\IConfigurableFactoryObject.cs" />
-    <Compile Include="Objects\Factory\Config\IManagedCollection.cs" />
-    <Compile Include="Objects\Factory\Config\InstantiationAwareObjectPostProcessorAdapter.cs" />
-    <Compile Include="Objects\Factory\Config\ISingletonObjectRegistry.cs" />
-    <Compile Include="Objects\Factory\Config\ManagedDictionary.cs" />
-    <Compile Include="Objects\Factory\Config\ManagedList.cs" />
-    <Compile Include="Objects\Factory\Config\ManagedNameValueCollection.cs" />
-    <Compile Include="Objects\Factory\Config\ManagedSet.cs" />
-    <Compile Include="Objects\Factory\Config\ObjectDefinitionHolder.cs" />
-    <Compile Include="Objects\Factory\Config\ObjectDefinitionVisitor.cs" />
-    <Compile Include="Objects\Factory\Config\ObjectRole.cs" />
-    <Compile Include="Objects\Factory\Config\ResourceHandlerConfigurer.cs" />
-    <Compile Include="Objects\Factory\Config\SharedStateAwareProcessor.cs" />
-    <Compile Include="Objects\Factory\Config\SmartInstantiationAwareObjectPostProcessor.cs" />
-    <Compile Include="Objects\Factory\Config\TypeAliasConfigurer.cs" />
-    <Compile Include="Objects\Factory\Config\PropertyFileVariableSource.cs" />
-    <Compile Include="Objects\Factory\Config\SpecialFolderVariableSource.cs" />
-    <Compile Include="Objects\Factory\Config\RegistryVariableSource.cs" />
-    <Compile Include="Objects\Factory\Config\EnvironmentVariableSource.cs" />
-    <Compile Include="Objects\Factory\Config\ExpressionHolder.cs" />
-    <Compile Include="Objects\Factory\Config\IVariableSource.cs" />
-    <Compile Include="Objects\Factory\Config\VariableAccessor.cs" />
-    <Compile Include="Objects\Factory\Config\VariablePlaceholderConfigurer.cs" />
-    <Compile Include="Objects\Factory\Parsing\FailFastProblemReporter.cs" />
-    <Compile Include="Objects\Factory\Parsing\IProblemReporter.cs" />
-    <Compile Include="Objects\Factory\Parsing\Location.cs" />
-    <Compile Include="Objects\Factory\Parsing\ObjectDefinitionParsingException.cs" />
-    <Compile Include="Objects\Factory\Parsing\Problem.cs" />
-    <Compile Include="Objects\Factory\Parsing\ReaderContext.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\IObjectDefinitionRegistryPostProcessor.cs" />
-    <Compile Include="Objects\Factory\Support\ObjectScope.cs" />
-    <Compile Include="Util\ConstructorInstantiationInfo.cs" />
-    <Compile Include="Objects\Factory\Support\GenericObjectDefinition.cs" />
-    <Compile Include="Objects\Factory\Support\IAutowireCandidateResolver.cs" />
-    <Compile Include="Objects\Factory\Support\ConstructorResolver.cs" />
-    <Compile Include="Objects\Factory\Support\DefaultObjectNameGenerator.cs" />
-    <Compile Include="Objects\Factory\Support\IConfigurableObjectDefinition.cs" />
-    <Compile Include="Objects\Factory\Support\IObjectNameGenerator.cs" />
-    <Compile Include="Objects\Factory\Support\ObjectDefinitionBuilder.cs" />
-    <Compile Include="Objects\Factory\Support\ObjectDefinitionValueResolver.cs" />
-    <Compile Include="Objects\Factory\Support\SimpleAutowireCandidateResolver.cs" />
-    <Compile Include="Objects\Factory\Xml\AbstractObjectDefinitionParser.cs" />
-    <Compile Include="Objects\Factory\Xml\AbstractSimpleObjectDefinitionParser.cs" />
-    <Compile Include="Objects\Factory\Xml\AbstractSingleObjectDefinitionParser.cs" />
-    <Compile Include="Objects\Factory\Xml\DefaultNamespaceHandlerResolver.cs" />
-    <Compile Include="Objects\Factory\Xml\INamespaceParserResolver.cs" />
-    <Compile Include="Objects\Factory\Xml\NamespaceParserAttribute.cs" />
-    <Compile Include="Objects\Factory\Xml\ObjectFactorySectionHandler.cs" />
-    <Compile Include="Objects\Factory\Xml\DocumentDefaultsDefinition.cs" />
-    <Compile Include="Objects\Factory\Xml\IObjectDefinitionDocumentReader.cs" />
-    <Compile Include="Objects\Factory\Xml\IObjectDefinitionParser.cs" />
-    <Compile Include="Objects\Factory\Xml\NamespaceParserSupport.cs" />
-    <Compile Include="Objects\Factory\Xml\ObjectDefinitionParserHelper.cs" />
-    <Compile Include="Objects\Factory\Xml\ParserContext.cs" />
-    <Compile Include="Objects\Factory\Xml\XmlReaderContext.cs" />
-    <Compile Include="Objects\FatalObjectException.cs" />
-    <Compile Include="Objects\IMergable.cs" />
-    <Compile Include="Objects\ISharedStateAware.cs" />
-    <Compile Include="Objects\ISharedStateFactory.cs" />
-    <Compile Include="Objects\MutablePropertyValues.cs" />
-    <Compile Include="Objects\ObjectWrapper.cs" />
-    <Compile Include="Objects\Events\IEventRegistry.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Events\IEventRegistryAware.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Events\Support\EventManipulationUtils.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Events\Support\EventRegistry.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\AbstractFactoryObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\AutoWiringMode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\ConfigurationReader.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\ConstructorArgumentValues.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\CustomConverterConfigurer.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\DelegateFactoryObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\DictionaryFactoryObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\EnvironmentVariableMode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\EventValues.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\FieldRetrievingFactoryObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\IAutowireCapableObjectFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\IConfigurableListableObjectFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\IConfigurableObjectFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\IDestructionAwareObjectPostProcessor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\IInstantiationAwareObjectPostProcessor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\IObjectDefinition.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\IObjectFactoryPostProcessor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\IObjectPostProcessor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\ListFactoryObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\LogFactoryObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\MethodInvokingFactoryObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\ObjectFactoryCreatingFactoryObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\ObjectReferenceFactoryObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\PropertyOverrideConfigurer.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\PropertyPathFactoryObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\PropertyPlaceholderConfigurer.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\PropertyResourceConfigurer.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\PropertyRetrievingFactoryObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\ResourceManagerFactoryObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\RuntimeObjectReference.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\SetFactoryObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\TypedStringValue.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\FactoryObjectNotInitializedException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\IFactoryObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\IGenericObjectFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\IHierarchicalObjectFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\IInitializingObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\IListableObjectFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\IObjectDefinitionFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\IObjectFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\IObjectFactoryAware.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\IObjectNameAware.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\NoSuchObjectDefinitionException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\ObjectCreationException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\ObjectCurrentlyInCreationException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\ObjectDefinitionException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\ObjectDefinitionStoreException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\ObjectFactoryUtils.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\ObjectInitializationException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\ObjectIsNotAFactoryException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\ObjectNotOfRequiredTypeException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\AbstractAutowireCapableObjectFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\AbstractMethodReplacer.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\AbstractObjectDefinition.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\AbstractObjectDefinitionReader.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\AbstractObjectFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\AutowireUtils.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\ChildObjectDefinition.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\DefaultListableObjectFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\DefaultObjectDefinitionFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\DelegatingMethodReplacer.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\DependencyCheckingMode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\IInstantiationStrategy.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\IMethodReplacer.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\IObjectDefinitionReader.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\IObjectDefinitionRegistry.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\LookupMethodOverride.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\LookupMethodReplacer.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\MethodInjectingInstantiationStrategy.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\MethodOverride.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\MethodOverrides.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\ObjectDefinitionReaderUtils.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\ObjectDefinitionValidationException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\PropertiesObjectDefinitionReader.cs" />
-    <Compile Include="Objects\Factory\Xml\ReplacedMethodOverride.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\RootObjectDefinition.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\SimpleInstantiationStrategy.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\StaticListableObjectFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\UnsatisfiedDependencyException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\ObjectsNamespaceParser.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\INamespaceParser.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\ObjectDefinitionConstants.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\XmlObjectDefinitionReader.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\XmlObjectFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\NamespaceParserRegistry.cs" />
-    <Compile Include="Objects\Factory\Xml\DefaultObjectDefinitionDocumentReader.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\IEventHandlerValue.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\IObjectWrapper.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\IPropertyValues.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\ObjectsException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\PropertyAccessExceptionsException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\PropertyValue.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Support\AbstractEventHandlerValue.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Support\AbstractSharedStateFactory.cs" />
-    <Compile Include="Objects\Support\AbstractWiringEventHandlerValue.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Support\ArgumentConvertingMethodInvoker.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Support\AutoWiringEventHandlerValue.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Support\ByTypeSharedStateFactory.cs" />
-    <Compile Include="Objects\Support\InstanceEventHandlerValue.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Support\ISortDefinition.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Support\MethodInvoker.cs" />
-    <Compile Include="Objects\Support\MutableSortDefinition.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Support\PropertyComparator.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Support\StaticEventHandlerValue.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Pool\IObjectPool.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Pool\IPoolableObjectFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Pool\PoolException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Pool\Support\SimplePool.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Proxy\AbstractProxyMethodBuilder.cs" />
-    <Compile Include="Proxy\AbstractProxyTypeBuilder.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Proxy\BaseProxyMethodBuilder.cs" />
-    <Compile Include="Proxy\ProxyIgnoreAttribute.cs" />
-    <Compile Include="Proxy\CompositionProxyTypeBuilder.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Proxy\DynamicProxyManager.cs" />
-    <Compile Include="Proxy\InheritanceProxyTypeBuilder.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Proxy\IProxyMethodBuilder.cs" />
-    <Compile Include="Proxy\IProxyTypeBuilder.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Proxy\IProxyTypeGenerator.cs" />
-    <Compile Include="Proxy\TargetProxyMethodBuilder.cs" />
-    <Compile Include="Reflection\Dynamic\BaseDynamicMember.cs" />
-    <Compile Include="Reflection\Dynamic\DynamicConstructor.cs" />
-    <Compile Include="Reflection\Dynamic\DynamicField.cs" />
-    <Compile Include="Reflection\Dynamic\DynamicIndexer.cs" />
-    <Compile Include="Reflection\Dynamic\DynamicMethod.cs" />
-    <Compile Include="Reflection\Dynamic\DynamicProperty.cs" />
-    <Compile Include="Reflection\Dynamic\DynamicReflectionManager.cs" />
-    <Compile Include="Stereotype\ComponentAttribute.cs" />
-    <Compile Include="Stereotype\RepositoryAttribute.cs" />
-    <Compile Include="Stereotype\ServiceAttribute.cs" />
-    <Compile Include="Threading\CallContextStorage.cs" />
-    <Compile Include="Threading\ISync.cs" />
-    <Compile Include="Threading\IThreadStorage.cs" />
-    <Compile Include="Threading\Latch.cs" />
-    <Compile Include="Threading\LogicalThreadContext.cs" />
-    <Compile Include="Threading\Semaphore.cs" />
-    <Compile Include="Threading\SyncHolder.cs" />
-    <Compile Include="Threading\ThreadStaticStorage.cs" />
-    <Compile Include="Threading\TimeoutException.cs" />
-    <Compile Include="Threading\TimeoutSync.cs" />
-    <Compile Include="Threading\Utils.cs" />
-    <Compile Include="Util\ArrayUtils.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Util\AssertUtils.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Util\AttributeUtils.cs" />
-    <Compile Include="Util\CollectionUtils.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Util\CompareUtils.cs" />
-    <Compile Include="Util\ConfigurationUtils.cs" />
-    <Compile Include="Util\ConfigXmlAttribute.cs" />
-    <Compile Include="Util\ConfigXmlDocument.cs" />
-    <Compile Include="Util\ConfigXmlElement.cs" />
-    <Compile Include="Util\FatalReflectionException.cs" />
-    <Compile Include="Util\IChainableConfigSystem.cs" />
-    <Compile Include="Util\IErrorHandler.cs" />
-    <Compile Include="Util\IEventExceptionsCollector.cs" />
-    <Compile Include="Util\IoUtils.cs" />
-    <Compile Include="Util\ITextPosition.cs" />
-    <Compile Include="Util\ObjectUtils.cs" />
-    <Compile Include="Util\ReflectionException.cs" />
-    <Compile Include="Util\SecurityCritical.cs" />
-    <Compile Include="Util\SystemUtils.cs" />
-    <Compile Include="Util\DynamicCodeManager.cs" />
-    <Compile Include="Util\Generic\CollectionUtils.cs" />
-    <Compile Include="Util\PatternMatchUtils.cs" />
-    <Compile Include="Util\TextPositionInfo.cs" />
-    <Compile Include="Util\UniqueKey.cs" />
-    <Compile Include="Core\TypeConversion\UniqueKeyConverter.cs" />
-    <Compile Include="Util\XmlUtils.cs" />
-    <Compile Include="Util\DelegateInfo.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Util\EventUtils.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Util\NumberUtils.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Util\PathMatcher.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Util\Properties.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Util\ReflectionUtils.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Util\StringUtils.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Validation\Actions\ExceptionAction.cs" />
-    <Compile Include="Validation\BaseSimpleValidator.cs" />
-    <Compile Include="Validation\BaseValidatorGroup.cs" />
-    <Compile Include="Validation\Actions\ErrorMessageAction.cs" />
-    <Compile Include="Validation\Actions\ExpressionAction.cs" />
-    <Compile Include="Validation\AnyValidatorGroup.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Validation\BaseValidationAction.cs" />
-    <Compile Include="Validation\BaseValidator.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Validation\Config\ValidationNamespaceParser.cs" />
-    <Compile Include="Validation\ErrorMessage.cs" />
-    <Compile Include="Validation\ExclusiveValidatorGroup.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Validation\ValidatedAttribute.cs" />
-    <Compile Include="Validation\ValidationException.cs" />
-    <Compile Include="Validation\IValidationAction.cs" />
-    <Compile Include="Validation\IValidationErrors.cs" />
-    <Compile Include="Validation\IValidator.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Validation\ValidationErrors.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Validation\ValidatorGroup.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Validation\ValidatorReference.cs" />
-    <Compile Include="Validation\CollectionValidator.cs" />
-    <Compile Include="Validation\Validators\ConditionValidator.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Validation\Validators\CreditCardValidator.cs" />
-    <Compile Include="Validation\Validators\ISBNValidator.cs" />
-    <Compile Include="Validation\Validators\EmailValidator.cs" />
-    <Compile Include="Validation\Validators\RegularExpressionValidator.cs" />
-    <Compile Include="Validation\Validators\RequiredValidator.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Validation\Validators\UrlValidator.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <None Include="Expressions\Expression.g" />
-    <EmbeddedResource Include="Objects\Factory\Xml\spring-tool-1.1.xsd">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="Objects\Factory\Xml\spring-objects-1.1.xsd">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="Objects\Factory\Xml\spring-objects-1.3.xsd">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <None Include="Spring.Core.build" />
-    <EmbeddedResource Include="Validation\Config\spring-validation-1.3.xsd">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="Validation\Config\spring-validation-1.1.xsd">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="Resources\Strings.resx">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-  </ItemGroup>
-  <ItemGroup>
-    <Content Include="README_ANTLR.txt" />
-    <Content Include="Expressions\Parser\ExpressionParserTokenTypes.txt" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>$(ProjectDir)..\..\..\build-support\tools\antlr-2.7.6\antlr-2.7.6.exe -o $(ProjectDir)Expressions\Parser $(ProjectDir)Expressions\Expression.g
-</PreBuildEvent>
-    <PostBuildEvent>
-    </PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/src/Spring/Spring.Data.NHibernate/Spring.Data.NHibernate.2003.csproj b/src/Spring/Spring.Data.NHibernate/Spring.Data.NHibernate.2003.csproj
deleted file mode 100644
index bcd93164..00000000
--- a/src/Spring/Spring.Data.NHibernate/Spring.Data.NHibernate.2003.csproj
+++ /dev/null
@@ -1,256 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{E8467024-8AE3-44A4-BAAD-1D78747EC7BD}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Data.NHibernate"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;NET_1_1"
-                    DocumentationFile = "Spring.Data.NHibernate.xml"
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Data.NHibernate\Debug-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Data.NHibernate\Release-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "System.Web"
-                    AssemblyName = "System.Web"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Web.dll"
-                />
-                <Reference
-                    Name = "Spring.Aop.2003"
-                    Project = "{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Core.2003"
-                    Project = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Data.2003"
-                    Project = "{E10A3BED-795F-41CB-A4A8-8C4B342ACDDF}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\lib\Net\1.1\Common.Logging.dll"
-                />
-                <Reference
-                    Name = "NHibernate"
-                    AssemblyName = "NHibernate"
-                    HintPath = "..\..\..\lib\NHibernate10\net\1.1\NHibernate.dll"
-                />
-                <Reference
-                    Name = "Castle.DynamicProxy"
-                    AssemblyName = "Castle.DynamicProxy"
-                    HintPath = "..\..\..\lib\NHibernate10\net\1.1\Castle.DynamicProxy.dll"
-                />
-                <Reference
-                    Name = "Iesi.Collections"
-                    AssemblyName = "Iesi.Collections"
-                    HintPath = "..\..\..\lib\NHibernate10\net\1.1\Iesi.Collections.dll"
-                />
-                <Reference
-                    Name = "log4net"
-                    AssemblyName = "log4net"
-                    HintPath = "..\..\..\lib\NHibernate10\net\1.1\log4net.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "CommonAssemblyInfo.cs"
-                    Link = "..\CommonAssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\HibernateAccessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\HibernateAdoException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\HibernateDelegate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\HibernateObjectRetrievalFailureException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\HibernateOptimisticLockingFailureException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\HibernateQueryException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\HibernateSystemException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\HibernateTemplate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\HibernateTransactionManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\ICommonHibernateOperations.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\IHibernateCallback.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\IHibernateOperations.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\LocalSessionFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\SessionFactoryUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\SessionHolder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\SpringSessionSynchronization.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\TemplateFlushMode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\Support\ConfigSectionSessionScopeSettings.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\Support\HibernateDaoSupport.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\Support\OpenSessionInViewModule.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\Support\SessionScope.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\Support\SessionScopeSettings.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/src/Spring/Spring.Data.NHibernate/Spring.Data.NHibernate.2005.csproj b/src/Spring/Spring.Data.NHibernate/Spring.Data.NHibernate.2005.csproj
deleted file mode 100644
index b13ac41a..00000000
--- a/src/Spring/Spring.Data.NHibernate/Spring.Data.NHibernate.2005.csproj
+++ /dev/null
@@ -1,108 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{130E1609-45A7-4F65-B112-105F2DD3E2CE}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Data.NHibernate</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.NHibernate\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-    <DocumentationFile>Spring.Data.NHibernate.xml</DocumentationFile>
-    <TreatWarningsAsErrors>true</TreatWarningsAsErrors>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.NHibernate\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Castle.DynamicProxy, Version=1.1.5.0, Culture=neutral, PublicKeyToken=407dd0808d44fbdc">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate10\net\2.0\Castle.DynamicProxy.dll</HintPath>
-    </Reference>
-    <Reference Include="Common.Logging, Version=1.1.0.0, Culture=neutral, PublicKeyToken=af08829b84f0328e">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="Iesi.Collections, Version=1.0.0.1, Culture=neutral, PublicKeyToken=154fdcb44c4484fc">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate10\net\2.0\Iesi.Collections.dll</HintPath>
-    </Reference>
-    <Reference Include="NHibernate, Version=1.0.4.0, Culture=neutral, PublicKeyToken=154fdcb44c4484fc">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate10\net\2.0\NHibernate.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Web" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="..\CommonAssemblyInfo.cs">
-      <Link>CommonAssemblyInfo.cs</Link>
-    </Compile>
-    <Compile Include="AssemblyInfo.cs" />
-    <Compile Include="Data\NHibernate\HibernateAccessor.cs" />
-    <Compile Include="Data\NHibernate\HibernateAdoException.cs" />
-    <Compile Include="Data\NHibernate\HibernateDelegate.cs" />
-    <Compile Include="Data\NHibernate\HibernateObjectRetrievalFailureException.cs" />
-    <Compile Include="Data\NHibernate\HibernateOptimisticLockingFailureException.cs" />
-    <Compile Include="Data\NHibernate\HibernateQueryException.cs" />
-    <Compile Include="Data\NHibernate\HibernateSystemException.cs" />
-    <Compile Include="Data\NHibernate\HibernateTemplate.cs" />
-    <Compile Include="Data\NHibernate\HibernateTransactionManager.cs" />
-    <Compile Include="Data\NHibernate\ICommonHibernateOperations.cs" />
-    <Compile Include="Data\NHibernate\IHibernateCallback.cs" />
-    <Compile Include="Data\NHibernate\IHibernateOperations.cs" />
-    <Compile Include="Data\NHibernate\LocalSessionFactoryObject.cs" />
-    <Compile Include="Data\NHibernate\SessionFactoryUtils.cs" />
-    <Compile Include="Data\NHibernate\SessionHolder.cs" />
-    <Compile Include="Data\NHibernate\SpringSessionSynchronization.cs" />
-    <Compile Include="Data\NHibernate\Support\ConfigSectionSessionScopeSettings.cs" />
-    <Compile Include="Data\NHibernate\Support\HibernateDaoSupport.cs" />
-    <Compile Include="Data\NHibernate\Support\OpenSessionInViewModule.cs" />
-    <Compile Include="Data\NHibernate\Support\SessionScope.cs" />
-    <Compile Include="Data\NHibernate\Support\SessionScopeSettings.cs" />
-    <Compile Include="Data\NHibernate\TemplateFlushMode.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.Aop\Spring.Aop.2005.csproj">
-      <Project>{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}</Project>
-      <Name>Spring.Aop.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Data\Spring.Data.2005.csproj">
-      <Project>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</Project>
-      <Name>Spring.Data.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Web\Spring.Web.2005.csproj">
-      <Project>{BA4789EB-281A-48EA-8763-28B9F0596A18}</Project>
-      <Name>Spring.Web.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it.
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/src/Spring/Spring.Data.NHibernate12/Spring.Data.NHibernate12.2003.csproj b/src/Spring/Spring.Data.NHibernate12/Spring.Data.NHibernate12.2003.csproj
deleted file mode 100644
index f458bd08..00000000
--- a/src/Spring/Spring.Data.NHibernate12/Spring.Data.NHibernate12.2003.csproj
+++ /dev/null
@@ -1,287 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{B573D2EF-56FD-4675-9031-F8057119B3C8}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Data.NHibernate12"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring.Data.NHibernate12"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;NET_1_1,NH_1_2"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "bin\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE,NH_1_2"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "bin\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "NHibernate"
-                    AssemblyName = "NHibernate"
-                    HintPath = "..\..\..\lib\NHibernate12\net\1.1\NHibernate.dll"
-                />
-                <Reference
-                    Name = "Castle.DynamicProxy"
-                    AssemblyName = "Castle.DynamicProxy"
-                    HintPath = "..\..\..\lib\NHibernate12\net\1.1\Castle.DynamicProxy.dll"
-                />
-                <Reference
-                    Name = "Iesi.Collections"
-                    AssemblyName = "Iesi.Collections"
-                    HintPath = "..\..\..\lib\NHibernate12\net\1.1\Iesi.Collections.dll"
-                />
-                <Reference
-                    Name = "log4net"
-                    AssemblyName = "log4net"
-                    HintPath = "..\..\..\lib\NHibernate12\net\1.1\log4net.dll"
-                />
-                <Reference
-                    Name = "Spring.Aop.2003"
-                    Project = "{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Core.2003"
-                    Project = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Data.2003"
-                    Project = "{E10A3BED-795F-41CB-A4A8-8C4B342ACDDF}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\lib\Net\1.1\Common.Logging.dll"
-                />
-                <Reference
-                    Name = "HashCodeProvider"
-                    AssemblyName = "HashCodeProvider"
-                    HintPath = "..\..\..\lib\NHibernate12\net\1.1\HashCodeProvider.dll"
-                />
-                <Reference
-                    Name = "System.Web"
-                    AssemblyName = "System.Web"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Web.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "CommonAssemblyInfo.cs"
-                    Link = "..\CommonAssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\HibernateAccessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\HibernateAdoException.cs"
-                    Link = "..\Spring.Data.NHibernate\Data\NHibernate\HibernateAdoException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\HibernateDelegate.cs"
-                    Link = "..\Spring.Data.NHibernate\Data\NHibernate\HibernateDelegate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\HibernateObjectRetrievalFailureException.cs"
-                    Link = "..\Spring.Data.NHibernate\Data\NHibernate\HibernateObjectRetrievalFailureException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\HibernateOptimisticLockingFailureException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\HibernateQueryException.cs"
-                    Link = "..\Spring.Data.NHibernate\Data\NHibernate\HibernateQueryException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\HibernateSystemException.cs"
-                    Link = "..\Spring.Data.NHibernate\Data\NHibernate\HibernateSystemException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\HibernateTemplate.cs"
-                    Link = "..\Spring.Data.NHibernate\Data\NHibernate\HibernateTemplate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\HibernateTransactionManager.cs"
-                    Link = "..\Spring.Data.NHibernate\Data\NHibernate\HibernateTransactionManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\ICommonHibernateOperations.cs"
-                    Link = "..\Spring.Data.NHibernate\Data\NHibernate\ICommonHibernateOperations.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\IHibernateCallback.cs"
-                    Link = "..\Spring.Data.NHibernate\Data\NHibernate\IHibernateCallback.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\IHibernateOperations.cs"
-                    Link = "..\Spring.Data.NHibernate\Data\NHibernate\IHibernateOperations.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\LocalSessionFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\SessionFactoryUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\SessionHolder.cs"
-                    Link = "..\Spring.Data.NHibernate\Data\NHibernate\SessionHolder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\SpringSessionContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\SpringSessionSynchronization.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\TemplateFlushMode.cs"
-                    Link = "..\Spring.Data.NHibernate\Data\NHibernate\TemplateFlushMode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\Support\ConfigSectionSessionScopeSettings.cs"
-                    Link = "..\Spring.Data.NHibernate\Data\NHibernate\Support\ConfigSectionSessionScopeSettings.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\Support\dontdelete.txt"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\NHibernate\Support\HibernateDaoSupport.cs"
-                    Link = "..\Spring.Data.NHibernate\Data\NHibernate\Support\HibernateDaoSupport.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\Support\OpenSessionInViewModule.cs"
-                    Link = "..\Spring.Data.NHibernate\Data\NHibernate\Support\OpenSessionInViewModule.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\Support\SessionScope.cs"
-                    Link = "..\Spring.Data.NHibernate\Data\NHibernate\Support\SessionScope.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\Support\SessionScopeSettings.cs"
-                    Link = "..\Spring.Data.NHibernate\Data\NHibernate\Support\SessionScopeSettings.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/src/Spring/Spring.Data.NHibernate12/Spring.Data.NHibernate12.2005.csproj b/src/Spring/Spring.Data.NHibernate12/Spring.Data.NHibernate12.2005.csproj
deleted file mode 100644
index 85d413cd..00000000
--- a/src/Spring/Spring.Data.NHibernate12/Spring.Data.NHibernate12.2005.csproj
+++ /dev/null
@@ -1,141 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{90F2D070-6F98-4926-A626-BD7A6071D6D9}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Data.NHibernate12</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.NHibernate12\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0,NH_1_2</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-    <DocumentationFile>Spring.Data.NHibernate12.xml</DocumentationFile>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.NHibernate12\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0,NH_1_2</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=1.0.2.0, Culture=neutral, PublicKeyToken=af08829b84f0328e">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="log4net, Version=1.2.10.0, Culture=neutral, PublicKeyToken=1b44e1d426115821, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate12\net\2.0\log4net.dll</HintPath>
-    </Reference>
-    <Reference Include="NHibernate, Version=1.2.0.4000, Culture=neutral, PublicKeyToken=aa95f207798dfdb4, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate12\net\2.0\NHibernate.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Web" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="..\CommonAssemblyInfo.cs">
-      <Link>CommonAssemblyInfo.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\HibernateAdoException.cs">
-      <Link>Data\NHibernate\HibernateAdoException.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\HibernateDelegate.cs">
-      <Link>Data\NHibernate\HibernateDelegate.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\HibernateObjectRetrievalFailureException.cs">
-      <Link>Data\NHibernate\HibernateObjectRetrievalFailureException.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\HibernateQueryException.cs">
-      <Link>Data\NHibernate\HibernateQueryException.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\HibernateSystemException.cs">
-      <Link>Data\NHibernate\HibernateSystemException.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\HibernateTemplate.cs">
-      <Link>Data\NHibernate\HibernateTemplate.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\HibernateTransactionManager.cs">
-      <Link>Data\NHibernate\HibernateTransactionManager.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\ICommonHibernateOperations.cs">
-      <Link>Data\NHibernate\ICommonHibernateOperations.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\IHibernateCallback.cs">
-      <Link>Data\NHibernate\IHibernateCallback.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\IHibernateOperations.cs">
-      <Link>Data\NHibernate\IHibernateOperations.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\SessionHolder.cs">
-      <Link>Data\NHibernate\SessionHolder.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\Support\ConfigSectionSessionScopeSettings.cs">
-      <Link>Data\NHibernate\Support\ConfigSectionSessionScopeSettings.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\Support\HibernateDaoSupport.cs">
-      <Link>Data\NHibernate\Support\HibernateDaoSupport.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\Support\OpenSessionInViewModule.cs">
-      <Link>Data\NHibernate\Support\OpenSessionInViewModule.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\Support\SessionScope.cs">
-      <Link>Data\NHibernate\Support\SessionScope.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\Support\SessionScopeSettings.cs">
-      <Link>Data\NHibernate\Support\SessionScopeSettings.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\TemplateFlushMode.cs">
-      <Link>Data\NHibernate\TemplateFlushMode.cs</Link>
-    </Compile>
-    <Compile Include="AssemblyInfo.cs" />
-    <Compile Include="Data\NHibernate\Generic\FindHibernateDelegate.cs" />
-    <Compile Include="Data\NHibernate\Generic\HibernateDaoSupport.cs" />
-    <Compile Include="Data\NHibernate\Generic\HibernateDelegate.cs" />
-    <Compile Include="Data\NHibernate\Generic\HibernateTemplate.cs" />
-    <Compile Include="Data\NHibernate\Generic\IFindHibernateCallback.cs" />
-    <Compile Include="Data\NHibernate\Generic\IHibernateCallback.cs" />
-    <Compile Include="Data\NHibernate\Generic\IHibernateOperations.cs" />
-    <Compile Include="Data\NHibernate\HibernateAccessor.cs" />
-    <Compile Include="Data\NHibernate\HibernateOptimisticLockingFailureException.cs" />
-    <Compile Include="Data\NHibernate\LocalSessionFactoryObject.cs" />
-    <Compile Include="Data\NHibernate\SessionFactoryUtils.cs" />
-    <Compile Include="Data\NHibernate\SpringSessionContext.cs" />
-    <Compile Include="Data\NHibernate\SpringSessionSynchronization.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.Aop\Spring.Aop.2005.csproj">
-      <Project>{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}</Project>
-      <Name>Spring.Aop.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Data\Spring.Data.2005.csproj">
-      <Project>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</Project>
-      <Name>Spring.Data.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it.
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/src/Spring/Spring.Data.NHibernate20/Spring.Data.NHibernate20.2005.csproj b/src/Spring/Spring.Data.NHibernate20/Spring.Data.NHibernate20.2005.csproj
deleted file mode 100644
index ecc9c145..00000000
--- a/src/Spring/Spring.Data.NHibernate20/Spring.Data.NHibernate20.2005.csproj
+++ /dev/null
@@ -1,163 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{71368632-B8B7-4A6A-8C65-8DA848120C82}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Data.NHibernate20</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.NHibernate20\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-    <DocumentationFile>Spring.Data.NHibernate20.xml</DocumentationFile>
-    <TreatWarningsAsErrors>true</TreatWarningsAsErrors>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.NHibernate20\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=1.0.2.0, Culture=neutral, PublicKeyToken=af08829b84f0328e">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="log4net, Version=1.2.10.0, Culture=neutral, PublicKeyToken=1b44e1d426115821, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate20\net\2.0\log4net.dll</HintPath>
-    </Reference>
-    <Reference Include="NHibernate, Version=2.0.0.1001, Culture=neutral, PublicKeyToken=aa95f207798dfdb4, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate20\net\2.0\NHibernate.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Web" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="..\CommonAssemblyInfo.cs">
-      <Link>CommonAssemblyInfo.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\Generic\FindHibernateDelegate.cs">
-      <Link>Data\NHibernate\Generic\FindHibernateDelegate.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\Generic\HibernateDaoSupport.cs">
-      <Link>Data\NHibernate\Generic\HibernateDaoSupport.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\Generic\HibernateDelegate.cs">
-      <Link>Data\NHibernate\Generic\HibernateDelegate.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\Generic\HibernateTemplate.cs">
-      <Link>Data\NHibernate\Generic\HibernateTemplate.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\Generic\IFindHibernateCallback.cs">
-      <Link>Data\NHibernate\Generic\IFindHibernateCallback.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\Generic\IHibernateCallback.cs">
-      <Link>Data\NHibernate\Generic\IHibernateCallback.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\Generic\IHibernateOperations.cs">
-      <Link>Data\NHibernate\Generic\IHibernateOperations.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\HibernateAccessor.cs">
-      <Link>Data\NHibernate\HibernateAccessor.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\SpringSessionContext.cs">
-      <Link>Data\NHibernate\SpringSessionContext.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\SpringSessionSynchronization.cs">
-      <Link>Data\NHibernate\SpringSessionSynchronization.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\HibernateAdoException.cs">
-      <Link>Data\NHibernate\HibernateAdoException.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\HibernateDelegate.cs">
-      <Link>Data\NHibernate\HibernateDelegate.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\HibernateQueryException.cs">
-      <Link>Data\NHibernate\HibernateQueryException.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\HibernateSystemException.cs">
-      <Link>Data\NHibernate\HibernateSystemException.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\HibernateTemplate.cs">
-      <Link>Data\NHibernate\HibernateTemplate.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\HibernateTransactionManager.cs">
-      <Link>Data\NHibernate\HibernateTransactionManager.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\ICommonHibernateOperations.cs">
-      <Link>Data\NHibernate\ICommonHibernateOperations.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\IHibernateCallback.cs">
-      <Link>Data\NHibernate\IHibernateCallback.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\IHibernateOperations.cs">
-      <Link>Data\NHibernate\IHibernateOperations.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\SessionFactoryUtils.cs">
-      <Link>Data\NHibernate\SessionFactoryUtils.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\SessionHolder.cs">
-      <Link>Data\NHibernate\SessionHolder.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\Support\ConfigSectionSessionScopeSettings.cs">
-      <Link>Data\NHibernate\Support\ConfigSectionSessionScopeSettings.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\Support\HibernateDaoSupport.cs">
-      <Link>Data\NHibernate\Support\HibernateDaoSupport.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\Support\OpenSessionInViewModule.cs">
-      <Link>Data\NHibernate\Support\OpenSessionInViewModule.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\Support\SessionScope.cs">
-      <Link>Data\NHibernate\Support\SessionScope.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\Support\SessionScopeSettings.cs">
-      <Link>Data\NHibernate\Support\SessionScopeSettings.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\TemplateFlushMode.cs">
-      <Link>Data\NHibernate\TemplateFlushMode.cs</Link>
-    </Compile>
-    <Compile Include="AssemblyInfo.cs" />
-    <Compile Include="Data\NHibernate\FilterDefiniitionFactoryObject.cs" />
-    <Compile Include="Data\NHibernate\HibernateObjectRetrievalFailureException.cs" />
-    <Compile Include="Data\NHibernate\HibernateOptimisticLockingFailureException.cs" />
-    <Compile Include="Data\NHibernate\LocalSessionFactoryObject.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.Aop\Spring.Aop.2005.csproj">
-      <Project>{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}</Project>
-      <Name>Spring.Aop.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Data\Spring.Data.2005.csproj">
-      <Project>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</Project>
-      <Name>Spring.Data.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it.
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/src/Spring/Spring.Data.NHibernate21/Spring.Data.NHibernate21.2005.csproj b/src/Spring/Spring.Data.NHibernate21/Spring.Data.NHibernate21.2005.csproj
deleted file mode 100644
index c0092d86..00000000
--- a/src/Spring/Spring.Data.NHibernate21/Spring.Data.NHibernate21.2005.csproj
+++ /dev/null
@@ -1,171 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{E57B4652-0231-49CB-B058-87E10EFE540D}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Data.NHibernate21</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.NHibernate21\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0,NH_2_0,NH_2_1</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-    <DocumentationFile>Spring.Data.NHibernate21.xml</DocumentationFile>
-    <TreatWarningsAsErrors>true</TreatWarningsAsErrors>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.NHibernate21\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0,NH_2_0,NH_2_1</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=1.0.2.0, Culture=neutral, PublicKeyToken=af08829b84f0328e">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="log4net, Version=1.2.10.0, Culture=neutral, PublicKeyToken=1b44e1d426115821, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate21\net\2.0\log4net.dll</HintPath>
-    </Reference>
-    <Reference Include="NHibernate, Version=2.0.0.1001, Culture=neutral, PublicKeyToken=aa95f207798dfdb4, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate21\net\2.0\NHibernate.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Web" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="..\CommonAssemblyInfo.cs">
-      <Link>CommonAssemblyInfo.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\Generic\FindHibernateDelegate.cs">
-      <Link>Data\NHibernate\Generic\FindHibernateDelegate.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\Generic\HibernateDaoSupport.cs">
-      <Link>Data\NHibernate\Generic\HibernateDaoSupport.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\Generic\HibernateDelegate.cs">
-      <Link>Data\NHibernate\Generic\HibernateDelegate.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\Generic\HibernateTemplate.cs">
-      <Link>Data\NHibernate\Generic\HibernateTemplate.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\Generic\IFindHibernateCallback.cs">
-      <Link>Data\NHibernate\Generic\IFindHibernateCallback.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\Generic\IHibernateCallback.cs">
-      <Link>Data\NHibernate\Generic\IHibernateCallback.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\Generic\IHibernateOperations.cs">
-      <Link>Data\NHibernate\Generic\IHibernateOperations.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\HibernateAccessor.cs">
-      <Link>Data\NHibernate\HibernateAccessor.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\SpringSessionContext.cs">
-      <Link>Data\NHibernate\SpringSessionContext.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\SpringSessionSynchronization.cs">
-      <Link>Data\NHibernate\SpringSessionSynchronization.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\HibernateAdoException.cs">
-      <Link>Data\NHibernate\HibernateAdoException.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\HibernateDelegate.cs">
-      <Link>Data\NHibernate\HibernateDelegate.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\HibernateQueryException.cs">
-      <Link>Data\NHibernate\HibernateQueryException.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\HibernateSystemException.cs">
-      <Link>Data\NHibernate\HibernateSystemException.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\HibernateTemplate.cs">
-      <Link>Data\NHibernate\HibernateTemplate.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\HibernateTransactionManager.cs">
-      <Link>Data\NHibernate\HibernateTransactionManager.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\ICommonHibernateOperations.cs">
-      <Link>Data\NHibernate\ICommonHibernateOperations.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\IHibernateCallback.cs">
-      <Link>Data\NHibernate\IHibernateCallback.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\IHibernateOperations.cs">
-      <Link>Data\NHibernate\IHibernateOperations.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate12\Data\NHibernate\SessionFactoryUtils.cs">
-      <Link>Data\NHibernate\SessionFactoryUtils.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\SessionHolder.cs">
-      <Link>Data\NHibernate\SessionHolder.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\Support\ConfigSectionSessionScopeSettings.cs">
-      <Link>Data\NHibernate\Support\ConfigSectionSessionScopeSettings.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\Support\HibernateDaoSupport.cs">
-      <Link>Data\NHibernate\Support\HibernateDaoSupport.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\Support\OpenSessionInViewModule.cs">
-      <Link>Data\NHibernate\Support\OpenSessionInViewModule.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\Support\SessionScope.cs">
-      <Link>Data\NHibernate\Support\SessionScope.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\Support\SessionScopeSettings.cs">
-      <Link>Data\NHibernate\Support\SessionScopeSettings.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate\Data\NHibernate\TemplateFlushMode.cs">
-      <Link>Data\NHibernate\TemplateFlushMode.cs</Link>
-    </Compile>
-    <Compile Include="AssemblyInfo.cs" />
-    <Compile Include="..\Spring.Data.NHibernate20\Data\NHibernate\FilterDefiniitionFactoryObject.cs">
-		<Link>Data\NHibernate\FilterDefiniitionFactoryObject.cs</Link>
-	</Compile>
-    <Compile Include="..\Spring.Data.NHibernate20\Data\NHibernate\HibernateObjectRetrievalFailureException.cs">
-		<Link>Data\NHibernate\HibernateObjectRetrievalFailureException.cs</Link>
-	</Compile>
-    <Compile Include="..\Spring.Data.NHibernate20\Data\NHibernate\HibernateOptimisticLockingFailureException.cs">
-		<Link>Data\NHibernate\HibernateOptimisticLockingFailureException.cs</Link>
-	</Compile>
-    <Compile Include="..\Spring.Data.NHibernate20\Data\NHibernate\LocalSessionFactoryObject.cs">
-		<Link>Data\NHibernate\LocalSessionFactoryObject.cs</Link>
-	</Compile>
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.Aop\Spring.Aop.2005.csproj">
-      <Project>{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}</Project>
-      <Name>Spring.Aop.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Data\Spring.Data.2005.csproj">
-      <Project>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</Project>
-      <Name>Spring.Data.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it.
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/src/Spring/Spring.Data/Spring.Data.2003.csproj b/src/Spring/Spring.Data/Spring.Data.2003.csproj
deleted file mode 100644
index 90129591..00000000
--- a/src/Spring/Spring.Data/Spring.Data.2003.csproj
+++ /dev/null
@@ -1,1111 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{E10A3BED-795F-41CB-A4A8-8C4B342ACDDF}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Data"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;NET_1_1"
-                    DocumentationFile = "Spring.Data.xml"
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = "1591"
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Data\Debug-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "true"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Data\Release-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "System.EnterpriseServices"
-                    AssemblyName = "System.EnterpriseServices"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.EnterpriseServices.dll"
-                />
-                <Reference
-                    Name = "System.Data.OracleClient"
-                    AssemblyName = "System.Data.OracleClient"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.OracleClient.dll"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\lib\Net\1.1\Common.Logging.dll"
-                />
-                <Reference
-                    Name = "Spring.Core.2003"
-                    Project = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Aop.2003"
-                    Project = "{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "CommonAssemblyInfo.cs"
-                    Link = "..\CommonAssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Spring.Data.build"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Dao\CannotAcquireLockException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\CannotSerializeTransactionException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\CleanupFailureDataAccessException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\ConcurrencyFailureException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\DataAccessException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\DataAccessResourceFailureException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\DataIntegrityViolationException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\DataRetrievalFailureException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\DeadlockLoserDataAccessException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\EmptyResultDataAccessException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\IncorrectResultSizeDataAccessException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\IncorrectUpdateSemanticsDataAccessException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\InvalidDataAccessApiUsageException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\InvalidDataAccessResourceUsageException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\NonTransientDataAccessException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\NonTransientDataAccessResourceException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\ObjectOptimisticLockingFailureException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\ObjectRetrievalFailureException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\OptimisticLockingFailureException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\PermissionDeniedDataAccessException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\PessimisticLockingFailureException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\TransientDataAccessException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\TransientDataAccessResourceException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\TypeMismatchDataAccessException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\UncategorizedDataAccessException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\Attributes\PersistenceExceptionTranslationAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\Attributes\PersistenceExceptionTranslationPostProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\Support\ChainedPersistenceExceptionTranslator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\Support\DaoSupport.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\Support\DataAccessUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\Support\IPersistenceExceptionTranslator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\Support\PersistenceExceptionTranslationInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\Support\Generic\DataAccessUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\BadSqlGrammarException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\CannotGetAdoConnectionException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\CommandDelegate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\CommandSetterDelegate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\DuplicateKeyException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\IAdoOperations.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\ICommandCallback.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\ICommandSetter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\ICommandTextProvider.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\ICommonAdoOperations.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\IDataAdapterCallback.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\IDataAdapterSetter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\IDataReaderWrapper.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\IDataSetFillLifecycleProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\IDbCommandCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\IDbCommandCreatorFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\IDbDataAdapterCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\InvalidResultSetAccessException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\IResultSetExtractor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\IRowCallback.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\IRowMapper.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\ResultSetExtractorDelegate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\RowCallbackDelegate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\RowMapperDelegate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\UncategorizedAdoException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Common\DbMetadata.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Common\DbParameter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Common\DbParameters.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Common\DbParametersBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Common\DbProvider.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Common\DbProviderConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Common\DbProviderFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Common\DbProviderFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Common\dbproviders.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\Common\DelegatingDbProvider.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Common\ErrorCodes.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Common\IDbMetadata.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Common\IDbParameter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Common\IDbParameters.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Common\IDbParametersBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Common\IDbProvider.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Common\MultiDelegatingDbProvider.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Common\UserCredentialsDbProvider.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Config\DatabaseNamespaceParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Config\spring-database-1.3.xsd"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\Config\spring-database-1.3.xsx"
-                    DependentUpon = "spring-database-1.3.xsd"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Data\Core\AdoAccessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Core\AdoDaoSupport.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Core\AdoPlatformTransactionManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Core\AdoTemplate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Core\RowMapperResultSetExtractor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Core\ServiceDomainPlatformTransactionManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Core\TxScopeTransactionManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Generic\AdoDaoSupport.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Generic\AdoTemplate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Generic\CommandDelegate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Generic\DataAdapterDelegate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Generic\IAdoOperations.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Generic\ICommandCallback.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Generic\IDataAdapterCallback.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Generic\IDbCommandCallback.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Generic\IDbCommandDelegate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Generic\IResultSetExtractor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Generic\IRowMapper.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Generic\NamedResultSetProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Generic\ResultSetExtractorDelegate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Generic\RowMapperDelegate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Generic\RowMapperResultSetExtractor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Objects\AbstractAdoOperation.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Objects\AdoNonQuery.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Objects\AdoOperation.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Objects\AdoQuery.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Objects\AdoScalar.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Objects\MappingAdoQuery.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Objects\MappingAdoQueryWithContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Objects\StoredProcedure.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Objects\Generic\AdoOperation.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Objects\Generic\AdoQuery.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Objects\Generic\MappingAdoQuery.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Objects\Generic\MappingAdoQueryWithContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Objects\Generic\StoredProcedure.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Support\AdoTransactionObjectSupport.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Support\AdoUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Support\ConnectionHolder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Support\ConnectionSynchronization.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Support\ConnectionTxPair.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Support\ConnectionUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Support\DefaultServiceDomainAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Support\DefaultTransactionScopeAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Support\ErrorCodeExceptionTranslator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Support\FallbackExceptionTranslator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Support\IAdoExceptionTranslator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Support\IServiceDomainAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Support\ITransactionScopeAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Support\NamedResultSetProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Support\NullMappingDataReader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Support\ParameterUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Support\RowCallbackResultSetExtractor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Support\SimpleServiceConfig.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Support\TypedDataSetUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Support\Sql\sqlconnectionstring.xsd"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Transaction\CannotCreateTransactionException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\HeuristicCompletionException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\IllegalTransactionStateException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\InvalidIsolationLevelException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\InvalidTimeoutException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\IPlatformTransactionManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\ISavepointManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\ITransactionDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\ITransactionStatus.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\NestedTransactionNotSupportedException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\NoTransactionException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\TransactionException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\TransactionOutcomeState.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\TransactionPropagation.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\TransactionSuspensionNotSupportedException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\TransactionSystemException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\TransactionTimedOutException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\TransactionUsageException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\UnexpectedRollbackException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Config\AttributeDrivenObjectDefinitionParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Config\spring-tx-1.1.xsd"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Transaction\Config\TxAdviceObjectDefinitionParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Config\TxNamespaceParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Config\TxNamespaceUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\AbstractFallbackTransactionAttributeSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\AbstractTransactionAttributeSourcePointcut.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\AttributesTransactionAttributeSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\DefaultTransactionAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\DefaultTransactionAttributeSourceAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\DelegatingTransactionAttributeWithName.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\ITransactionAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\ITransactionAttributeSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\MatchAlwaysTransactionAttributeSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\MethodMapTransactionAttributeSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\NameMatchTransactionAttributeSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\NoRollbackRuleAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\ObjectFactoryTransactionAttributeSourceAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\RollbackRuleAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\RuleBasedTransactionAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\TransactionAspectSupport.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\TransactionAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\TransactionAttributeConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\TransactionAttributeEditor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\TransactionAttributeSourceAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\TransactionAttributeSourceEditor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\TransactionInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\TransactionProxyFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\AbstractPlatformTransactionManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\DefaultTransactionDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\DefaultTransactionStatus.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\IResourceTransactionManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\ISmartTransactionObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\ITransactionCallback.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\ITransactionOperations.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\ITransactionSynchronization.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\ResourceHolderSupport.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\TransactionCallbackWithoutResult.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\TransactionDelegate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\TransactionSynchronizationAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\TransactionSynchronizationManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\TransactionSynchronizationState.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\TransactionSynchronizationStatus.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\TransactionTemplate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/src/Spring/Spring.Data/Spring.Data.2005.csproj b/src/Spring/Spring.Data/Spring.Data.2005.csproj
deleted file mode 100644
index 8c74d97e..00000000
--- a/src/Spring/Spring.Data/Spring.Data.2005.csproj
+++ /dev/null
@@ -1,336 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003" ToolsVersion="3.5">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.Data</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Library</OutputType>
-    <RootNamespace>Spring</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <OldToolsVersion>2.0</OldToolsVersion>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <DocumentationFile>Spring.Data.xml</DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>1587, 1591, 219, 162, 618</NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>true</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=2.1.0.0, Culture=neutral, PublicKeyToken=65e474d141e25e07, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="System">
-      <Name>System</Name>
-    </Reference>
-    <Reference Include="System.configuration" />
-    <Reference Include="System.Data">
-      <Name>System.Data</Name>
-    </Reference>
-    <Reference Include="System.Drawing">
-      <Name>System.Drawing</Name>
-    </Reference>
-    <Reference Include="System.EnterpriseServices" />
-    <Reference Include="System.Transactions" />
-    <Reference Include="System.Web">
-      <Name>System.Web</Name>
-    </Reference>
-    <Reference Include="System.Xml">
-      <Name>System.XML</Name>
-    </Reference>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="..\CommonAssemblyInfo.cs">
-      <Link>CommonAssemblyInfo.cs</Link>
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="AssemblyInfo.cs" />
-    <Compile Include="Dao\Attributes\PersistenceExceptionTranslationAdvisor.cs" />
-    <Compile Include="Dao\Attributes\PersistenceExceptionTranslationPostProcessor.cs" />
-    <Compile Include="Dao\CannotAcquireLockException.cs" />
-    <Compile Include="Dao\CannotSerializeTransactionException.cs" />
-    <Compile Include="Dao\CleanupFailureDataAccessException.cs" />
-    <Compile Include="Dao\ConcurrencyFailureException.cs" />
-    <Compile Include="Dao\NonTransientDataAccessException.cs" />
-    <Compile Include="Dao\NonTransientDataAccessResourceException.cs" />
-    <Compile Include="Dao\PessimisticLockingFailureException.cs" />
-    <Compile Include="Dao\DataAccessException.cs" />
-    <Compile Include="Dao\DataAccessResourceFailureException.cs" />
-    <Compile Include="Dao\DataIntegrityViolationException.cs" />
-    <Compile Include="Dao\DataRetrievalFailureException.cs" />
-    <Compile Include="Dao\DeadlockLoserDataAccessException.cs" />
-    <Compile Include="Dao\EmptyResultDataAccessException.cs" />
-    <Compile Include="Dao\IncorrectResultSizeDataAccessException.cs" />
-    <Compile Include="Dao\IncorrectUpdateSemanticsDataAccessException.cs" />
-    <Compile Include="Dao\InvalidDataAccessApiUsageException.cs" />
-    <Compile Include="Dao\InvalidDataAccessResourceUsageException.cs" />
-    <Compile Include="Dao\ObjectOptimisticLockingFailureException.cs" />
-    <Compile Include="Dao\ObjectRetrievalFailureException.cs" />
-    <Compile Include="Dao\OptimisticLockingFailureException.cs" />
-    <Compile Include="Dao\PermissionDeniedDataAccessException.cs" />
-    <Compile Include="Dao\Support\ChainedPersistenceExceptionTranslator.cs" />
-    <Compile Include="Dao\Support\DaoSupport.cs" />
-    <Compile Include="Dao\Support\DataAccessUtils.cs" />
-    <Compile Include="Dao\Support\Generic\DataAccessUtils.cs" />
-    <Compile Include="Dao\Support\IPersistenceExceptionTranslator.cs" />
-    <Compile Include="Dao\Support\PersistenceExceptionTranslationInterceptor.cs" />
-    <Compile Include="Dao\TransientDataAccessException.cs" />
-    <Compile Include="Dao\TransientDataAccessResourceException.cs" />
-    <Compile Include="Dao\TypeMismatchDataAccessException.cs" />
-    <Compile Include="Dao\UncategorizedDataAccessException.cs" />
-    <Compile Include="Data\BadSqlGrammarException.cs" />
-    <Compile Include="Data\CommandDelegate.cs" />
-    <Compile Include="Data\Common\DbMetadata.cs" />
-    <Compile Include="Data\Common\DbParameter.cs" />
-    <Compile Include="Data\Common\DbParameters.cs" />
-    <Compile Include="Data\Common\DbProvider.cs" />
-    <Compile Include="Data\Common\DbProviderConfigurer.cs" />
-    <Compile Include="Data\Common\DbProviderFactory.cs" />
-    <Compile Include="Data\Common\DbProviderFactoryObject.cs" />
-    <Compile Include="Data\Common\DbParametersBuilder.cs" />
-    <Compile Include="Data\Common\DelegatingDbProvider.cs" />
-    <Compile Include="Data\Common\ErrorCodes.cs" />
-    <Compile Include="Data\Common\IDbMetadata.cs" />
-    <Compile Include="Data\Common\IDbParameter.cs" />
-    <Compile Include="Data\Common\IDbParametersBuilder.cs" />
-    <Compile Include="Data\Common\IDbParameters.cs" />
-    <Compile Include="Data\Common\IDbProvider.cs" />
-    <Compile Include="Data\CannotGetAdoConnectionException.cs" />
-    <Compile Include="Data\CommandSetterDelegate.cs" />
-    <Compile Include="Data\Common\MultiDelegatingDbProvider.cs" />
-    <Compile Include="Data\Common\UserCredentialsDbProvider.cs" />
-    <Compile Include="Data\Config\DatabaseNamespaceParser.cs" />
-    <Compile Include="Data\DuplicateKeyException.cs" />
-    <Compile Include="Data\Core\AdoAccessor.cs" />
-    <Compile Include="Data\Core\AdoDaoSupport.cs" />
-    <Compile Include="Data\Core\AdoPlatformTransactionManager.cs" />
-    <Compile Include="Data\Core\AdoTemplate.cs" />
-    <Compile Include="Data\Core\RowMapperResultSetExtractor.cs" />
-    <Compile Include="Data\Core\ServiceDomainPlatformTransactionManager.cs" />
-    <Compile Include="Data\Core\TxScopeTransactionManager.cs" />
-    <Compile Include="Data\Generic\AdoDaoSupport.cs" />
-    <Compile Include="Data\Generic\IDataAdapterCallback.cs" />
-    <Compile Include="Data\Generic\DataAdapterDelegate.cs" />
-    <Compile Include="Data\Generic\IDbCommandDelegate.cs" />
-    <Compile Include="Data\Generic\IDbCommandCallback.cs" />
-    <Compile Include="Data\Generic\IResultSetExtractor.cs" />
-    <Compile Include="Data\Generic\NamedResultSetProcessor.cs" />
-    <Compile Include="Data\Generic\ResultSetExtractorDelegate.cs" />
-    <Compile Include="Data\Generic\RowMapperDelegate.cs" />
-    <Compile Include="Data\Generic\RowMapperResultSetExtractor.cs" />
-    <Compile Include="Data\ICommonAdoOperations.cs" />
-    <Compile Include="Data\IDataReaderWrapper.cs" />
-    <Compile Include="Data\Objects\AbstractAdoOperation.cs" />
-    <Compile Include="Data\Objects\Generic\AdoOperation.cs" />
-    <Compile Include="Data\Objects\Generic\AdoQuery.cs" />
-    <Compile Include="Data\Objects\Generic\MappingAdoQuery.cs" />
-    <Compile Include="Data\Objects\Generic\MappingAdoQueryWithContext.cs" />
-    <Compile Include="Data\Objects\Generic\StoredProcedure.cs" />
-    <Compile Include="Data\ResultSetExtractorDelegate.cs" />
-    <Compile Include="Data\RowCallbackDelegate.cs" />
-    <Compile Include="Data\Generic\AdoTemplate.cs" />
-    <Compile Include="Data\Generic\CommandDelegate.cs" />
-    <Compile Include="Data\Generic\IAdoOperations.cs" />
-    <Compile Include="Data\Generic\ICommandCallback.cs" />
-    <Compile Include="Data\Generic\IRowMapper.cs" />
-    <Compile Include="Data\IAdoOperations.cs" />
-    <Compile Include="Data\ICommandCallback.cs" />
-    <Compile Include="Data\ICommandSetter.cs" />
-    <Compile Include="Data\ICommandTextProvider.cs" />
-    <Compile Include="Data\IDataAdapterCallback.cs" />
-    <Compile Include="Data\IDataAdapterSetter.cs" />
-    <Compile Include="Data\IDataSetFillLifecycleProcessor.cs" />
-    <Compile Include="Data\IDbCommandCreator.cs" />
-    <Compile Include="Data\IDbCommandCreatorFactory.cs" />
-    <Compile Include="Data\IDbDataAdapterCreator.cs" />
-    <Compile Include="Data\InvalidResultSetAccessException.cs" />
-    <Compile Include="Data\IResultSetExtractor.cs" />
-    <Compile Include="Data\IRowCallback.cs" />
-    <Compile Include="Data\IRowMapper.cs" />
-    <Compile Include="Data\Objects\AdoNonQuery.cs" />
-    <Compile Include="Data\Objects\AdoOperation.cs" />
-    <Compile Include="Data\Objects\AdoQuery.cs" />
-    <Compile Include="Data\Objects\AdoScalar.cs" />
-    <Compile Include="Data\Objects\MappingAdoQuery.cs" />
-    <Compile Include="Data\Objects\MappingAdoQueryWithContext.cs" />
-    <Compile Include="Data\Objects\StoredProcedure.cs" />
-    <Compile Include="Data\RowMapperDelegate.cs" />
-    <Compile Include="Data\Support\AdoTransactionObjectSupport.cs" />
-    <Compile Include="Data\Support\AdoUtils.cs" />
-    <Compile Include="Data\Support\ConnectionHolder.cs" />
-    <Compile Include="Data\Support\ConnectionSynchronization.cs" />
-    <Compile Include="Data\Support\ConnectionTxPair.cs" />
-    <Compile Include="Data\Support\ConnectionUtils.cs" />
-    <Compile Include="Data\Support\DefaultServiceDomainAdapter.cs" />
-    <Compile Include="Data\Support\DefaultTransactionScopeAdapter.cs" />
-    <Compile Include="Data\Support\ErrorCodeExceptionTranslator.cs" />
-    <Compile Include="Data\Support\FallbackExceptionTranslator.cs" />
-    <Compile Include="Data\Support\IAdoExceptionTranslator.cs" />
-    <Compile Include="Data\Support\IServiceDomainAdapter.cs" />
-    <Compile Include="Data\Support\ITransactionScopeAdapter.cs" />
-    <Compile Include="Data\Support\NamedResultSetProcessor.cs" />
-    <Compile Include="Data\Support\NullMappingDataReader.cs" />
-    <Compile Include="Data\Support\ParameterUtils.cs" />
-    <Compile Include="Data\Support\RowCallbackResultSetExtractor.cs" />
-    <Compile Include="Data\Support\SimpleServiceConfig.cs" />
-    <Compile Include="Data\Support\TypedDataSetUtils.cs" />
-    <Compile Include="Data\UncategorizedAdoException.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Transaction\CannotCreateTransactionException.cs" />
-    <Compile Include="Transaction\Config\AttributeDrivenObjectDefinitionParser.cs" />
-    <Compile Include="Transaction\Config\TxNamespaceUtils.cs" />
-    <Compile Include="Transaction\Config\TxAdviceObjectDefinitionParser.cs" />
-    <Compile Include="Transaction\Config\TxNamespaceParser.cs" />
-    <Compile Include="Transaction\HeuristicCompletionException.cs" />
-    <Compile Include="Transaction\IllegalTransactionStateException.cs" />
-    <Compile Include="Transaction\Interceptor\AbstractFallbackTransactionAttributeSource.cs" />
-    <Compile Include="Transaction\Interceptor\AbstractTransactionAttributeSourcePointcut.cs" />
-    <Compile Include="Transaction\Interceptor\AttributesTransactionAttributeSource.cs" />
-    <Compile Include="Transaction\Interceptor\DefaultTransactionAttribute.cs" />
-    <Compile Include="Transaction\Interceptor\DefaultTransactionAttributeSourceAdvisor.cs" />
-    <Compile Include="Transaction\Interceptor\DelegatingTransactionAttributeWithName.cs" />
-    <Compile Include="Transaction\Interceptor\ITransactionAttribute.cs" />
-    <Compile Include="Transaction\Interceptor\ITransactionAttributeSource.cs" />
-    <Compile Include="Transaction\Interceptor\MatchAlwaysTransactionAttributeSource.cs" />
-    <Compile Include="Transaction\Interceptor\MethodMapTransactionAttributeSource.cs" />
-    <Compile Include="Transaction\Interceptor\NameMatchTransactionAttributeSource.cs" />
-    <Compile Include="Transaction\Interceptor\NoRollbackRuleAttribute.cs" />
-    <Compile Include="Transaction\Interceptor\ObjectFactoryTransactionAttributeSourceAdvisor.cs" />
-    <Compile Include="Transaction\Interceptor\RollbackRuleAttribute.cs" />
-    <Compile Include="Transaction\Interceptor\RuleBasedTransactionAttribute.cs" />
-    <Compile Include="Transaction\Interceptor\TransactionAspectSupport.cs" />
-    <Compile Include="Transaction\Interceptor\TransactionAttribute.cs" />
-    <Compile Include="Transaction\Interceptor\TransactionAttributeConverter.cs" />
-    <Compile Include="Transaction\Interceptor\TransactionAttributeEditor.cs" />
-    <Compile Include="Transaction\Interceptor\TransactionAttributeSourceAdvisor.cs" />
-    <Compile Include="Transaction\Interceptor\TransactionAttributeSourceEditor.cs" />
-    <Compile Include="Transaction\Interceptor\TransactionInterceptor.cs" />
-    <Compile Include="Transaction\Interceptor\TransactionProxyFactoryObject.cs" />
-    <Compile Include="Transaction\InvalidIsolationLevelException.cs" />
-    <Compile Include="Transaction\InvalidTimeoutException.cs" />
-    <Compile Include="Transaction\IPlatformTransactionManager.cs" />
-    <Compile Include="Transaction\ISavepointManager.cs" />
-    <Compile Include="Transaction\ITransactionDefinition.cs" />
-    <Compile Include="Transaction\ITransactionStatus.cs" />
-    <Compile Include="Transaction\NestedTransactionNotSupportedException.cs" />
-    <Compile Include="Transaction\NoTransactionException.cs" />
-    <Compile Include="Transaction\Support\AbstractPlatformTransactionManager.cs" />
-    <Compile Include="Transaction\Support\DefaultTransactionDefinition.cs" />
-    <Compile Include="Transaction\Support\DefaultTransactionStatus.cs" />
-    <Compile Include="Transaction\Support\IResourceTransactionManager.cs" />
-    <Compile Include="Transaction\Support\ISmartTransactionObject.cs" />
-    <Compile Include="Transaction\Support\ITransactionCallback.cs" />
-    <Compile Include="Transaction\Support\ITransactionOperations.cs" />
-    <Compile Include="Transaction\Support\ITransactionSynchronization.cs" />
-    <Compile Include="Transaction\Support\ResourceHolderSupport.cs" />
-    <Compile Include="Transaction\Support\TransactionCallbackWithoutResult.cs" />
-    <Compile Include="Transaction\Support\TransactionDelegate.cs" />
-    <Compile Include="Transaction\Support\TransactionSynchronizationAdapter.cs" />
-    <Compile Include="Transaction\Support\TransactionSynchronizationManager.cs" />
-    <Compile Include="Transaction\Support\TransactionSynchronizationState.cs" />
-    <Compile Include="Transaction\Support\TransactionSynchronizationStatus.cs" />
-    <Compile Include="Transaction\Support\TransactionTemplate.cs" />
-    <Compile Include="Transaction\TransactionException.cs" />
-    <Compile Include="Transaction\TransactionOutcomeState.cs" />
-    <Compile Include="Transaction\TransactionPropagation.cs" />
-    <Compile Include="Transaction\TransactionSuspensionNotSupportedException.cs" />
-    <Compile Include="Transaction\TransactionSystemException.cs" />
-    <Compile Include="Transaction\TransactionTimedOutException.cs" />
-    <Compile Include="Transaction\TransactionUsageException.cs" />
-    <Compile Include="Transaction\UnexpectedRollbackException.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\Common\dbproviders.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\Config\spring-database-1.1.xsd">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="Transaction\Config\spring-tx-1.1.xsd">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.Aop\Spring.Aop.2005.csproj">
-      <Project>{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}</Project>
-      <Name>Spring.Aop.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\Config\spring-database-1.3.xsd">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <None Include="Data\Config\spring-database-1.3.xsx">
-      <DependentUpon>spring-database-1.3.xsd</DependentUpon>
-    </None>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>
-    </PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/src/Spring/Spring.Messaging.Ems/Spring.Messaging.Ems.2005.csproj b/src/Spring/Spring.Messaging.Ems/Spring.Messaging.Ems.2005.csproj
deleted file mode 100644
index 1593499a..00000000
--- a/src/Spring/Spring.Messaging.Ems/Spring.Messaging.Ems.2005.csproj
+++ /dev/null
@@ -1,146 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003" ToolsVersion="3.5">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{900E3839-301E-48B1-BAEB-B6645620ACFF}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Messaging.Ems</AssemblyName>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <OldToolsVersion>2.0</OldToolsVersion>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.Messaging.Ems\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-    <DocumentationFile>..\..\..\build\VS.NET.2005\Spring.Messaging.Ems\Debug\Spring.Messaging.Ems.xml</DocumentationFile>
-    <TreatWarningsAsErrors>true</TreatWarningsAsErrors>
-    <NoWarn>1591,0618</NoWarn>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.Messaging.Ems\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=1.2.0.0, Culture=neutral, PublicKeyToken=65e474d141e25e07, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.XML" />
-    <Reference Include="TIBCO.EMS, Version=1.0.0.0, Culture=neutral, PublicKeyToken=5b83db8ff05c64ba, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\TIBCO.EMS.dll</HintPath>
-    </Reference>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="..\CommonAssemblyInfo.cs">
-      <Link>CommonAssemblyInfo.cs</Link>
-    </Compile>
-    <Compile Include="Messaging\Ems\Common\CertificateStoreConfig.cs" />
-    <Compile Include="Messaging\Ems\Common\EmsConnection.cs" />
-    <Compile Include="Messaging\Ems\Common\EmsConnectionFactory.cs" />
-    <Compile Include="Messaging\Ems\Common\EmsMessageConsumer.cs" />
-    <Compile Include="Messaging\Ems\Common\EmsMessageProducer.cs" />
-    <Compile Include="Messaging\Ems\Common\EmsSession.cs" />
-    <Compile Include="Messaging\Ems\Common\EmsSSLFileStoreInfo.cs" />
-    <Compile Include="Messaging\Ems\Common\EmsSSLSystemStoreInfo.cs" />
-    <Compile Include="Messaging\Ems\Common\EmsTopicSubscriber.cs" />
-    <Compile Include="Messaging\Ems\Common\IConnection.cs" />
-    <Compile Include="Messaging\Ems\Common\IConnectionFactory.cs" />
-    <Compile Include="Messaging\Ems\Common\IEmsSSLStoreType.cs" />
-    <Compile Include="Messaging\Ems\Common\IMessageConsumer.cs" />
-    <Compile Include="Messaging\Ems\Common\IMessageProducer.cs" />
-    <Compile Include="Messaging\Ems\Common\ISession.cs" />
-    <Compile Include="Messaging\Ems\Common\ITopicSubscriber.cs" />
-    <Compile Include="Messaging\Ems\Config\MessageListenerContainerObjectDefinitionParser.cs" />
-    <Compile Include="Messaging\Ems\Config\EmsNamespaceParser.cs" />
-    <Compile Include="Messaging\Ems\Connections\CachedMessageConsumer .cs" />
-    <Compile Include="Messaging\Ems\Connections\CachedMessageProducer.cs" />
-    <Compile Include="Messaging\Ems\Connections\CachedSession.cs" />
-    <Compile Include="Messaging\Ems\Connections\CachingConnectionFactory.cs" />
-    <Compile Include="Messaging\Ems\Connections\ChainedExceptionListener.cs" />
-    <Compile Include="Messaging\Ems\Connections\ConnectionFactoryUtils.cs" />
-    <Compile Include="Messaging\Ems\Connections\EmsResourceHolder.cs" />
-    <Compile Include="Messaging\Ems\Connections\EmsTransactionManager.cs" />
-    <Compile Include="Messaging\Ems\Connections\IDecoratorSession.cs" />
-    <Compile Include="Messaging\Ems\Connections\ISmartConnectionFactory.cs" />
-    <Compile Include="Messaging\Ems\Connections\SingleConnectionFactory.cs" />
-    <Compile Include="Messaging\Ems\Connections\SynchedLocalTransactionFailedException.cs" />
-    <Compile Include="Messaging\Ems\Core\BrowserDelegate.cs" />
-    <Compile Include="Messaging\Ems\Core\EmsGatewaySupport.cs" />
-    <Compile Include="Messaging\Ems\Core\EmsTemplate.cs" />
-    <Compile Include="Messaging\Ems\Core\IBrowserCallback.cs" />
-    <Compile Include="Messaging\Ems\Core\IEmsOperations.cs" />
-    <Compile Include="Messaging\Ems\Core\IMessageCreator.cs" />
-    <Compile Include="Messaging\Ems\Core\IMessagePostProcessor.cs" />
-    <Compile Include="Messaging\Ems\Core\IProducerCallback.cs" />
-    <Compile Include="Messaging\Ems\Core\ISessionCallback.cs" />
-    <Compile Include="Messaging\Ems\Core\MessageCreatorDelegate.cs" />
-    <Compile Include="Messaging\Ems\Core\MessagePostProcessorDelegate.cs" />
-    <Compile Include="Messaging\Ems\Core\ProducerDelegate.cs" />
-    <Compile Include="Messaging\Ems\Core\SessionDelegate.cs" />
-    <Compile Include="Messaging\Ems\Listener\AbstractListenerContainer.cs" />
-    <Compile Include="Messaging\Ems\Listener\AbstractMessageListenerContainer.cs" />
-    <Compile Include="Messaging\Ems\Listener\Adapter\ListenerExecutionFailedException.cs" />
-    <Compile Include="Messaging\Ems\Listener\Adapter\MessageListenerAdapter.cs" />
-    <Compile Include="Messaging\Ems\Listener\ISessionAwareMessageListener.cs" />
-    <Compile Include="Messaging\Ems\Listener\LocallyExposedEmsResourceHolder.cs" />
-    <Compile Include="Messaging\Ems\Listener\RecoveryTimeExceededException.cs" />
-    <Compile Include="Messaging\Ems\Listener\SimpleMessageListenerContainer.cs" />
-    <Compile Include="Messaging\Ems\Support\Converter\IMessageConverter.cs" />
-    <Compile Include="Messaging\Ems\Support\Converter\ITypeMapper.cs" />
-    <Compile Include="Messaging\Ems\Support\Converter\MessageConversionException.cs" />
-    <Compile Include="Messaging\Ems\Support\Converter\SimpleMessageConverter.cs" />
-    <Compile Include="Messaging\Ems\Support\Converter\TypeMapper.cs" />
-    <Compile Include="Messaging\Ems\Support\Converter\XmlMessageConverter.cs" />
-    <Compile Include="Messaging\Ems\Support\Destinations\DynamicDestinationResolver.cs" />
-    <Compile Include="Messaging\Ems\Support\Destinations\IDestinationResolver.cs" />
-    <Compile Include="Messaging\Ems\Support\Destinations\EmsDestinationAccessor.cs" />
-    <Compile Include="Messaging\Ems\Support\EmsAccessor.cs" />
-    <Compile Include="Messaging\Ems\Support\EmsUtils.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Messaging\Ems\Config\spring-ems-1.3.xsd">
-      <SubType>
-      </SubType>
-    </EmbeddedResource>
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.Aop\Spring.Aop.2005.csproj">
-      <Project>{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}</Project>
-      <Name>Spring.Aop.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Data\Spring.Data.2005.csproj">
-      <Project>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</Project>
-      <Name>Spring.Data.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it.
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/src/Spring/Spring.Messaging.Nms/Spring.Messaging.Nms.2003.csproj b/src/Spring/Spring.Messaging.Nms/Spring.Messaging.Nms.2003.csproj
deleted file mode 100644
index 2310df56..00000000
--- a/src/Spring/Spring.Messaging.Nms/Spring.Messaging.Nms.2003.csproj
+++ /dev/null
@@ -1,324 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{C17B27C2-4343-45BA-9A21-73C3CEC19BAD}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Messaging.Nms"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = "Spring.Messaging.Nms.xml"
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = "1591;0168;1570;1574"
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.NET.2003\Spring.Messaging.Nms\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.NET.2003\Spring.Messaging.Nms.2003\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\lib\net\1.1\Common.Logging.dll"
-                />
-                <Reference
-                    Name = "Spring.Aop.2003"
-                    Project = "{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Core.2003"
-                    Project = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Data.2003"
-                    Project = "{E10A3BED-795F-41CB-A4A8-8C4B342ACDDF}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Apache.NMS"
-                    AssemblyName = "Apache.NMS"
-                    HintPath = "..\..\..\lib\Net\1.1\Apache.NMS.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "Messaging\Nms\Config\MessageListenerContainerObjectDefinitionParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Config\NmsNamespaceParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Config\spring-nms-1.2.xsd"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Connections\CachedMessageProducer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Connections\CachedSession.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Connections\CachingConnectionFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Connections\ChainedExceptionListener.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Connections\ConnectionFactoryUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Connections\IDecoratorSession.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Connections\ISmartConnectionFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Connections\NmsResourceHolder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Connections\NmsTransactionManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Connections\SingleConnectionFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Connections\SynchedLocalTransactionFailedException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Core\IExceptionListener.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Core\IMessageCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Core\IMessageListener.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Core\IMessagePostProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Core\INmsOperations.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Core\IProducerCallback.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Core\ISessionCallback.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Core\MessageCreatorDelegate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Core\MessagePostProcessorDelegate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Core\NmsGatewaySupport.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Core\NmsTemplate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Core\ProducerDelegate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Core\SessionDelegate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Listener\AbstractListenerContainer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Listener\AbstractMessageListenerContainer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Listener\ISessionAwareMessageListener.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Listener\LocallyExposedNmsResourceHolder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Listener\SimpleMessageListenerContainer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Listener\Adapter\ListenerExecutionFailedException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Listener\Adapter\MessageListenerAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Support\MessageUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Support\NmsAccessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Support\Converter\IMessageConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Support\Converter\MessageConversionException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Support\Converter\SimpleMessageConverter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Support\Destinations\DynamicDestinationResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Support\Destinations\IDestinationResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Messaging\Nms\Support\Destinations\NmsDestinationAccessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/src/Spring/Spring.Messaging.Nms/Spring.Messaging.Nms.2005.csproj b/src/Spring/Spring.Messaging.Nms/Spring.Messaging.Nms.2005.csproj
deleted file mode 100644
index cee9b4f2..00000000
--- a/src/Spring/Spring.Messaging.Nms/Spring.Messaging.Nms.2005.csproj
+++ /dev/null
@@ -1,120 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{AEB1578C-9018-4D49-B440-789F38DD2F29}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Messaging.Nms</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.Messaging.Nms\Debug\</OutputPath>
-    <DefineConstants>DEBUG;TRACE</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-    <DocumentationFile>..\..\..\build\VS.NET.2005\Spring.Messaging.Nms\Debug\Spring.Messaging.Nms.xml</DocumentationFile>
-    <TreatWarningsAsErrors>true</TreatWarningsAsErrors>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.Messaging.Nms\Release\</OutputPath>
-    <DefineConstants>TRACE</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Apache.NMS, Version=1.0.0.0, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Apache.NMS.dll</HintPath>
-    </Reference>
-    <Reference Include="Common.Logging, Version=1.1.0.2, Culture=neutral, PublicKeyToken=65e474d141e25e07, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="Messaging\Nms\Connections\CachedMessageConsumer .cs" />
-    <Compile Include="Messaging\Nms\Core\IExceptionListener.cs" />
-    <Compile Include="Messaging\Nms\Core\IMessageCreator.cs" />
-    <Compile Include="Messaging\Nms\Core\IMessageListener.cs" />
-    <Compile Include="Messaging\Nms\Core\INmsOperations.cs" />
-    <Compile Include="Messaging\Nms\Core\IMessagePostProcessor.cs" />
-    <Compile Include="Messaging\Nms\Core\IProducerCallback.cs" />
-    <Compile Include="Messaging\Nms\Core\ISessionCallback.cs" />
-    <Compile Include="Messaging\Nms\Core\MessageCreatorDelegate.cs" />
-    <Compile Include="Messaging\Nms\Core\MessagePostProcessorDelegate.cs" />
-    <Compile Include="Messaging\Nms\Core\NmsTemplate.cs" />
-    <Compile Include="Messaging\Nms\Core\NmsGatewaySupport.cs" />
-    <Compile Include="Messaging\Nms\Core\NmsTrace.cs" />
-    <Compile Include="Messaging\Nms\Core\ProducerDelegate.cs" />
-    <Compile Include="Messaging\Nms\Core\SessionDelegate.cs" />
-    <Compile Include="Messaging\Nms\Config\MessageListenerContainerObjectDefinitionParser.cs" />
-    <Compile Include="Messaging\Nms\Config\NmsNamespaceParser.cs" />
-    <Compile Include="Messaging\Nms\Connections\CachedMessageProducer.cs" />
-    <Compile Include="Messaging\Nms\Connections\CachedSession.cs" />
-    <Compile Include="Messaging\Nms\Connections\CachingConnectionFactory.cs" />
-    <Compile Include="Messaging\Nms\Connections\ChainedExceptionListener.cs" />
-    <Compile Include="Messaging\Nms\Connections\ConnectionFactoryUtils.cs" />
-    <Compile Include="Messaging\Nms\Connections\IDecoratorSession.cs" />
-    <Compile Include="Messaging\Nms\Connections\ISmartConnectionFactory.cs" />
-    <Compile Include="Messaging\Nms\Connections\NmsResourceHolder.cs" />
-    <Compile Include="Messaging\Nms\Connections\NmsTransactionManager.cs" />
-    <Compile Include="Messaging\Nms\Connections\SingleConnectionFactory.cs" />
-    <Compile Include="Messaging\Nms\Connections\SynchedLocalTransactionFailedException.cs" />
-    <Compile Include="Messaging\Nms\Listener\AbstractListenerContainer.cs" />
-    <Compile Include="Messaging\Nms\Listener\AbstractMessageListenerContainer.cs" />
-    <Compile Include="Messaging\Nms\Listener\Adapter\ListenerExecutionFailedException.cs" />
-    <Compile Include="Messaging\Nms\Listener\Adapter\MessageListenerAdapter.cs" />
-    <Compile Include="Messaging\Nms\Listener\ISessionAwareMessageListener.cs" />
-    <Compile Include="Messaging\Nms\Listener\LocallyExposedNmsResourceHolder.cs" />
-    <Compile Include="Messaging\Nms\Listener\RecoveryTimeExceededException.cs" />
-    <Compile Include="Messaging\Nms\Listener\SimpleMessageListenerContainer.cs" />
-    <Compile Include="Messaging\Nms\Support\Converter\IMessageConverter.cs" />
-    <Compile Include="Messaging\Nms\Support\Converter\ITypeMapper.cs" />
-    <Compile Include="Messaging\Nms\Support\Converter\MessageConversionException.cs" />
-    <Compile Include="Messaging\Nms\Support\Converter\SimpleMessageConverter.cs" />
-    <Compile Include="Messaging\Nms\Support\Converter\TypeMapper.cs" />
-    <Compile Include="Messaging\Nms\Support\Converter\XmlMessageConverter.cs" />
-    <Compile Include="Messaging\Nms\Support\Destinations\DynamicDestinationResolver.cs" />
-    <Compile Include="Messaging\Nms\Support\Destinations\IDestinationResolver.cs" />
-    <Compile Include="Messaging\Nms\Support\Destinations\NmsDestinationAccessor.cs" />
-    <Compile Include="Messaging\Nms\Support\NmsAccessor.cs" />
-    <Compile Include="Messaging\Nms\Support\MessageUtils.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Data\Spring.Data.2005.csproj">
-      <Project>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</Project>
-      <Name>Spring.Data.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Messaging\Nms\Config\spring-nms-1.2.xsd">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-  </ItemGroup>
-  <ItemGroup>
-    <Folder Include="Properties\" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/src/Spring/Spring.Messaging/Spring.Messaging.2005.csproj b/src/Spring/Spring.Messaging/Spring.Messaging.2005.csproj
deleted file mode 100644
index 054da5e9..00000000
--- a/src/Spring/Spring.Messaging/Spring.Messaging.2005.csproj
+++ /dev/null
@@ -1,111 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{0E23AE41-D8D8-41C2-84A2-D35564049F0D}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Messaging</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Messaging\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-    <DocumentationFile>Spring.Messaging.xml</DocumentationFile>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Messaging\Release\</OutputPath>
-    <DefineConstants>TRACE</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=1.2.0.0, Culture=neutral, PublicKeyToken=af08829b84f0328e">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Messaging" />
-    <Reference Include="System.Transactions" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="..\CommonAssemblyInfo.cs">
-      <Link>CommonAssemblyInfo.cs</Link>
-    </Compile>
-    <Compile Include="AssemblyInfo.cs" />
-    <Compile Include="Messaging\Core\DefaultMessageQueueFactory.cs" />
-    <Compile Include="Messaging\Core\IMessageQueueFactory.cs" />
-    <Compile Include="Messaging\Core\MessagePostProcessorDelegate.cs" />
-    <Compile Include="Messaging\Core\MessageQueueGatewaySupport.cs" />
-    <Compile Include="Messaging\Core\MessageQueueMetadata.cs" />
-    <Compile Include="Messaging\Core\MessageQueueMetadataCache.cs" />
-    <Compile Include="Messaging\Core\QueueUtils.cs" />
-    <Compile Include="Messaging\Listener\AbstractSendToQueueExceptionHandler.cs" />
-    <Compile Include="Messaging\Listener\AbstractTransactionalMessageListenerContainer.cs" />
-    <Compile Include="Messaging\Listener\DistributedTxMessageListenerContainer.cs" />
-    <Compile Include="Messaging\Listener\ListenerExecutionFailedException.cs" />
-    <Compile Include="Messaging\Listener\MessageListenerAdapter.cs" />
-    <Compile Include="Messaging\Listener\SendToQueueDistributedTransactionExceptionHandler.cs" />
-    <Compile Include="Messaging\Listener\TransactionalMessageListenerContainer.cs" />
-    <Compile Include="Messaging\Listener\NonTransactionalMessageListenerContainer.cs" />
-    <Compile Include="Messaging\Core\IMessageQueueOperations.cs" />
-    <Compile Include="Messaging\Core\LocallyExposedMessageQueueResourceHolder.cs" />
-    <Compile Include="Messaging\Core\MessageQueueResourceHolder.cs" />
-    <Compile Include="Messaging\Core\MessageQueueTransactionManager.cs" />
-    <Compile Include="Messaging\Core\MessageQueueTemplate.cs" />
-    <Compile Include="Messaging\Listener\AbstractListenerContainer.cs" />
-    <Compile Include="Messaging\Listener\AbstractMessageListenerContainer.cs" />
-    <Compile Include="Messaging\Listener\IDistributedTransactionExceptionHandler.cs" />
-    <Compile Include="Messaging\Listener\IMessageTransactionExceptionHandler.cs" />
-    <Compile Include="Messaging\Listener\AbstractPeekingMessageListenerContainer.cs" />
-    <Compile Include="Messaging\Listener\SendToQueueExceptionHandler.cs" />
-    <Compile Include="Messaging\Listener\TransactionAction.cs" />
-    <Compile Include="Messaging\Listener\IExceptionHandler.cs" />
-    <Compile Include="Messaging\Listener\IMessageListener.cs" />
-    <Compile Include="Messaging\MessagingException.cs" />
-    <Compile Include="Messaging\Support\Converters\ActiveXMessageConverter.cs" />
-    <Compile Include="Messaging\Support\Converters\BinaryMessageConverter.cs" />
-    <Compile Include="Messaging\Support\Converters\IMessageConverter.cs" />
-    <Compile Include="Messaging\Support\Converters\MessageConverterCreatorDelegate.cs" />
-    <Compile Include="Messaging\Support\Converters\MessageConverterFactoryObject.cs" />
-    <Compile Include="Messaging\Support\Converters\XmlDocumentConverter.cs" />
-    <Compile Include="Messaging\Support\Converters\XmlMessageConverter.cs" />
-    <Compile Include="Messaging\Support\MessageQueueCreatorDelegate.cs" />
-    <Compile Include="Messaging\Support\MessageQueueFactoryObject.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Data\Spring.Data.2005.csproj">
-      <Project>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</Project>
-      <Name>Spring.Data.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="Messaging\Listener\ListenerClassDiagram.cd" />
-  </ItemGroup>
-  <ItemGroup>
-    <Folder Include="Properties\" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/src/Spring/Spring.Scheduling.Quartz/Spring.Scheduling.Quartz.2003.csproj b/src/Spring/Spring.Scheduling.Quartz/Spring.Scheduling.Quartz.2003.csproj
deleted file mode 100644
index 9d81f9be..00000000
--- a/src/Spring/Spring.Scheduling.Quartz/Spring.Scheduling.Quartz.2003.csproj
+++ /dev/null
@@ -1,240 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{0C0D8C65-90DE-4914-9940-4C684C54971B}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Scheduling.Quartz"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = "Spring.Scheduling.Quartz.xml"
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.NET.2003\Spring.Scheduling.Quartz\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.NET.2003\Spring.Scheduling.Quartz\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\lib\net\1.1\Common.Logging.dll"
-                />
-                <Reference
-                    Name = "Quartz"
-                    AssemblyName = "Quartz"
-                    HintPath = "..\..\..\lib\net\1.1\Quartz.dll"
-                />
-                <Reference
-                    Name = "Nullables"
-                    AssemblyName = "Nullables"
-                    HintPath = "..\..\..\lib\net\1.1\Nullables.dll"
-                />
-                <Reference
-                    Name = "Spring.Core.2003"
-                    Project = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Data.2003"
-                    Project = "{E10A3BED-795F-41CB-A4A8-8C4B342ACDDF}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "JobMethodInvocationFailedException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\AdaptableJobFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\CronTriggerObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\DelegatingJob.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\IJobDetailAwareTrigger.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\ISchedulerContextAware.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\ISchedulingTaskExecutor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\ITaskExecutor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\JobDetailObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\LocalDataSourceJobStore.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\LocalTaskExecutorThreadPool.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\MethodInvokingJob.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\MethodInvokingJobDetailFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\MethodInvokingRunnable.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\QuartzJobObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\ResourceJobSchedulingDataProcessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\SchedulerAccessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\SchedulerAccessorObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\SchedulerFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\SchedulingException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\SimpleThreadPoolTaskExecutor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\SimpleTriggerObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\SpringDbProviderAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\SpringObjectJobFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\StatefulMethodInvokingJob.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\TaskRejectedException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/src/Spring/Spring.Scheduling.Quartz/Spring.Scheduling.Quartz.2005.csproj b/src/Spring/Spring.Scheduling.Quartz/Spring.Scheduling.Quartz.2005.csproj
deleted file mode 100644
index 876d3780..00000000
--- a/src/Spring/Spring.Scheduling.Quartz/Spring.Scheduling.Quartz.2005.csproj
+++ /dev/null
@@ -1,94 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003" ToolsVersion="3.5">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{E823D54C-CE82-4868-929F-5F95A999F61E}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Scheduling.Quartz</AssemblyName>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <OldToolsVersion>2.0</OldToolsVersion>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.Scheduling.Quartz\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-    <DocumentationFile>..\..\..\build\VS.NET.2005\Spring.Scheduling.Quartz\Debug\Spring.Scheduling.Quartz.xml</DocumentationFile>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.Scheduling.Quartz\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=1.1.0.0, Culture=neutral, PublicKeyToken=af08829b84f0328e">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="Quartz, Version=0.6.0.21049, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\net\2.0\Quartz.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="JobMethodInvocationFailedException.cs" />
-    <Compile Include="Scheduling\Quartz\AdaptableJobFactory.cs" />
-    <Compile Include="Scheduling\Quartz\CronTriggerObject.cs" />
-    <Compile Include="Scheduling\Quartz\DelegatingJob.cs" />
-    <Compile Include="Scheduling\Quartz\IJobDetailAwareTrigger.cs" />
-    <Compile Include="Scheduling\Quartz\ISchedulerContextAware.cs" />
-    <Compile Include="Scheduling\Quartz\ISchedulingTaskExecutor.cs" />
-    <Compile Include="Scheduling\Quartz\ITaskExecutor.cs" />
-    <Compile Include="Scheduling\Quartz\JobDetailObject.cs" />
-    <Compile Include="Scheduling\Quartz\LocalDataSourceJobStore.cs" />
-    <Compile Include="Scheduling\Quartz\LocalTaskExecutorThreadPool.cs" />
-    <Compile Include="Scheduling\Quartz\MethodInvokingJob.cs" />
-    <Compile Include="Scheduling\Quartz\MethodInvokingJobDetailFactoryObject.cs" />
-    <Compile Include="Scheduling\Quartz\MethodInvokingRunnable.cs" />
-    <Compile Include="Scheduling\Quartz\QuartzJobObject.cs" />
-    <Compile Include="Scheduling\Quartz\ResourceJobSchedulingDataProcessor.cs" />
-    <Compile Include="Scheduling\Quartz\SchedulerAccessor.cs" />
-    <Compile Include="Scheduling\Quartz\SchedulerAccessorObject.cs" />
-    <Compile Include="Scheduling\Quartz\SchedulerFactoryObject.cs" />
-    <Compile Include="Scheduling\Quartz\SchedulingException.cs" />
-    <Compile Include="Scheduling\Quartz\SimpleThreadPoolTaskExecutor.cs" />
-    <Compile Include="Scheduling\Quartz\SimpleTriggerObject.cs" />
-    <Compile Include="Scheduling\Quartz\SpringDbProviderAdapter.cs" />
-    <Compile Include="Scheduling\Quartz\SpringObjectJobFactory.cs" />
-    <Compile Include="Scheduling\Quartz\StatefulMethodInvokingJob.cs" />
-    <Compile Include="Scheduling\Quartz\TaskRejectedException.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Data\Spring.Data.2005.csproj">
-      <Project>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</Project>
-      <Name>Spring.Data.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/src/Spring/Spring.Services/Spring.Services.2003.csproj b/src/Spring/Spring.Services/Spring.Services.2003.csproj
deleted file mode 100644
index 29ba0255..00000000
--- a/src/Spring/Spring.Services/Spring.Services.2003.csproj
+++ /dev/null
@@ -1,223 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Services"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;NET_1_1"
-                    DocumentationFile = "Spring.Services.xml"
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Services\Debug-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "true"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Services\Release-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "system.enterpriseservices"
-                    AssemblyName = "System.EnterpriseServices"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\system.enterpriseservices.dll"
-                />
-                <Reference
-                    Name = "system.web.services"
-                    AssemblyName = "System.Web.Services"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\system.web.services.dll"
-                />
-                <Reference
-                    Name = "Spring.Core.2003"
-                    Project = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\lib\Net\1.1\Common.Logging.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "CommonAssemblyInfo.cs"
-                    Link = "..\CommonAssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Spring.Services.build"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "EnterpriseServices\EnterpriseServices.keys"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "EnterpriseServices\EnterpriseServicesExporter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "EnterpriseServices\ServicedComponentContextHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "EnterpriseServices\ServicedComponentExporter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "EnterpriseServices\ServicedComponentFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "EnterpriseServices\ServicedComponentHelper.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\CaoExporter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\CaoFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\RemoteObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\RemotingConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\SaoExporter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\SaoFactoryObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\Config\RemotingNamespaceParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\Config\spring-remoting-1.1.xsd"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Remoting\Support\BaseRemoteObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\Support\ConfigurableLifetime.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\Support\ICaoRemoteFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\Support\ILifetime.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\Support\RemoteObjectProxyTypeBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Services\WebServiceProxyFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/src/Spring/Spring.Services/Spring.Services.2005.csproj b/src/Spring/Spring.Services/Spring.Services.2005.csproj
deleted file mode 100644
index f7cbf165..00000000
--- a/src/Spring/Spring.Services/Spring.Services.2005.csproj
+++ /dev/null
@@ -1,149 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.Services</AssemblyName>
-    <AssemblyOriginatorKeyFile>..\..\..\Spring.Net.snk</AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Library</OutputType>
-    <RootNamespace>Spring</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-    <SignAssembly>false</SignAssembly>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Services\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <DocumentationFile>Spring.Services.xml</DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>true</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Services\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=2.1.0.0, Culture=neutral, PublicKeyToken=65e474d141e25e07, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="System">
-      <Name>System</Name>
-    </Reference>
-    <Reference Include="System.configuration" />
-    <Reference Include="System.Data">
-      <Name>System.Data</Name>
-    </Reference>
-    <Reference Include="System.EnterpriseServices">
-      <Name>system.enterpriseservices</Name>
-    </Reference>
-    <Reference Include="System.Web.Services">
-      <Name>system.web.services</Name>
-    </Reference>
-    <Reference Include="System.Xml">
-      <Name>System.XML</Name>
-    </Reference>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="..\CommonAssemblyInfo.cs">
-      <Link>CommonAssemblyInfo.cs</Link>
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="AssemblyInfo.cs" />
-    <Compile Include="EnterpriseServices\EnterpriseServicesExporter.cs" />
-    <Compile Include="EnterpriseServices\ExeConfigurationSystem.cs" />
-    <Compile Include="EnterpriseServices\ServicedComponentHelper.cs" />
-    <Compile Include="EnterpriseServices\ServicedComponentContextHandler.cs" />
-    <Compile Include="EnterpriseServices\ServicedComponentExporter.cs" />
-    <Compile Include="EnterpriseServices\ServicedComponentFactory.cs" />
-    <Compile Include="Remoting\CaoExporter.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Remoting\CaoFactoryObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Remoting\Config\RemotingNamespaceParser.cs" />
-    <Compile Include="Remoting\RemotingConfigurer.cs" />
-    <Compile Include="Remoting\RemoteObjectFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Remoting\Support\BaseRemoteObject.cs" />
-    <Compile Include="Remoting\Support\ConfigurableLifetime.cs" />
-    <Compile Include="Remoting\Support\ICaoRemoteFactory.cs" />
-    <Compile Include="Remoting\Support\ILifetime.cs" />
-    <Compile Include="Remoting\Support\RemoteObjectProxyTypeBuilder.cs" />
-    <Compile Include="Remoting\SaoExporter.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Remoting\SaoFactoryObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Web\Services\WebServiceProxyFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <EmbeddedResource Include="EnterpriseServices\EnterpriseServices.keys" />
-    <EmbeddedResource Include="Remoting\Config\spring-remoting-1.1.xsd">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <None Include="Spring.Services.build" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>
-    </PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/src/Spring/Spring.Testing.NUnit/Spring.Testing.NUnit.2003.csproj b/src/Spring/Spring.Testing.NUnit/Spring.Testing.NUnit.2003.csproj
deleted file mode 100644
index 43d022b4..00000000
--- a/src/Spring/Spring.Testing.NUnit/Spring.Testing.NUnit.2003.csproj
+++ /dev/null
@@ -1,146 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{6B8639E3-88BB-4F7B-9F23-699E84C30D58}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Testing.NUnit"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;NET_1_1"
-                    DocumentationFile = "Spring.Testing.NUnit.xml"
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = "1587, 1591, 219, 162"
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Testing.NUnit\Debug-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Testing.NUnit\Release-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "Spring.Core.2003"
-                    Project = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Data.2003"
-                    Project = "{E10A3BED-795F-41CB-A4A8-8C4B342ACDDF}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "nunit.framework"
-                    AssemblyName = "nunit.framework"
-                    HintPath = "..\..\..\lib\Net\1.1\nunit.framework.dll"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\lib\Net\1.1\Common.Logging.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "CommonAssemblyInfo.cs"
-                    Link = "..\CommonAssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Testing\Ado\IPlatformTransaction.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Testing\Ado\SimpleAdoTestUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Testing\NUnit\AbstractDependencyInjectionSpringContextTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Testing\NUnit\AbstractSpringContextTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Testing\NUnit\AbstractTransactionalDbProviderSpringContextTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Testing\NUnit\AbstractTransactionalSpringContextTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/src/Spring/Spring.Testing.NUnit/Spring.Testing.NUnit.2005.csproj b/src/Spring/Spring.Testing.NUnit/Spring.Testing.NUnit.2005.csproj
deleted file mode 100644
index 3926b582..00000000
--- a/src/Spring/Spring.Testing.NUnit/Spring.Testing.NUnit.2005.csproj
+++ /dev/null
@@ -1,75 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Testing.NUnit</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Testing.NUnit\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-    <DocumentationFile>Spring.Testing.NUnit.xml</DocumentationFile>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Testing.NUnit\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-    <NoWarn>1587, 1591, 219, 162, 618</NoWarn>
-    <DocumentationFile>Spring.Testing.NUnit.xml</DocumentationFile>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=1.0.2.0, Culture=neutral, PublicKeyToken=af08829b84f0328e">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.framework, Version=2.4.1.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="..\CommonAssemblyInfo.cs">
-      <Link>CommonAssemblyInfo.cs</Link>
-    </Compile>
-    <Compile Include="AssemblyInfo.cs" />
-    <Compile Include="Testing\Ado\IPlatformTransaction.cs" />
-    <Compile Include="Testing\Ado\SimpleAdoTestUtils.cs" />
-    <Compile Include="Testing\NUnit\AbstractDependencyInjectionSpringContextTests.cs" />
-    <Compile Include="Testing\NUnit\AbstractSpringContextTests.cs" />
-    <Compile Include="Testing\NUnit\AbstractTransactionalDbProviderSpringContextTests.cs" />
-    <Compile Include="Testing\NUnit\AbstractTransactionalSpringContextTests.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Data\Spring.Data.2005.csproj">
-      <Project>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</Project>
-      <Name>Spring.Data.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it.
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/src/Spring/Spring.Web.Extensions/Spring.Web.Extensions.2005.csproj b/src/Spring/Spring.Web.Extensions/Spring.Web.Extensions.2005.csproj
deleted file mode 100644
index 46fb6f94..00000000
--- a/src/Spring/Spring.Web.Extensions/Spring.Web.Extensions.2005.csproj
+++ /dev/null
@@ -1,69 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{E5E287D2-EE2C-4C99-87CA-EB27B35ABF7B}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Web.Extensions</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Web.Extensions\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-    <DocumentationFile>Spring.Web.Extensions.xml</DocumentationFile>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Web.Extensions\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=1.0.2.0, Culture=neutral, PublicKeyToken=af08829b84f0328e">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Web" />
-    <Reference Include="System.Web.Extensions, Version=1.0.61025.0, Culture=neutral, PublicKeyToken=31bf3856ad364e35, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\System.Web.Extensions.dll</HintPath>
-    </Reference>
-    <Reference Include="System.Web.Services" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="..\CommonAssemblyInfo.cs">
-      <Link>CommonAssemblyInfo.cs</Link>
-    </Compile>
-    <Compile Include="AssemblyInfo.cs" />
-    <Compile Include="Web\Script\Services\ScriptHandlerFactory.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Web\Spring.Web.2005.csproj">
-      <Project>{BA4789EB-281A-48EA-8763-28B9F0596A18}</Project>
-      <Name>Spring.Web.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it.
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/src/Spring/Spring.Web/Spring.Web.2003.csproj b/src/Spring/Spring.Web/Spring.Web.2003.csproj
deleted file mode 100644
index ee8aae88..00000000
--- a/src/Spring/Spring.Web/Spring.Web.2003.csproj
+++ /dev/null
@@ -1,767 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{BA4789EB-281A-48EA-8763-28B9F0596A18}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Web"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;NET_1_1"
-                    DocumentationFile = "Spring.Web.xml"
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Web\Debug-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Web\Release-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                />
-                <Reference
-                    Name = "system.web"
-                    AssemblyName = "System.Web"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\system.web.dll"
-                />
-                <Reference
-                    Name = "system.web.services"
-                    AssemblyName = "System.Web.Services"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\system.web.services.dll"
-                />
-                <Reference
-                    Name = "system.enterpriseservices"
-                    AssemblyName = "System.EnterpriseServices"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\system.enterpriseservices.dll"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\lib\Net\1.1\Common.Logging.dll"
-                />
-                <Reference
-                    Name = "Spring.Core.2003"
-                    Project = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "CommonAssemblyInfo.cs"
-                    Link = "..\CommonAssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Spring.Web.build"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Caching\AspNetCache.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\HttpApplicationConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\WebApplicationContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\WebApplicationContextArgs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\WebContextHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\WebSupportModule.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\WebResource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\DataSourceItemFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\HttpRequestBindingContainer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\IBindingAwareFormatter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\IWebDataBound.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\MultipleSelectionListControlBinding.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\AspNetResourceCache.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Resolvers\CookieCultureResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Resolvers\DefaultWebCultureResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Resolvers\RequestCultureResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Resolvers\SessionCultureResolver.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ChildWebObjectDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\IWebObjectDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\IWebObjectNameGenerator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\RootWebObjectDefinition.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\WebInstantiationStrategy.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\WebObjectDefinitionFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\WebObjectFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\WebObjectUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\WebObjectDefinitionDocumentReader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\WebObjectDefinitionParserHelper.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\WebObjectDefinitionReader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\WebObjectsNamespaceParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\HttpContextStorage.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\HybridContextStorage.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\HttpContextSwitch.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ISessionState.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\IVirtualEnvironment.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\SecurityCritical.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\VirtualEnvironment.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\WebUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Providers\ConfigurableActiveDirectoryMembershipProvider.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Providers\ConfigurableSqlMembershipProvider.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Providers\ConfigurableSqlProfileProvider.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Providers\ConfigurableSqlRoleProvider.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Providers\ConfigurableXmlSiteMapProvider.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Providers\IMembershipProvider.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Providers\IProfileProvider.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Providers\IRoleProvider.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Providers\ISiteMapProvider.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Providers\MembershipProviderAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Providers\ProfileProviderAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Providers\RoleProviderAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Providers\SiteMapProviderAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Services\WebServiceExporter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Services\WebServiceHandlerFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\AbstractHandlerFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\ContextMonitor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\ControlAccessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\ControlCollectionAccessor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\ControlInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\DefaultHandlerFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\DefaultResultFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\DefaultResultWebNavigator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\HandlerMap.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\HandlerMapEntry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\IHierarchicalWebNavigator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\IInterceptionStrategy.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\InterceptControlCollectionOwnerStrategy.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\InterceptControlCollectionStrategy.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\IResult.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\IResultFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\IResultWebNavigator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\ISupportsWebDependencyInjection.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\IWebNavigable.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\IWebNavigator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\LocalResourceManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\MappingHandlerFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\MappingHandlerFactoryConfigurer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\MimeMediaType.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\PageHandlerFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\Result.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\ResultFactoryRegistry.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\ResultMode.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\Script.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\SharedStateResourceCache.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\SupportsWebDependencyInjectionMethodBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\SupportsWebDependencyInjectionOwnerProxy.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\SupportsWebDependencyInjectionTypeBuilder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\WebDependencyInjectionUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\WebFormsResultWebNavigator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\WebNavigableWebNavigatorAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\AbstractWizard.cs"
-                    SubType = "ASPXCodeBehind"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\DialogAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\IModelPersistenceMedium.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\IValidationContainer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\MasterPage.cs"
-                    SubType = "ASPXCodeBehind"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Page.cs"
-                    SubType = "ASPXCodeBehind"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\SessionModelPersistenceMedium.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\UserControl.cs"
-                    SubType = "ASPXCodeBehind"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\AbstractBaseValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\AbstractValidationControl.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\Calendar.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\CheckBoxList.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\CheckBoxValidator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\Content.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\ContentPlaceHolder.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\ContentReplacer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\ControlState.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\DataBindingAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\DataBindingPanel.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\Form.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\Head.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\LocalizedImage.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\MultiView.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\Panel.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\RadioButtonGroup.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\TabCommandEventArgs.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\TabCommandEventHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\TabContainer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\TabularMultiView.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\TabularView.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\TabularViewCollection.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\ValidationError.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\ValidationSummary.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\View.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\ViewCollection.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Validation\AbstractValidationErrorsRenderer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Validation\DivValidationErrorsRenderer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Validation\IconValidationErrorsRenderer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Validation\IValidationErrorsRenderer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Validation\SpanValidationErrorsRenderer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/src/Spring/Spring.Web/Spring.Web.2005.csproj b/src/Spring/Spring.Web/Spring.Web.2005.csproj
deleted file mode 100644
index 20d7637c..00000000
--- a/src/Spring/Spring.Web/Spring.Web.2005.csproj
+++ /dev/null
@@ -1,305 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{BA4789EB-281A-48EA-8763-28B9F0596A18}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.Web</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Library</OutputType>
-    <RootNamespace>Spring</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Web\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <DocumentationFile>Spring.Web.xml</DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Web\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=2.1.0.0, Culture=neutral, PublicKeyToken=65e474d141e25e07, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="System">
-      <Name>System</Name>
-    </Reference>
-    <Reference Include="System.configuration" />
-    <Reference Include="System.Data">
-      <Name>System.Data</Name>
-    </Reference>
-    <Reference Include="System.DirectoryServices" />
-    <Reference Include="System.EnterpriseServices">
-      <Name>system.enterpriseservices</Name>
-    </Reference>
-    <Reference Include="System.Web">
-      <Name>system.web</Name>
-    </Reference>
-    <Reference Include="System.Web.Services">
-      <Name>system.web.services</Name>
-    </Reference>
-    <Reference Include="System.Xml">
-      <Name>System.XML</Name>
-    </Reference>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="..\CommonAssemblyInfo.cs">
-      <Link>CommonAssemblyInfo.cs</Link>
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="AssemblyInfo.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Caching\AspNetCache.cs" />
-    <Compile Include="Context\Support\HttpApplicationConfigurer.cs" />
-    <Compile Include="Context\Support\WebApplicationContext.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\WebApplicationContextArgs.cs" />
-    <Compile Include="Context\Support\WebContextHandler.cs" />
-    <Compile Include="Context\Support\WebSupportModule.cs" />
-    <Compile Include="Core\IO\WebResource.cs" />
-    <Compile Include="DataBinding\DataSourceItemFormatter.cs" />
-    <Compile Include="DataBinding\HttpRequestBindingContainer.cs" />
-    <Compile Include="DataBinding\IBindingAwareFormatter.cs" />
-    <Compile Include="DataBinding\IWebDataBound.cs" />
-    <Compile Include="DataBinding\MultipleSelectionListControlBinding.cs" />
-    <Compile Include="Globalization\AspNetResourceCache.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\IWebObjectNameGenerator.cs" />
-    <Compile Include="Objects\Factory\Xml\WebObjectDefinitionDocumentReader.cs" />
-    <Compile Include="Objects\Factory\Xml\WebObjectDefinitionParserHelper.cs" />
-    <Compile Include="Objects\Factory\Xml\WebObjectDefinitionReader.cs" />
-    <Compile Include="Util\ISessionState.cs" />
-    <Compile Include="Util\SecurityCritical.cs" />
-    <Compile Include="Web\Support\ControlAccessor.cs" />
-    <Compile Include="Web\Support\ControlCollectionAccessor.cs" />
-    <Compile Include="Web\Support\DefaultResultFactory.cs" />
-    <Compile Include="Web\Support\DefaultResultWebNavigator.cs" />
-    <Compile Include="Web\Support\LocalResourceManager.cs" />
-    <Compile Include="Web\Support\MappingHandlerFactory.cs" />
-    <Compile Include="Web\Support\MappingHandlerFactoryConfigurer.cs" />
-    <Compile Include="Web\Support\HandlerMap.cs" />
-    <Compile Include="Web\Support\HandlerMapEntry.cs" />
-    <Compile Include="Web\Support\IHierarchicalWebNavigator.cs" />
-    <Compile Include="Web\Support\IResult.cs" />
-    <Compile Include="Web\Support\IResultFactory.cs" />
-    <Compile Include="Web\Support\IResultWebNavigator.cs" />
-    <Compile Include="Web\Support\IWebNavigable.cs" />
-    <Compile Include="Web\Support\IWebNavigator.cs" />
-    <Compile Include="Web\Support\ResultFactoryRegistry.cs" />
-    <Compile Include="Web\Support\DefaultHandlerFactory.cs" />
-    <Compile Include="Web\Support\WebFormsResultWebNavigator.cs" />
-    <Compile Include="Web\Support\WebNavigableWebNavigatorAdapter.cs" />
-    <Compile Include="Web\UI\IModelPersistenceMedium.cs" />
-    <Compile Include="Web\UI\IValidationContainer.cs" />
-    <Compile Include="Web\Support\MimeMediaType.cs" />
-    <Compile Include="Web\Support\SharedStateResourceCache.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Globalization\Resolvers\CookieCultureResolver.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Globalization\Resolvers\DefaultWebCultureResolver.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Globalization\Resolvers\RequestCultureResolver.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Globalization\Resolvers\SessionCultureResolver.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\ChildWebObjectDefinition.cs" />
-    <Compile Include="Objects\Factory\Support\IWebObjectDefinition.cs" />
-    <Compile Include="Objects\Factory\Support\RootWebObjectDefinition.cs" />
-    <Compile Include="Objects\Factory\Support\WebInstantiationStrategy.cs" />
-    <Compile Include="Objects\Factory\Support\WebObjectDefinitionFactory.cs" />
-    <Compile Include="Objects\Factory\Support\WebObjectFactory.cs" />
-    <Compile Include="Objects\Factory\Support\WebObjectUtils.cs" />
-    <Compile Include="Objects\Factory\Xml\WebObjectsNamespaceParser.cs" />
-    <Compile Include="Threading\HttpContextStorage.cs" />
-    <Compile Include="Threading\HybridContextStorage.cs" />
-    <Compile Include="Util\HttpContextSwitch.cs" />
-    <Compile Include="Util\IVirtualEnvironment.cs" />
-    <Compile Include="Util\VirtualEnvironment.cs" />
-    <Compile Include="Util\WebUtils.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Web\Providers\ConfigurableActiveDirectoryMembershipProvider.cs" />
-    <Compile Include="Web\Providers\ConfigurableSqlMembershipProvider.cs" />
-    <Compile Include="Web\Providers\ConfigurableSqlProfileProvider.cs" />
-    <Compile Include="Web\Providers\ConfigurableSqlRoleProvider.cs" />
-    <Compile Include="Web\Providers\ConfigurableXmlSiteMapProvider.cs" />
-    <Compile Include="Web\Providers\IMembershipProvider.cs" />
-    <Compile Include="Web\Providers\IProfileProvider.cs" />
-    <Compile Include="Web\Providers\IRoleProvider.cs" />
-    <Compile Include="Web\Providers\ISiteMapProvider.cs" />
-    <Compile Include="Web\Providers\MembershipProviderAdapter.cs" />
-    <Compile Include="Web\Providers\ProfileProviderAdapter.cs" />
-    <Compile Include="Web\Providers\RoleProviderAdapter.cs" />
-    <Compile Include="Web\Providers\SiteMapProviderAdapter.cs" />
-    <Compile Include="Web\Services\WebServiceExporter.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Web\Services\WebServiceHandlerFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Web\Support\AbstractHandlerFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Web\Support\ContextMonitor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Web\Support\ControlInterceptor.cs" />
-    <Compile Include="Web\Support\IInterceptionStrategy.cs" />
-    <Compile Include="Web\Support\InterceptControlCollectionOwnerStrategy.cs" />
-    <Compile Include="Web\Support\InterceptControlCollectionStrategy.cs" />
-    <Compile Include="Web\Support\ISupportsWebDependencyInjection.cs" />
-    <Compile Include="Web\Support\PageHandlerFactory.cs">
-    </Compile>
-    <Compile Include="Web\Support\Result.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Web\Support\ResultMode.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Web\Support\Script.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Web\Support\SupportsWebDependencyInjectionMethodBuilder.cs" />
-    <Compile Include="Web\Support\SupportsWebDependencyInjectionOwnerProxy.cs" />
-    <Compile Include="Web\Support\SupportsWebDependencyInjectionTypeBuilder.cs" />
-    <Compile Include="Web\Support\WebDependencyInjectionUtils.cs" />
-    <Compile Include="Web\UI\AbstractWizard.cs">
-      <SubType>ASPXCodeBehind</SubType>
-    </Compile>
-    <Compile Include="Web\UI\Controls\AbstractBaseValidator.cs" />
-    <Compile Include="Web\UI\Controls\AbstractValidationControl.cs" />
-    <Compile Include="Web\UI\Controls\Calendar.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Web\UI\Controls\CheckBoxList.cs" />
-    <Compile Include="Web\UI\Controls\CheckBoxValidator.cs" />
-    <Compile Include="Web\UI\Controls\Content.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Web\UI\Controls\ContentPlaceholder.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Web\UI\Controls\ContentReplacer.cs" />
-    <Compile Include="Web\UI\Controls\ControlState.cs" />
-    <Compile Include="Web\UI\Controls\DataBindingAdapter.cs" />
-    <Compile Include="Web\UI\Controls\DataBindingPanel.cs" />
-    <Compile Include="Web\UI\Controls\Form.cs" />
-    <Compile Include="Web\UI\Controls\Head.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Web\UI\Controls\LocalizedImage.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Web\UI\Controls\MultiView.cs" />
-    <Compile Include="Web\UI\Controls\Panel.cs" />
-    <Compile Include="Web\UI\Controls\RadioButtonGroup.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Web\UI\Controls\TabCommandEventArgs.cs" />
-    <Compile Include="Web\UI\Controls\TabCommandEventHandler.cs" />
-    <Compile Include="Web\UI\Controls\TabContainer.cs" />
-    <Compile Include="Web\UI\Controls\TabularMultiView.cs" />
-    <Compile Include="Web\UI\Controls\TabularView.cs" />
-    <Compile Include="Web\UI\Controls\TabularViewCollection.cs" />
-    <Compile Include="Web\UI\Controls\ValidationError.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Web\UI\Controls\ValidationSummary.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Web\UI\Controls\View.cs" />
-    <Compile Include="Web\UI\Controls\ViewCollection.cs" />
-    <Compile Include="Web\UI\DialogAttribute.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Web\UI\MasterPage.cs">
-      <SubType>ASPXCodeBehind</SubType>
-    </Compile>
-    <Compile Include="Web\UI\Page.cs">
-      <SubType>ASPXCodeBehind</SubType>
-    </Compile>
-    <Compile Include="Web\UI\SessionModelPersistenceMedium.cs" />
-    <Compile Include="Web\UI\UserControl.cs">
-      <SubType>ASPXCodeBehind</SubType>
-    </Compile>
-    <Compile Include="Web\UI\Validation\AbstractValidationErrorsRenderer.cs" />
-    <Compile Include="Web\UI\Validation\DivValidationErrorsRenderer.cs" />
-    <Compile Include="Web\UI\Validation\IconValidationErrorsRenderer.cs" />
-    <Compile Include="Web\UI\Validation\IValidationErrorsRenderer.cs" />
-    <Compile Include="Web\UI\Validation\SpanValidationErrorsRenderer.cs" />
-    <None Include="Spring.Web.build" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>
-    </PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/test/Spring/Spring.Aop.Tests/Spring.Aop.Tests.2002.csproj b/test/Spring/Spring.Aop.Tests/Spring.Aop.Tests.2002.csproj
deleted file mode 100644
index 1e805fd9..00000000
--- a/test/Spring/Spring.Aop.Tests/Spring.Aop.Tests.2002.csproj
+++ /dev/null
@@ -1,516 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.0.9955"
-        SchemaVersion = "1.0"
-        ProjectGuid = "{F856BCAE-421E-469A-B75F-E41E5BA7F160}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Aop.Tests"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                RootNamespace = "Spring"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;NET_1_0"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.Net.2002\Spring.Aop.Tests\Debug-1.0\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "1"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.Net.2002\Spring.Aop.Tests\Release-1.0\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                />
-                <Reference
-                    Name = "System.Drawing"
-                    AssemblyName = "System.Drawing"
-                    HintPath = "..\..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.0.3705\System.Drawing.dll"
-                />
-                <Reference
-                    Name = "Spring.Core.Tests.2002"
-                    Project = "{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Aop.2002"
-                    Project = "{828F16E3-20A4-4EC4-A8F4-CD95B8ED44C9}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Core.2002"
-                    Project = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "System.Web"
-                    AssemblyName = "System.Web"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.0.3705\System.Web.dll"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\lib\Net\1.0\Common.Logging.dll"
-                />
-                <Reference
-                    Name = "antlr.runtime"
-                    AssemblyName = "antlr.runtime"
-                    HintPath = "..\..\..\lib\Net\1.0\antlr.runtime.dll"
-                />
-                <Reference
-                    Name = "DotNetMock"
-                    AssemblyName = "DotNetMock"
-                    HintPath = "..\..\..\lib\Net\1.0\DotNetMock.dll"
-                />
-                <Reference
-                    Name = "DotNetMock.Framework"
-                    AssemblyName = "DotNetMock.Framework"
-                    HintPath = "..\..\..\lib\Net\1.0\DotNetMock.Framework.dll"
-                />
-                <Reference
-                    Name = "nunit.framework"
-                    AssemblyName = "nunit.framework"
-                    HintPath = "..\..\..\lib\Net\1.0\nunit.framework.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AopExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\ISimpleBeforeAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\SimpleBeforeAdviceAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\SimpleBeforeAdviceImpl.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\SimpleBeforeAdviceInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\TrueMethodMatcherTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\TruePointcutTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\TrueTypeFilterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Advice\DebugAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Config\AopNamespaceParserTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Config\AopNamespaceParserTests.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Aop\Framework\AbstractMethodInvocationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AopContextTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\CountingAfterReturningAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\CountingBeforeAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\CountingMultiAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\CountingThrowsAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicMethodInvocationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\HashtableCachingAdvisorChainFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\ITimeStamped.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\MethodCounter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\PrototypeTargetTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\ProxyConfigTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\ProxyFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\ProxyFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\ReflectiveMethodInvocationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\TimestampIntroductionInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\UnsupportedInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\AdvisorAdapterRegistrationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\AfterReturningAdviceInterceptorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\ThrowsAdviceInterceptorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\UnknownAdviceTypeExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\AdvisorAutoProxyCreatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\LogicalThreadContextAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\NoSetterProperties.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\ObjectNameAutoProxyCreatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\OrderedLogicalThreadContextCheckAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\AbstractAopProxyTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\CompositionAopProxyTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\DecoratorAopProxyTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\MockTargetSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Interceptor\NopInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Interceptor\SerializableNopInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\AbstractRegularExpressionMethodPointcutTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\AttributeMatchMethodPointcutTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\ControlFlowPointcutTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\DelegatingIntroductionInterceptorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\RegularExpressionMethodPointcutAdvisorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\RootTypeFilterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\SdkRegularExpressionMethodPointcutTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\TypeFiltersTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\EmptyTargetSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\HotSwappableTargetSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\PrototypeTargetSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\SimplePoolTargetSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\SingletonTargetSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\ThreadLocalTargetSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\CacheAspectIntegrationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\CacheParameterAdviceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\CacheResultAdviceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\InvalidateCacheAdviceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Exception\ExceptionHandlerAspectIntegrationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\innerBeanTarget.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\prototypeTarget.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\prototypeTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\proxyFactoryDoubleTargetSourceTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\proxyFactoryTargetSourceTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\proxyFactoryTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\serializationTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\throwsAdvice.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\adapter\withBPPContext.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\adapter\withoutBPPContext.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\AutoProxy\advisorAutoProxyCreator.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\AutoProxy\objectNameAutoProxyCreatorTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Support\RegularExpressionSetterTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Target\commonsPoolTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Target\hotSwapTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Target\prototypeTargetSourceTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Target\simplePoolTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Target\threadLocalTests.xml"
-                    BuildAction = "Content"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/test/Spring/Spring.Aop.Tests/Spring.Aop.Tests.2003.csproj b/test/Spring/Spring.Aop.Tests/Spring.Aop.Tests.2003.csproj
deleted file mode 100644
index e2e5f9c5..00000000
--- a/test/Spring/Spring.Aop.Tests/Spring.Aop.Tests.2003.csproj
+++ /dev/null
@@ -1,594 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{2111596A-0327-4C9D-8919-294FBD988A23}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Aop.Tests"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = 'echo "Copying .xml files for tests"&#xd;&#xa;xcopy "$(ProjectDir)Data" "..\..\..\..\build\VS.Net.2003\Spring.Aop.Tests\$(ConfigurationName)\" /y /s /q&#xd;&#xa;'
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;NET_1_1;DEBUG_DYNAMIC"
-                    DocumentationFile = "Spring.Aop.Tests.xml"
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = "0618"
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Aop.Tests\Debug-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "3"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Aop.Tests\Release-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "System.Web"
-                    AssemblyName = "System.Web"
-                    HintPath = "..\..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Web.dll"
-                />
-                <Reference
-                    Name = "DotNetMock"
-                    AssemblyName = "DotNetMock"
-                    HintPath = "..\..\..\lib\Net\1.1\DotNetMock.dll"
-                />
-                <Reference
-                    Name = "nunit.framework"
-                    AssemblyName = "nunit.framework"
-                    HintPath = "..\..\..\lib\Net\1.1\nunit.framework.dll"
-                    Private = "True"
-                />
-                <Reference
-                    Name = "Spring.Aop.2003"
-                    Project = "{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Core.2003"
-                    Project = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Core.Tests.2003"
-                    Project = "{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\lib\Net\1.1\Common.Logging.dll"
-                />
-                <Reference
-                    Name = "Rhino.Mocks"
-                    AssemblyName = "Rhino.Mocks"
-                    HintPath = "..\..\..\lib\Net\1.1\Rhino.Mocks.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AopExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Spring.Aop.Tests.build"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Aop\ISimpleBeforeAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\SimpleBeforeAdviceAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\SimpleBeforeAdviceImpl.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\SimpleBeforeAdviceInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\TrueMethodMatcherTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\TruePointcutTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\TrueTypeFilterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Advice\DebugAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Config\AopNamespaceParserTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Config\AopNamespaceParserTests.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Aop\Framework\AbstractMethodInvocationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AopContextTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\CountingAfterReturningAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\CountingBeforeAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\CountingMultiAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\CountingThrowsAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicMethodInvocationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\HashtableCachingAdvisorChainFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\IIsModified.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\IsModifiedMixin.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\ITimeStamped.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\MethodCounter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\PrototypeTargetTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\ProxyConfigTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\ProxyFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\ProxyFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\ReflectiveMethodInvocationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\TimestampIntroductionInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\UnsupportedInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\AdvisorAdapterRegistrationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\AfterReturningAdviceInterceptorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\ThrowsAdviceInterceptorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\Adapter\UnknownAdviceTypeExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\AdvisorAutoProxyCreatorCircularReferencesTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\advisorAutoProxyCreatorCircularReferencesTests.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\AdvisorAutoProxyCreatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\CreatesTestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\LogicalThreadContextAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\NoSetterProperties.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\ObjectNameAutoProxyCreatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\AutoProxy\OrderedLogicalThreadContextCheckAdvisor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\AbstractAopProxyTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\AopUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\CachedAopProxyFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\CompositionAopProxyTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\DecoratorAopProxyTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\DefaultAopProxyFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\InheritanceAopProxyTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Framework\DynamicProxy\MockTargetSource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Interceptor\NopInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Interceptor\SerializableNopInterceptor.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\AbstractRegularExpressionMethodPointcutTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\AttributeMatchMethodPointcutTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\ControlFlowPointcutTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\DelegatingIntroductionInterceptorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\RegularExpressionMethodPointcutAdvisorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\RootTypeFilterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\SdkRegularExpressionMethodPointcutTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Support\TypeFiltersTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\EmptyTargetSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\HotSwappableTargetSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\PrototypeTargetSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\SimplePoolTargetSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\SingletonTargetSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aop\Target\ThreadLocalTargetSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\RetryAdviceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\CacheAspectIntegrationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\CacheParameterAdviceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\CacheResultAdviceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Cache\InvalidateCacheAdviceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Exception\CaptureOutputLogger.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Exception\CaptureOutputLoggerFactoryAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Exception\ExceptionHandlerAspectIntegrationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Logging\SimpleLoggingAdviceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Logging\TestableSimpleLoggingAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Aspects\Validation\ParameterValidationAdviceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\innerBeanTarget.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\prototypeTarget.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\prototypeTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\proxyFactoryDoubleTargetSourceTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\proxyFactoryTargetSourceTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\proxyFactoryTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\serializationTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\throwsAdvice.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\adapter\withBPPContext.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\adapter\withoutBPPContext.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\AutoProxy\advisorAutoProxyCreator.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Framework\AutoProxy\objectNameAutoProxyCreatorTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Support\RegularExpressionSetterTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Target\commonsPoolTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Target\hotSwapTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Target\prototypeTargetSourceTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Target\simplePoolTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Aop\Target\threadLocalTests.xml"
-                    BuildAction = "Content"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/test/Spring/Spring.Aop.Tests/Spring.Aop.Tests.2005.csproj b/test/Spring/Spring.Aop.Tests/Spring.Aop.Tests.2005.csproj
deleted file mode 100644
index d8d94a3d..00000000
--- a/test/Spring/Spring.Aop.Tests/Spring.Aop.Tests.2005.csproj
+++ /dev/null
@@ -1,307 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{2111596A-0327-4C9D-8919-294FBD988A23}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.Aop.Tests</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Library</OutputType>
-    <RootNamespace>Spring</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Aop.Tests\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG;NET_2_0;DEBUG_DYNAMIC</DefineConstants>
-    <DocumentationFile>Spring.Aop.Tests.xml</DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>0618</NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>3</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-    <UseVSHostingProcess>true</UseVSHostingProcess>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Aop.Tests\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>618</NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=2.1.0.0, Culture=neutral, PublicKeyToken=65e474d141e25e07, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="DotNetMock, Version=0.7.4.0, Culture=neutral, PublicKeyToken=805ea88df19095f6">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\DotNetMock.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.framework, Version=2.5.1.9189, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="Rhino.Mocks, Version=2.9.6.40380, Culture=neutral, PublicKeyToken=0b3305902db7183f, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Rhino.Mocks.dll</HintPath>
-    </Reference>
-    <Reference Include="System">
-      <Name>System</Name>
-    </Reference>
-    <Reference Include="System.Data">
-      <Name>System.Data</Name>
-    </Reference>
-    <Reference Include="System.Web">
-      <Name>System.Web</Name>
-    </Reference>
-    <Reference Include="System.Xml">
-      <Name>System.XML</Name>
-    </Reference>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="AopExceptionTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Advice\DebugAdvice.cs" />
-    <Compile Include="Aop\Config\AopNamespaceParserTests.cs" />
-    <Compile Include="Aop\Framework\Adapter\AdvisorAdapterRegistrationTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\Adapter\AfterReturningAdviceInterceptorTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\Adapter\ThrowsAdviceInterceptorTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\Adapter\UnknownAdviceTypeExceptionTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\AopContextTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\AutoProxy\AdvisorAutoProxyCreatorCircularReferencesTests.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\AdvisorAutoProxyCreatorTests.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\AttributeAutoProxyCreatorTests.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\LogicalThreadContextAdvice.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\NoSetterProperties.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\ObjectNameAutoProxyCreatorTests.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\OrderedLogicalThreadContextCheckAdvisor.cs" />
-    <Compile Include="Aop\Framework\AbstractMethodInvocationTests.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\CreatesTestObject.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\PointcutFilteringAutoProxyCreatorTests.cs" />
-    <Compile Include="Aop\Framework\AutoProxy\TypeNameAutoProxyCreatorTests.cs" />
-    <Compile Include="Aop\Framework\DynamicMethodInvocationTests.cs" />
-    <Compile Include="Aop\Framework\CountingAfterReturningAdvice.cs" />
-    <Compile Include="Aop\Framework\CountingBeforeAdvice.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\CountingMultiAdvice.cs" />
-    <Compile Include="Aop\Framework\CountingThrowsAdvice.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\AbstractAopProxyTests.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\AopUtilsTests.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\CachedAopProxyFactoryTests.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\CompositionAopProxyTests.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\InheritanceAopProxyTests.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\DecoratorAopProxyTests.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\DefaultAopProxyFactoryTests.cs" />
-    <Compile Include="Aop\Framework\DynamicProxy\MockTargetSource.cs" />
-    <Compile Include="Aop\Framework\HashtableCachingAdvisorChainFactoryTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\IIsModified.cs" />
-    <Compile Include="Aop\Framework\IsModifiedMixin.cs" />
-    <Compile Include="Aop\Framework\ITimeStamped.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\MethodCounter.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\PrototypeTargetTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\ProxyConfigTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\ProxyFactoryObjectTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\ProxyFactoryTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\ReflectiveMethodInvocationTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\TimestampIntroductionInterceptor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Framework\UnsupportedInterceptor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Interceptor\NopInterceptor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Interceptor\SerializableNopInterceptor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\ISimpleBeforeAdvice.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\SimpleBeforeAdviceAdapter.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\SimpleBeforeAdviceImpl.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\SimpleBeforeAdviceInterceptor.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\AbstractRegularExpressionMethodPointcutTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\AttributeMatchMethodPointcutTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\ControlFlowPointcutTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\DelegatingIntroductionInterceptorTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\RegularExpressionMethodPointcutAdvisorTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\RootTypeFilterTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\SdkRegularExpressionMethodPointcutTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Support\TypeFiltersTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Target\EmptyTargetSourceTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Target\HotSwappableTargetSourceTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Target\PrototypeTargetSourceTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Target\SimplePoolTargetSourceTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Target\SingletonTargetSourceTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\Target\ThreadLocalTargetSourceTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\TrueMethodMatcherTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\TruePointcutTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aop\TrueTypeFilterTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Aspects\Cache\CacheResultAdviceTests.cs" />
-    <Compile Include="Aspects\Cache\CacheParameterAdviceTests.cs" />
-    <Compile Include="Aspects\Cache\CacheAspectIntegrationTests.cs" />
-    <Compile Include="Aspects\Cache\InvalidateCacheAdviceTests.cs" />
-    <Compile Include="Aspects\Exception\CaptureOutputLogger.cs" />
-    <Compile Include="Aspects\Exception\CaptureOutputLoggerFactoryAdapter.cs" />
-    <Compile Include="Aspects\Exception\ExceptionHandlerAspectIntegrationTests.cs" />
-    <Compile Include="Aspects\Logging\SimpleLoggingAdviceTests.cs" />
-    <Compile Include="Aspects\Logging\TestableSimpleLoggingAdvice.cs" />
-    <Compile Include="Aspects\RetryAdviceTests.cs" />
-    <Compile Include="Aspects\Validation\ParameterValidationAdviceTests.cs" />
-    <Compile Include="AssemblyInfo.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <None Include="Spring.Aop.Tests.build" />
-    <None Include="Spring.Aop.Tests.dll.config" />
-    <EmbeddedResource Include="Aop\Config\AopNamespaceParserTests.xml" />
-    <EmbeddedResource Include="Data\Spring\Aop\Framework\adapter\withBPPContext.xml" />
-    <EmbeddedResource Include="Data\Spring\Aop\Framework\adapter\withoutBPPContext.xml" />
-    <EmbeddedResource Include="Aop\Framework\AutoProxy\advisorAutoProxyCreatorCircularReferencesTests.xml" />
-    <Content Include="Data\Spring\Aop\Framework\AutoProxy\advisorAutoProxyCreator.xml" />
-    <Content Include="Data\Spring\Aop\Framework\AutoProxy\objectNameAutoProxyCreatorTests.xml" />
-    <Content Include="Data\Spring\Aop\Framework\innerBeanTarget.xml" />
-    <Content Include="Data\Spring\Aop\Framework\prototypeTarget.xml" />
-    <Content Include="Data\Spring\Aop\Framework\prototypeTests.xml" />
-    <Content Include="Data\Spring\Aop\Framework\proxyFactoryDoubleTargetSourceTests.xml" />
-    <Content Include="Data\Spring\Aop\Framework\proxyFactoryTargetSourceTests.xml" />
-    <Content Include="Data\Spring\Aop\Framework\proxyFactoryTests.xml" />
-    <Content Include="Data\Spring\Aop\Framework\serializationTests.xml" />
-    <Content Include="Data\Spring\Aop\Framework\throwsAdvice.xml" />
-    <Content Include="Data\Spring\Aop\Support\RegularExpressionSetterTests.xml" />
-    <Content Include="Data\Spring\Aop\Target\commonsPoolTests.xml" />
-    <Content Include="Data\Spring\Aop\Target\hotSwapTests.xml" />
-    <Content Include="Data\Spring\Aop\Target\prototypeTargetSourceTests.xml" />
-    <Content Include="Data\Spring\Aop\Target\simplePoolTests.xml" />
-    <Content Include="Data\Spring\Aop\Target\threadLocalTests.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Aop\Spring.Aop.2005.csproj">
-      <Project>{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}</Project>
-      <Name>Spring.Aop.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Core.Tests\Spring.Core.Tests.2005.csproj">
-      <Project>{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}</Project>
-      <Name>Spring.Core.Tests.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>echo "Copying .xml files for tests"
-xcopy "$(ProjectDir)Data" ..\..\..\..\build\VS.Net.2005\Spring.Aop.Tests\$(ConfigurationName)\ /y /s /q /d
-xcopy "$(ProjectDir)$(TargetFileName).config" ..\..\..\..\build\VS.Net.2005\Spring.Aop.Tests\$(ConfigurationName)\ /y /s /q</PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/test/Spring/Spring.Core.Tests/Spring.Core.Tests.2002.csproj b/test/Spring/Spring.Core.Tests/Spring.Core.Tests.2002.csproj
deleted file mode 100644
index 7f1c3f04..00000000
--- a/test/Spring/Spring.Core.Tests/Spring.Core.Tests.2002.csproj
+++ /dev/null
@@ -1,1744 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.0.9955"
-        SchemaVersion = "1.0"
-        ProjectGuid = "{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Core.Tests"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                RootNamespace = "Spring"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;NET_1_0"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.Net.2002\Spring.Core.Tests\Debug-1.0\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "1"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.Net.2002\Spring.Core.Tests\Release-1.0\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                />
-                <Reference
-                    Name = "System.Drawing"
-                    AssemblyName = "System.Drawing"
-                    HintPath = "..\..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.0.3705\System.Drawing.dll"
-                />
-                <Reference
-                    Name = "Spring.Core.2002"
-                    Project = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "nunit.framework"
-                    AssemblyName = "nunit.framework"
-                    HintPath = "..\..\..\lib\Net\1.0\nunit.framework.dll"
-                />
-                <Reference
-                    Name = "antlr.runtime"
-                    AssemblyName = "antlr.runtime"
-                    HintPath = "..\..\..\lib\Net\1.0\antlr.runtime.dll"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\lib\Net\1.0\Common.Logging.dll"
-                />
-                <Reference
-                    Name = "DotNetMock"
-                    AssemblyName = "DotNetMock"
-                    HintPath = "..\..\..\lib\Net\1.0\DotNetMock.dll"
-                />
-                <Reference
-                    Name = "DotNetMock.Framework"
-                    AssemblyName = "DotNetMock.Framework"
-                    HintPath = "..\..\..\lib\Net\1.0\DotNetMock.Framework.dll"
-                />
-                <Reference
-                    Name = "System.EnterpriseServices"
-                    AssemblyName = "System.EnterpriseServices"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.0.3705\System.EnterpriseServices.dll"
-                />
-                <Reference
-                    Name = "System.Web"
-                    AssemblyName = "System.Web"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.0.3705\System.Web.dll"
-                />
-                <Reference
-                    Name = "System.Web.Services"
-                    AssemblyName = "System.Web.Services"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.0.3705\System.Web.Services.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "CommonTypes.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "CoreExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "ExceptionsTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Spring.Core.Tests.build"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Spring.Core.Tests.dll.config"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "StandardsComplianceTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "StreamHelperDecorator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "TestResource.txt"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Collections\AbstractQueueTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\HashedSetTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\HybridSetTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\ImmutableSetTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\LinkedListTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\ListSetTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\PriorityQueueTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\SetTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\SortedSetTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\StaticSetTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\ApplicationEventArgsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\CommonTypes.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\ContextExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\contextlifecycle.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Context\ContextListenerObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\EventListenerAttributeTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Events\ConsoleListenerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\AbstractApplicationContextTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\AbstractMessageSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\ApplicationContextAwareProcessorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\ApplicationContextExtensionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\ApplicationObjectSupportTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\Assembler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\contextA.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Context\Support\contextB.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Context\Support\contextC.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Context\Support\ContextLocatorHandlerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\ContextRegistryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\DefaultMessageSourceResolvableTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\DelegatingMessageSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\import1.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Context\Support\invalidType.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Context\Support\invalidValueType.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Context\Support\Logic.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\MessageSourceAccessorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\NamespaceParsersSectionHandlerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\NullMessageSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\objects.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Context\Support\ResourceSetMessageSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\Service.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\simpleContext.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Context\Support\StaticApplicationContextTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\StaticMessageSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\testobject.xsd"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Context\Support\TestObjectConfigParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\TypeAliasesSectionHandlerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\XmlApplicationContextTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\ComposedCriteriaTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\ControlFlowFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodArgumentsCriteriaTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodGenericArgumentsCountCriteriaTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodParametersCountCriteriaTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodParametersCriteriaTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodReturnTypeCriteriaTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\OrderComparatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\RegularExpressionEventNameCriteriaTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\RegularExpressionMethodNameCriteriaTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\AssemblyResourceTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\ConfigurableResourceLoaderTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\FileSystemResourceCommonTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\FileSystemResourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\InputStreamResourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\ResourceConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\ResourceHandlerRegistryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\TestResource.txt"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Core\IO\UrlResourceTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\CredentialConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\CustomNumberConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\FileInfoConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\NameValueConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\RegexConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\RegistryKeyConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\ResourceManagerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\RGBColorConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\RuntimeTypeConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\StreamConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\StringArrayConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\TimeSpanConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\TypeConverterRegistryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\UriConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\aliasedObjects.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\CachedTypeResolverTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\GenericTypeResolverTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\TypeRegistryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\TypeResolutionUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\TypeResolverTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\PathMatcher\EmptyPattern.test"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Data\PathMatcher\Examples.test"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Data\PathMatcher\InBetween.test"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Data\PathMatcher\MatchAll.test"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Data\PathMatcher\PatternsAreCaseSensitive.test"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Data\PathMatcher\SingleCaracters.test"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Data\PathMatcher\SlurpPrependedDirectories.test"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Data\PathMatcher\SpringAssembliesPrefix.test"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Data\PathMatcher\ThisDirectory.test"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\concurrent.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\leaf.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\middle.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\root.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Config\AnotherDaoConfig.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Config\DaoConfig.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Config\DatabaseConfig.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Config\ObjectFactoryCreatingFactoryObjectTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Config\PPC-SPRNET-55.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Config\PPCTwoLocationsOneSectionTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Config\PPCTwoLocationsTwoSectionsTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Config\PPCWithTypesTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Config\PropertyPlaceholderConfigurerTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Config\PropertyResourceConfigurerTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\abstract.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\autowire.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\bad-external-resources.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\bad-named-constructor-arg.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\child.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\classnotfound.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\collections.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\constructor-arg.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\default-autowire.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\default-lazy-init.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\dependenciesmaterializethis.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\enums.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\event-wiring.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\event-wiring-prototypes.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\external-resources.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\factorycircle.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\factory-methods.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\field-props-factory.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\initializers.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\invalid.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\invalid-factory.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\invoke-factory.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\notfullyspecified.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\parent.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\reftypes.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\resource.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\satisfiedalldependencycheck.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\satisfiedobjectdependencycheck.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\satisfiedsimpledependencycheck.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\schema-validation.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\test.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\unsatisfiedalldependencycheckmissingobjects.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\unsatisfiedAllDependencyCheckMissingSimple.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\unsatisfiedobjectdependencycheck.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\unsatisfiedsimpledependencycheck.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\Resources\resource-imports.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "DataBinding\BaseBindingManagerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\SimpleExpressionBindingTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\ExpressionEvaluatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\AbstractLocalizerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\CultureInfoUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\CultureTestScope.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\CurrencyFormatterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\DateTimeFormatterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\FloatFormatterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\IntegerFormatterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\NumberFormatterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\PercentFormatterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Localizers\ResourceSetLocalizerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Resolvers\DefaultCultureResolverTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\DerivedTestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\ExpressionTestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\IndexedTestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\INestedTestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\IOther.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\IPerson.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\ITestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\LazyTestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\MutablePropertyValuesTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\NestedTestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\NotWritablePropertyExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\NumberTestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\ObjectWrapperTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\PropertyAccessExceptionsExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\PropertyValueTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\ResourceTestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\SerializablePerson.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\StaticTestEventHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\TestEventHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\TestGenericObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\TestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\TestObject.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Objects\TestObjectDAO.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\TestObjectList.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\TypeMismatchExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Events\Support\EventManipulationUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Events\Support\EventRegistryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\AbstractListableObjectFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\AbstractObjectFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\DefaultListableObjectFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\DummyConfigurableFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\DummyFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\HasMap.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ISideEffectObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\KnowsIfInstantiated.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\LifecycleObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\MethodReplacerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\MustBeInitialized.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\NoSuchObjectDefinitionExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ObjectDefinitionStoreExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ObjectFactoryUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\SideEffectObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\TestResource.txt"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Objects\Factory\UnsupportedObjectDefinitionImplementation.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\AbstractFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\CommandLineArgsVariableSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ConfigSectionVariableSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ConfigurationReaderTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ConnectionStringsVariableSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ConfigurableVariableSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ConstructorArgumentValuesTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\CustomConverterConfigurerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\DelegateFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\DictionaryFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\EnvironmentVariableSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\EventValuesTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\FieldRetrievingFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ListFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\LogFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\MethodInvokingFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ObjectDefinitionVisitorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ObjectFactoryCreatingFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ObjectReferenceFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyFileVariableSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyOverrideConfigurerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyPathFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyPlaceholderConfigurerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyRetrievingFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\RegistryVariableSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ResourceHandlerConfigurerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ResourceManagerFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\RuntimeObjectReferenceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\SetFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\SpecialFolderVariableSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\TypeAliasConfigurerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\TypedStringValueTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\AutowireUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ChildObjectDefinitionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\DefaultObjectDefinitionFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\DelegatingMethodReplacerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\LookupMethodOverrideTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\LookupMethodReplacerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ObjectDefinitionBuilderTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ObjectDefinitionReaderUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ReplacedMethodOverrideTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\RootObjectDefinitionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\SimpleInstantiationStrategyTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\ConstructorDependenciesObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\DependenciesObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\DerivedConstructorDependenciesObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\DoubleBooleanConstructorObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\DummyBo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\DummyDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\DummyReferencer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\EventWiringTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\FactoryMethods.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\IDummyBo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\InstanceFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\MixedCollectionObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\NullAppender.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\ReadOnlyXmlTestResource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\SingleSimpleTypeConstructorObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\TestObjectCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\XmlListableObjectFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\XmlObjectCollectionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\XmlObjectDefinitionReaderTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\XmlObjectFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\XmlParserResolverTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\ArgumentConvertingMethodInvokerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\AutoWiringEventHandlerValueTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\InstanceEventHandlerValueTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\MethodInvokerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\MutableSortDefinitionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\PropertyComparatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\StaticEventHandlerValueTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Pool\Support\SimplePoolTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\AbstractProxyTypeBuilderTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\CompositionProxyTypeBuilderTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\DynamicProxyManagerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\ExplicitCompositionProxyTypeBuilderTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\InheritanceProxyTypeBuilderTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicConstructorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicFieldTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicIndexerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicMethodTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicPropertyTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Resources\Images.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\SampleResources.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\SimpleAppContext.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\Spring.Context.Tests.pt-BR.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\Spring.Context.Tests.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\Spring.Context.Tests.sr.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\Spring.Context.Tests.sr-SP-Cyrl.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\Tesla.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\Tesla.sr.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\Tesla.sr-SP-Cyrl.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Threading\AsyncTestMethod.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\AsyncTestTask.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\CallContextStorageTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\CommonThreadStorageTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\LatchTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\LogicalThreadContextTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\SemaphoreTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\SyncHolderTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\ThreadStaticStorageTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ArrayUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\AssertUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\CollectionUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\DefensiveEventRaiserTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\DelegateInfoTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\EventRaiserTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\NumberUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ObjectUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\PathMatcherTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\PatternMatchUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\PropertiesTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ReflectionUtilsMemberwiseCopyTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ReflectionUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\SerializationTestUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\StringUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\AnyValidatorGroupTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ExclusiveValidatorGroupTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\HelperClasses.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ValidationConfigParserTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ValidationErrorsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ValidatorGroupTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ValidatorReferenceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Actions\ErrorMessageActionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Actions\ExpressionActionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\ConditionValidatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\RegularExpressionValidatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\RequiredValidatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/test/Spring/Spring.Core.Tests/Spring.Core.Tests.2003.csproj b/test/Spring/Spring.Core.Tests/Spring.Core.Tests.2003.csproj
deleted file mode 100644
index ee17b8a1..00000000
--- a/test/Spring/Spring.Core.Tests/Spring.Core.Tests.2003.csproj
+++ /dev/null
@@ -1,2137 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Core.Tests"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = 'echo "Copying .xml files for tests"&#xd;&#xa;xcopy "$(ProjectDir)Data" ..\..\..\..\build\VS.Net.2003\Spring.Core.Tests\$(ConfigurationName)\ /y /s /q /d&#xd;&#xa;copy  "$(ProjectDir)$(TargetFileName)-1.1.config" ..\..\..\..\build\VS.Net.2003\Spring.Core.Tests\$(ConfigurationName)\$(TargetFileName).config'
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = "67,0618"
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Core.Tests\Debug-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Core.Tests\Release-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                />
-                <Reference
-                    Name = "System.Drawing"
-                    AssemblyName = "System.Drawing"
-                    HintPath = "..\..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Drawing.dll"
-                />
-                <Reference
-                    Name = "nunit.framework"
-                    AssemblyName = "nunit.framework"
-                    HintPath = "..\..\..\lib\Net\1.1\nunit.framework.dll"
-                    Private = "True"
-                />
-                <Reference
-                    Name = "DotNetMock"
-                    AssemblyName = "DotNetMock"
-                    HintPath = "..\..\..\lib\Net\1.1\DotNetMock.dll"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\lib\Net\1.1\Common.Logging.dll"
-                />
-                <Reference
-                    Name = "System.Web.Services"
-                    AssemblyName = "System.Web.Services"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Web.Services.dll"
-                />
-                <Reference
-                    Name = "System.EnterpriseServices"
-                    AssemblyName = "System.EnterpriseServices"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.EnterpriseServices.dll"
-                />
-                <Reference
-                    Name = "Spring.Core.2003"
-                    Project = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-				<Reference
-                    Name = "Spring.Messaging.Nms.2003"
-                    Project = "{C17B27C2-4343-45BA-9A21-73C3CEC19BAD}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-				<Reference
-                    Name = "Spring.Services.2003"
-                    Project = "{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Rhino.Mocks"
-                    AssemblyName = "Rhino.Mocks"
-                    HintPath = "..\..\..\lib\Net\1.1\Rhino.Mocks.dll"
-                />
-                <Reference
-                    Name = "System.Runtime.Serialization.Formatters.Soap"
-                    AssemblyName = "System.Runtime.Serialization.Formatters.Soap"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Runtime.Serialization.Formatters.Soap.dll"
-                />
-                <Reference
-                    Name = "System.Windows.Forms"
-                    AssemblyName = "System.Windows.Forms"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Windows.Forms.dll"
-                />
-                <Reference
-                    Name = "System.Web"
-                    AssemblyName = "System.Web"
-                    HintPath = "..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Web.dll"
-                />
-                <Reference
-                    Name = "Spring.Aop.2003"
-                    Project = "{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "CommonTypes.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "CoreExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "ExceptionsTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "HookableContextHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Spring.Core.Tests.build"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Spring.Core.Tests.dll.config"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Spring.Core.Tests.dll-1.1.config"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "StandardsComplianceTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "StopWatch.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "StreamHelperDecorator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "TestResource.txt"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "TestResourceLoader.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Caching\AbstractCacheTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\AbstractQueueTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\HashedSetTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\HybridSetTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\ImmutableSetTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\LinkedListTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\ListSetTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\PriorityQueueTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\SetTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\SortedSetTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\StaticSetTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Collections\SynchronizedHashtableTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\ApplicationEventArgsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\CommonTypes.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\ContextExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\contextlifecycle.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Context\ContextListenerObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\EventListenerAttributeTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Events\ConsoleListenerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\AbstractApplicationContextTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\AbstractMessageSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\ApplicationContextAwareProcessorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\ApplicationContextExtensionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\ApplicationObjectSupportTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\Assembler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\contextA.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Context\Support\contextB.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Context\Support\contextC.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Context\Support\ContextLocatorHandlerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\ContextRegistryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\DefaultMessageSourceResolvableTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\DelegatingMessageSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\import1.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Context\Support\innerObjectsWithPostProcessor.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Context\Support\invalidType.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Context\Support\invalidValueType.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Context\Support\Logic.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\MessageSourceAccessorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\NamespaceParsersSectionHandlerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\NullMessageSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\objects.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Context\Support\ResourceSetMessageSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\Service.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\simpleContext.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Context\Support\StaticApplicationContextTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\StaticMessageSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\testobject.xsd"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Context\Support\TestObjectConfigParser.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\TypeAliasesSectionHandlerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\XmlApplicationContextTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\ComposedCriteriaTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\ControlFlowFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodArgumentsCriteriaTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodGenericArgumentsCountCriteriaTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodParametersCountCriteriaTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodParametersCriteriaTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\MethodReturnTypeCriteriaTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\OrderComparatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\RegularExpressionEventNameCriteriaTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\RegularExpressionMethodNameCriteriaTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\AssemblyResourceTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\ConfigSectionResourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\ConfigSectionResourceTests_config1.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Core\IO\ConfigurableResourceLoaderTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\FileSystemResourceCommonTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\FileSystemResourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\InputStreamResourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\ResourceConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\ResourceHandlerRegistryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\StringResourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\TestResource.txt"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Core\IO\UrlResourceTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\CredentialConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\CustomNumberConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\FileInfoConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\NameValueConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\RegexConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\RegistryKeyConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\ResourceManagerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\RGBColorConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\RuntimeTypeConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\StreamConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\StringArrayConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\TimeSpanConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\TypeConversionUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\TypeConverterRegistryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\UniqueKeyConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeConversion\UriConverterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\aliasedObjects.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\CachedTypeResolverTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\GenericTypeResolverTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\TypeRegistryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\TypeResolutionUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\TypeResolution\TypeResolverTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\PathMatcher\EmptyPattern.test"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\PathMatcher\Examples.test"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\PathMatcher\InBetween.test"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\PathMatcher\MatchAll.test"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\PathMatcher\PatternsAreCaseSensitive.test"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\PathMatcher\SingleCaracters.test"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\PathMatcher\SlurpPrependedDirectories.test"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\PathMatcher\SpringAssembliesPrefix.test"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\PathMatcher\ThisDirectory.test"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Context\Support\SPRNET-192.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\concurrent.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\leaf.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\middle.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\root.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Config\AnotherDaoConfig.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Config\DaoConfig.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Config\DatabaseConfig.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Config\one.properties"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Config\PPC-SPRNET-55.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Config\PPCTwoLocationsOneSectionTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Config\PPCTwoLocationsTwoSectionsTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Config\PPCWithTypesTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Config\PropertyPlaceholderConfigurerTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Config\PropertyResourceConfigurerTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Config\two.properties"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\abstract.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\autowire.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\bad-external-resources.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\bad-named-constructor-arg.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\child.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\classnotfound.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\collections.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\constructor-arg.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\default-autowire.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\default-lazy-init.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\dependenciesmaterializethis.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\enums.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\event-wiring.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\event-wiring-prototypes.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\expressions.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\external-resources.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\factorycircle.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\factory-methods.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\field-props-factory.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\initializers.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\invalid.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\invalid-factory.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\invoke-factory.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\lazy-init-multithreaded.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\no-objects.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\notfullyspecified.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\parent.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\reftypes.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\resource.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\satisfiedalldependencycheck.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\satisfiedobjectdependencycheck.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\satisfiedsimpledependencycheck.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\schema-validation.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\test.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\unsatisfiedalldependencycheckmissingobjects.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\unsatisfiedAllDependencyCheckMissingSimple.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\unsatisfiedobjectdependencycheck.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\unsatisfiedsimpledependencycheck.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\wellformed-but-bad.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Xml\Resources\resource-imports.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "DataBinding\BaseBindingManagerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataBinding\SimpleExpressionBindingTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\ConstructorNodeTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\ExpressionEvaluatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\FunctionNodeTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\MethodNodeTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpADDTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpANDTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpORTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\OpXORTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\PropertyOrFieldNodeTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\ReferenceNodeTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\SelectionNodeTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\ConversionProcessorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Expressions\Processors\OrderByProcessorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\AbstractLocalizerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\CultureInfoUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\CultureTestScope.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\BooleanFormatterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\CurrencyFormatterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\DateTimeFormatterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\FilteringFormatterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\FloatFormatterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\HasTextFilteringFormatterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\IntegerFormatterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\NumberFormatterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Formatters\PercentFormatterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Localizers\ResourceSetLocalizerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Globalization\Resolvers\DefaultCultureResolverTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\DerivedTestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\ExpressionTestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\IndexedTestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\INestedTestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\IOther.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\IPerson.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\ITestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\LazyTestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\MutablePropertyValuesTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\NestedTestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\NotWritablePropertyExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\NumberTestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\ObjectWrapperTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\PropertyAccessExceptionsExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\PropertyValueTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\ResourceTestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\SerializablePerson.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\StaticTestEventHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\TestEventHandler.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\TestGenericObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\TestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\TestObject.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Objects\TestObjectDAO.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\TestObjectList.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\TestTransparentProxyFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\TypeMismatchExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\ValidatorTestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Events\Support\EventManipulationUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Events\Support\EventRegistryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\AbstractListableObjectFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\AbstractObjectFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\DefaultListableObjectFactoryPerfTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\DefaultListableObjectFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\DummyConfigurableFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\DummyFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\HasMap.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ISideEffectObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\KnowsIfInstantiated.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\LifecycleObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\MethodReplacerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\MustBeInitialized.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\NoSuchObjectDefinitionExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ObjectDefinitionStoreExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\ObjectFactoryUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\SideEffectObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\TestResource.txt"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Objects\Factory\UnsupportedObjectDefinitionImplementation.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Attributes\MyRequiredAttribute.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Attributes\RequiredAttributeObjectPostProcessorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Attributes\RequiredTestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Attributes\RequiredWithAllRequiredPropertiesProvided.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Objects\Factory\Attributes\RequiredWithCustomAttribute.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Objects\Factory\Attributes\RequiredWithOneRequiredPropertyOmitted.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Objects\Factory\Attributes\RequiredWithThreeRequiredPropertiesOmitted.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\AbstractFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\CommandLineArgsVariableSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ConfigSectionVariableSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ConfigurationReaderTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ConnectionStringsVariableSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ConfigurableVariableSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ConstructorArgumentValuesTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\CustomConverterConfigurerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\DelegateFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\DelegateObjectFactoryConfigurerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\DictionaryFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\EnvironmentVariableSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\EventValuesTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\FieldRetrievingFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ListFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\LogFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\MethodInvokingFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ObjectDefinitionVisitorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ObjectFactoryCreatingFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ObjectReferenceFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyFileVariableSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyOverrideConfigurerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyPathFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyPlaceholderConfigurerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\PropertyRetrievingFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\RegistryVariableSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ResourceHandlerConfigurerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\ResourceManagerFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\RuntimeObjectReferenceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\SetFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\SharedStateAwareProcessorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\SpecialFolderVariableSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\TypeAliasConfigurerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\TypedStringValueTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\VariableAccessorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Config\VariablePlaceholderConfigurerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\AutowireUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ChildObjectDefinitionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\DefaultObjectDefinitionFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\DelegatingMethodReplacerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\LookupMethodOverrideTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\LookupMethodReplacerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ObjectDefinitionBuilderTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ObjectDefinitionReaderUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\ReplacedMethodOverrideTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\RootObjectDefinitionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\SimpleInstantiationStrategyTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\ArrayCtorDependencyObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\ConstructorDependenciesObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\DependenciesObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\DerivedConstructorDependenciesObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\DoubleBooleanConstructorObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\DummyBo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\DummyDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\DummyReferencer.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\EventWiringTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\FactoryMethods.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\IDummyBo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\InstanceFactory.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\LocaleTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\MixedCollectionObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\NamespaceParserRegistryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\NamespaceParserRegistryTests_TestSchema.xsd"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\NamespaceParserRegistryTests_TestSchema_2.xsd"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\NullAppender.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\ObjectFactorySectionHandlerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\ObjectNameGenerationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\ReadOnlyXmlTestResource.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\SiimpleCtorWiringTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\SingleSimpleTypeConstructorObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\TestObjectCreator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\XmlListableObjectFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\XmlObjectCollectionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\XmlObjectDefinitionReaderTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\XmlObjectFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Xml\XmlParserResolverTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\AbstractSharedStateFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\ArgumentConvertingMethodInvokerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\AutoWiringEventHandlerValueTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\ByTypeSharedStateProviderTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\InstanceEventHandlerValueTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\MethodInvokerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\MutableSortDefinitionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\PropertyComparatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Support\StaticEventHandlerValueTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Pool\Support\SimplePoolTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\AbstractProxyTypeBuilderTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\CompositionProxyTypeBuilderTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\DynamicProxyManagerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\ExplicitCompositionProxyTypeBuilderTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Proxy\InheritanceProxyTypeBuilderTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\BasePropertyTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicConstructorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicFieldTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicIndexerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicMethodTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\DynamicPropertyTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\SafeFieldTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\SafePropertyTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Reflection\Dynamic\SafePropertyTests_TestObject.vb"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\Images.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\SampleResources.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\SimpleAppContext.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\Spring.Context.Tests.pt-BR.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\Spring.Context.Tests.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\Spring.Context.Tests.sr.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\Spring.Context.Tests.sr-Cyrl-CS.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\Spring.Context.Tests.sr-SP-Cyrl.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\Tesla.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\Tesla.sr.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\Tesla.sr-Cyrl-CS.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Resources\Tesla.sr-SP-Cyrl.resx"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Threading\AsyncTestMethod.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\AsyncTestTask.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\CallContextStorageTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\CommonThreadStorageTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\LatchTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\LogicalThreadContextTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\SemaphoreTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\SyncHolderTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\ThreadStaticStorageTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ArrayUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\AssertUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\CollectionUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\DefensiveEventRaiserTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\DelegateInfoTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\EventRaiserTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\NumberUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ObjectUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\PathMatcherTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\PatternMatchUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\PropertiesTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ReflectionUtilsMemberwiseCopyTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\ReflectionUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\SerializationTestUtils.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\StringUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\SystemUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\UniqueKeyTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\AnyValidatorGroupTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\CollectionValidatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ExclusiveValidatorGroupTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\HelperClasses.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ValidationErrorsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ValidationExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ValidationNamespaceParserTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ValidationNamespaceParserTests_WhenConfigFileIsNotValid.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Validation\ValidationNamespaceParserTests_WhenConfigFileIsValid.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Validation\ValidatorGroupTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\ValidatorReferenceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Actions\ErrorMessageActionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Actions\ExpressionActionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\ConditionValidatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\CreditCardValidatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\EmailValidatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\ISBNValidatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\RegularExpressionValidatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\RequiredValidatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\UrlValidatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\Integration\CreditCardValidatorIntegrationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\Integration\EmailValidatorIntegrationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\Integration\ISBNValidatorIntegrationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Validation\Validators\Integration\UrlValidatorIntegrationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/test/Spring/Spring.Core.Tests/Spring.Core.Tests.2005.csproj b/test/Spring/Spring.Core.Tests/Spring.Core.Tests.2005.csproj
deleted file mode 100644
index 6e44cf3c..00000000
--- a/test/Spring/Spring.Core.Tests/Spring.Core.Tests.2005.csproj
+++ /dev/null
@@ -1,891 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.Core.Tests</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Library</OutputType>
-    <RootNamespace>Spring</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Core.Tests\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG;NET_2_0;DEBUG_DYNAMIC</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>67, 618</NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-    <UseVSHostingProcess>false</UseVSHostingProcess>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Core.Tests\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>618</NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=2.1.0.0, Culture=neutral, PublicKeyToken=65e474d141e25e07, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="DotNetMock, Version=0.7.4.0, Culture=neutral, PublicKeyToken=805ea88df19095f6">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\DotNetMock.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.framework, Version=2.2.5.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="Rhino.Mocks, Version=2.9.6.40380, Culture=neutral, PublicKeyToken=0b3305902db7183f, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Rhino.Mocks.dll</HintPath>
-    </Reference>
-    <Reference Include="System">
-      <Name>System</Name>
-    </Reference>
-    <Reference Include="System.configuration" />
-    <Reference Include="System.Data">
-      <Name>System.Data</Name>
-    </Reference>
-    <Reference Include="System.Drawing">
-      <Name>System.Drawing</Name>
-    </Reference>
-    <Reference Include="System.EnterpriseServices" />
-    <Reference Include="System.Runtime.Serialization.Formatters.Soap" />
-    <Reference Include="System.Transactions" />
-    <Reference Include="System.Web" />
-    <Reference Include="System.Web.Services" />
-    <Reference Include="System.Windows.Forms" />
-    <Reference Include="System.Xml">
-      <Name>System.XML</Name>
-    </Reference>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="AssemblyInfo.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Caching\AbstractCacheTests.cs" />
-    <Compile Include="Caching\BaseCacheAttributeTests.cs" />
-    <Compile Include="Collections\AbstractQueueTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Collections\CaseInsensitiveHashtableTests.cs" />
-    <Compile Include="Collections\HashedSetTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Collections\HybridSetTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Collections\ImmutableSetTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Collections\LinkedListTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Collections\ListSetTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Collections\PriorityQueueTests.cs" />
-    <Compile Include="Collections\SetTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Collections\SortedSetTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Collections\StaticSetTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Collections\SynchronizedHashtableTests.cs" />
-    <Compile Include="CommonTypes.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\ApplicationEventArgsTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\CommonTypes.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\ContextExceptionTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\ContextListenerObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\EventListenerAttributeTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Events\ConsoleListenerTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\AbstractApplicationContextTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\AbstractMessageSourceTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\ApplicationContextAwareProcessorTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\ApplicationContextExtensionTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\ApplicationObjectSupportTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\Assembler.cs" />
-    <Compile Include="Context\Support\ContextLocatorHandlerTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\ContextRegistryTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\NamespaceParsersSectionHandlerTests.cs" />
-    <Compile Include="Context\Support\DefaultMessageSourceResolvableTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\DelegatingMessageSourceTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\Logic.cs" />
-    <Compile Include="Context\Support\MessageSourceAccessorTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\NullMessageSourceTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\ResourceSetMessageSourceTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\Service.cs" />
-    <Compile Include="Context\Support\StaticApplicationContextTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\StaticMessageSourceTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\TestObjectConfigParser.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\TypeAliasesSectionHandlerTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Context\Support\XmlApplicationContextTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="CoreExceptionTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Core\ComposedCriteriaTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Core\ControlFlowFactoryTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Core\IO\AssemblyResourceTest.cs" />
-    <Compile Include="Core\IO\ConfigurableResourceLoaderTests.cs" />
-    <Compile Include="Core\IO\FileSystemResourceCommonTests.cs" />
-    <Compile Include="Core\IO\FileSystemResourceTests.cs" />
-    <Compile Include="Core\IO\InputStreamResourceTests.cs" />
-    <Compile Include="Core\IO\ResourceConverterTests.cs" />
-    <Compile Include="Core\IO\ResourceHandlerRegistryTests.cs" />
-    <Compile Include="Core\IO\StringResourceTests.cs" />
-    <Compile Include="Core\IO\UrlResourceTest.cs" />
-    <Compile Include="Core\MethodArgumentsCriteriaTests.cs" />
-    <Compile Include="Core\MethodGenericArgumentsCountCriteriaTests.cs" />
-    <Compile Include="Core\MethodParametersCountCriteriaTests.cs" />
-    <Compile Include="Core\MethodParametersCriteriaTests.cs" />
-    <Compile Include="Core\MethodReturnTypeCriteriaTests.cs" />
-    <Compile Include="Core\OrderComparatorTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Core\RegularExpressionEventNameCriteriaTests.cs" />
-    <Compile Include="Core\RegularExpressionMethodNameCriteriaTests.cs" />
-    <Compile Include="Core\TypeConversion\CredentialConverterTests.cs" />
-    <Compile Include="Core\TypeConversion\CustomNumberConverterTests.cs" />
-    <Compile Include="Core\TypeConversion\FileInfoConverterTests.cs" />
-    <Compile Include="Core\TypeConversion\NameValueConverterTests.cs" />
-    <Compile Include="Core\TypeConversion\RegexConverterTests.cs" />
-    <Compile Include="Core\TypeConversion\RegistryKeyConverterTests.cs" />
-    <Compile Include="Core\TypeConversion\ResourceManagerTests.cs" />
-    <Compile Include="Core\TypeConversion\RGBColorConverterTests.cs" />
-    <Compile Include="Core\TypeConversion\RuntimeTypeConverterTests.cs" />
-    <Compile Include="Core\TypeConversion\StreamConverterTests.cs" />
-    <Compile Include="Core\TypeConversion\StringArrayConverterTests.cs" />
-    <Compile Include="Core\TypeConversion\TimeSpanConverterTests.cs" />
-    <Compile Include="Core\TypeConversion\TypeConversionUtilsTests.cs" />
-    <Compile Include="Core\TypeConversion\TypeConverterRegistryTests.cs" />
-    <Compile Include="Core\TypeConversion\UriConverterTests.cs" />
-    <Compile Include="Core\TypeResolution\CachedTypeResolverTests.cs" />
-    <Compile Include="Core\TypeResolution\GenericTypeResolverTests.cs" />
-    <Compile Include="Core\TypeResolution\TypeRegistryTests.cs" />
-    <Compile Include="Core\TypeResolution\TypeResolutionUtilsTests.cs" />
-    <Compile Include="Core\TypeResolution\TypeResolverTests.cs" />
-    <Compile Include="DataBinding\SimpleExpressionBindingTests.cs" />
-    <Compile Include="DataBinding\BaseBindingManagerTests.cs" />
-    <Compile Include="ExceptionsTest.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\ConstructorNodeTests.cs" />
-    <Compile Include="Expressions\ExpressionEvaluatorTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Expressions\FunctionNodeTests.cs" />
-    <Compile Include="Expressions\MethodNodeTests.cs" />
-    <Compile Include="Expressions\Processors\ConversionProcessorTests.cs" />
-    <Compile Include="Expressions\Processors\OrderByProcessorTests.cs" />
-    <Compile Include="Expressions\PropertyOrFieldNodeTests.cs" />
-    <Compile Include="Expressions\ReferenceNodeTests.cs" />
-    <Compile Include="Expressions\SelectionNodeTests.cs" />
-    <Compile Include="Globalization\AbstractLocalizerTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Globalization\CultureInfoUtils.cs" />
-    <Compile Include="Globalization\CultureTestScope.cs" />
-    <Compile Include="Globalization\Formatters\BooleanFormatterTests.cs" />
-    <Compile Include="Globalization\Formatters\CurrencyFormatterTests.cs" />
-    <Compile Include="Globalization\Formatters\DateTimeFormatterTests.cs" />
-    <Compile Include="Globalization\Formatters\FilteringFormatterTests.cs" />
-    <Compile Include="Globalization\Formatters\FloatFormatterTests.cs" />
-    <Compile Include="Globalization\Formatters\HasTextFilteringFormatterTests.cs" />
-    <Compile Include="Globalization\Formatters\IntegerFormatterTests.cs" />
-    <Compile Include="Globalization\Formatters\NumberFormatterTests.cs" />
-    <Compile Include="Globalization\Formatters\PercentFormatterTests.cs" />
-    <Compile Include="Globalization\Localizers\ResourceSetLocalizerTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Globalization\Resolvers\DefaultCultureResolverTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="HookableContextHandler.cs" />
-    <Compile Include="Objects\ExpressionTestObject.cs" />
-    <Compile Include="Objects\Factory\Attributes\MyRequiredAttribute.cs" />
-    <Compile Include="Objects\Factory\Attributes\RequiredAttributeObjectPostProcessorTests.cs" />
-    <Compile Include="Objects\Factory\Attributes\RequiredTestObject.cs" />
-    <Compile Include="Objects\Factory\Config\CommandLineArgsVariableSourceTests.cs" />
-    <Compile Include="Objects\Factory\Config\ConfigSectionVariableSourceTests.cs" />
-    <Compile Include="Objects\Factory\Config\ConnectionStringsVariableSourceTests.cs" />
-    <Compile Include="Objects\Factory\Config\ConfigurableVariableSourceTests.cs" />
-    <Compile Include="Objects\Factory\Config\DelegateObjectFactoryConfigurerTests.cs" />
-    <Compile Include="Objects\Factory\Config\ObjectDefinitionVisitorTests.cs" />
-    <Compile Include="Objects\Factory\Config\ResourceHandlerConfigurerTests.cs" />
-    <Compile Include="Objects\Factory\Config\PropertyFileVariableSourceTests.cs" />
-    <Compile Include="Objects\Factory\Config\SharedStateAwareProcessorTests.cs" />
-    <Compile Include="Objects\Factory\Config\SpecialFolderVariableSourceTests.cs" />
-    <Compile Include="Objects\Factory\Config\EnvironmentVariableSourceTests.cs" />
-    <Compile Include="Objects\Factory\Config\RegistryVariableSourceTests.cs" />
-    <Compile Include="Objects\Factory\Config\TypeAliasConfigurerTests.cs" />
-    <Compile Include="Objects\Factory\Config\VariableAccessorTests.cs" />
-    <Compile Include="Objects\Factory\Config\VariablePlaceholderConfigurerTests.cs" />
-    <Compile Include="Objects\Factory\DefaultListableObjectFactoryPerfTests.cs" />
-    <Compile Include="Objects\Factory\DummyConfigurableFactory.cs" />
-    <Compile Include="Objects\Factory\Support\ObjectDefinitionBuilderTests.cs" />
-    <Compile Include="Objects\Factory\Xml\ArrayCtorDependencyObject.cs" />
-    <Compile Include="Objects\Factory\Xml\LocaleTests.cs" />
-    <Compile Include="Objects\Factory\Xml\ObjectFactorySectionHandlerTests.cs" />
-    <Compile Include="Objects\Factory\Xml\ObjectNameGenerationTests.cs" />
-    <Compile Include="Objects\Factory\Xml\SiimpleCtorWiringTests.cs" />
-    <Compile Include="Objects\LazyTestObject.cs" />
-    <Compile Include="Objects\Support\AbstractSharedStateFactoryTests.cs" />
-    <Compile Include="Objects\Support\ByTypeSharedStateProviderTests.cs" />
-    <Compile Include="Objects\Support\MethodInvokerTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\TestGenericObject.cs" />
-    <Compile Include="Objects\ObjectWrapperTests.cs" />
-    <Compile Include="Objects\DerivedTestObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Events\Support\EventManipulationUtilsTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Events\Support\EventRegistryTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\AbstractListableObjectFactoryTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\AbstractObjectFactoryTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\AbstractFactoryObjectTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\ConfigurationReaderTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\ConstructorArgumentValuesTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\CustomConverterConfigurerTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\DelegateFactoryObjectTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\DictionaryFactoryObjectTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\EventValuesTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\FieldRetrievingFactoryObjectTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\ListFactoryObjectTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\LogFactoryObjectTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\MethodInvokingFactoryObjectTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\ObjectFactoryCreatingFactoryObjectTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\ObjectReferenceFactoryObjectTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\PropertyOverrideConfigurerTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\PropertyPathFactoryObjectTests.cs" />
-    <Compile Include="Objects\Factory\Config\PropertyPlaceholderConfigurerTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\PropertyRetrievingFactoryObjectTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\ResourceManagerFactoryObjectTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\RuntimeObjectReferenceTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\SetFactoryObjectTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Config\TypedStringValueTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\DefaultListableObjectFactoryTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\DummyFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\HasMap.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\ISideEffectObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\KnowsIfInstantiated.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\LifecycleObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\MethodReplacerTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\MustBeInitialized.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\NoSuchObjectDefinitionExceptionTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\ObjectDefinitionStoreExceptionTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\ObjectFactoryUtilsTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\SideEffectObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\AutowireUtilsTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\ChildObjectDefinitionTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\DefaultObjectDefinitionFactoryTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\DelegatingMethodReplacerTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\LookupMethodOverrideTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\LookupMethodReplacerTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\ObjectDefinitionReaderUtilsTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\ReplacedMethodOverrideTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\RootObjectDefinitionTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Support\SimpleInstantiationStrategyTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\UnsupportedObjectDefinitionImplementation.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\ConstructorDependenciesObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\DependenciesObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\DerivedConstructorDependenciesObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\DoubleBooleanConstructorObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\DummyBo.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\DummyDao.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\DummyReferencer.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\EventWiringTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\FactoryMethods.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\IDummyBo.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\InstanceFactory.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\MixedCollectionObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\NullAppender.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\ReadOnlyXmlTestResource.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\SingleSimpleTypeConstructorObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\TestObjectCreator.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\XmlListableObjectFactoryTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\XmlObjectCollectionTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\XmlObjectDefinitionReaderTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\XmlObjectFactoryTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Factory\Xml\XmlParserResolverTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\IndexedTestObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\INestedTestObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\IOther.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\IPerson.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\ITestObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\MutablePropertyValuesTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\NestedTestObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\NotWritablePropertyExceptionTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\NumberTestObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\PropertyAccessExceptionsExceptionTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\PropertyValueTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\ResourceTestObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\SerializablePerson.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\StaticTestEventHandler.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Support\ArgumentConvertingMethodInvokerTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Support\AutoWiringEventHandlerValueTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Support\InstanceEventHandlerValueTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Support\MutableSortDefinitionTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Support\PropertyComparatorTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\Support\StaticEventHandlerValueTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\TestEventHandler.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\TestObject.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\TestObjectDAO.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\TestObjectList.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\TestTransparentProxyFactory.cs" />
-    <Compile Include="Objects\TypeMismatchExceptionTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Objects\ValidatorTestObject.cs">
-    </Compile>
-    <Compile Include="Pool\Support\SimplePoolTest.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Proxy\AbstractProxyTypeBuilderTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Proxy\CompositionProxyTypeBuilderTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Proxy\DynamicProxyManagerTests.cs" />
-    <Compile Include="Proxy\ExplicitCompositionProxyTypeBuilderTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Proxy\InheritanceProxyTypeBuilderTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Reflection\Dynamic\BasePropertyTests.cs" />
-    <Compile Include="Reflection\Dynamic\DynamicConstructorTests.cs" />
-    <Compile Include="Reflection\Dynamic\DynamicFieldTests.cs" />
-    <Compile Include="Reflection\Dynamic\DynamicIndexerTests.cs" />
-    <Compile Include="Reflection\Dynamic\DynamicMethodTests.cs" />
-    <Compile Include="Reflection\Dynamic\DynamicPropertyTests.cs" />
-    <Compile Include="Reflection\Dynamic\SafeFieldTests.cs" />
-    <Compile Include="Reflection\Dynamic\SafePropertyTests.cs" />
-    <Compile Include="SecurityTemplate.cs" />
-    <Compile Include="StandardsComplianceTest.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="StopWatch.cs" />
-    <Compile Include="StreamHelperDecorator.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="TestResourceLoader.cs" />
-    <Compile Include="Threading\AsyncTestMethod.cs" />
-    <Compile Include="Threading\AsyncTestTask.cs" />
-    <Compile Include="Threading\CallContextStorageTests.cs" />
-    <Compile Include="Threading\LatchTest.cs" />
-    <Compile Include="Threading\LogicalThreadContextTest.cs" />
-    <Compile Include="Threading\SemaphoreTest.cs" />
-    <Compile Include="Threading\SyncHolderTest.cs" />
-    <Compile Include="Threading\CommonThreadStorageTests.cs" />
-    <Compile Include="Threading\ThreadStaticStorageTests.cs" />
-    <Compile Include="Util\ArrayUtilsTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Util\AssertUtilsTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Util\CollectionUtilsTests.cs" />
-    <Compile Include="Util\ConfigXmlDocumentTests.cs" />
-    <Compile Include="Util\ObjectUtilsTests.cs" />
-    <Compile Include="Util\PatternMatchUtilsTests.cs" />
-    <Compile Include="Util\DefensiveEventRaiserTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Util\DelegateInfoTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Util\EventRaiserTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Util\NumberUtilsTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Util\PathMatcherTest.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Util\PropertiesTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Util\ReflectionUtilsMemberwiseCopyTests.cs" />
-    <Compile Include="Util\ReflectionUtilsTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Util\SerializationTestUtils.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Util\StringUtilsTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Core\TypeConversion\UniqueKeyConverterTests.cs" />
-    <Compile Include="Util\SystemUtilsTests.cs" />
-    <Compile Include="Util\UniqueKeyTests.cs" />
-    <Compile Include="Validation\Actions\ErrorMessageActionTests.cs" />
-    <Compile Include="Validation\Actions\ExpressionActionTests.cs" />
-    <Compile Include="Validation\AnyValidatorGroupTests.cs" />
-    <Compile Include="Validation\ExclusiveValidatorGroupTests.cs" />
-    <Compile Include="Validation\HelperClasses.cs" />
-    <Compile Include="Validation\ValidationExceptionTests.cs" />
-    <Compile Include="Validation\ValidationErrorsTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Validation\ValidatorGroupTests.cs" />
-    <Compile Include="Validation\ValidatorReferenceTests.cs" />
-    <Compile Include="Validation\CollectionValidatorTests.cs" />
-    <Compile Include="Validation\Validators\ConditionValidatorTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Validation\Validators\CreditCardValidatorTests.cs" />
-    <Compile Include="Validation\Validators\Integration\UrlValidatorIntegrationTests.cs" />
-    <Compile Include="Validation\Validators\Integration\EmailValidatorIntegrationTests.cs" />
-    <Compile Include="Validation\Validators\Integration\CreditCardValidatorIntegrationTests.cs" />
-    <Compile Include="Validation\Validators\Integration\ISBNValidatorIntegrationTests.cs" />
-    <Compile Include="Validation\Validators\ISBNValidatorTests.cs" />
-    <Compile Include="Validation\Validators\EmailValidatorTests.cs" />
-    <Compile Include="Validation\Validators\UrlValidatorTests.cs" />
-    <Compile Include="Validation\Validators\RegularExpressionValidatorTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Validation\Validators\RequiredValidatorTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <EmbeddedResource Include="Context\Support\testobject.xsd">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="Data\Spring\Objects\Factory\Config\two.properties" />
-    <EmbeddedResource Include="Data\Spring\Objects\Factory\Config\one.properties" />
-    <None Include="Context\Support\testobject.xsx">
-      <DependentUpon>testobject.xsd</DependentUpon>
-    </None>
-    <None Include="Spring.Core.Tests.build" />
-    <EmbeddedResource Include="Context\Support\contextB.xml" />
-    <EmbeddedResource Include="Context\Support\contextC.xml" />
-    <EmbeddedResource Include="Context\Support\import1.xml" />
-    <EmbeddedResource Include="Context\Support\contextA.xml" />
-    <EmbeddedResource Include="Context\Support\simpleContext.xml" />
-    <EmbeddedResource Include="Context\Support\invalidValueType.xml" />
-    <EmbeddedResource Include="Context\Support\invalidType.xml" />
-    <EmbeddedResource Include="Core\TypeResolution\aliasedObjects.xml" />
-    <EmbeddedResource Include="Core\IO\TestResource.txt" />
-    <EmbeddedResource Include="Context\Support\innerObjectsWithPostProcessor.xml" />
-    <Content Include="Data\PathMatcher\EmptyPattern.test" />
-    <Content Include="Data\PathMatcher\Examples.test" />
-    <Content Include="Data\PathMatcher\InBetween.test" />
-    <Content Include="Data\PathMatcher\MatchAll.test" />
-    <Content Include="Data\PathMatcher\PatternsAreCaseSensitive.test" />
-    <Content Include="Data\PathMatcher\SingleCaracters.test" />
-    <Content Include="Data\PathMatcher\SlurpPrependedDirectories.test" />
-    <Content Include="Data\PathMatcher\SpringAssembliesPrefix.test" />
-    <Content Include="Data\PathMatcher\ThisDirectory.test" />
-    <Content Include="Data\Spring\Context\Support\SPRNET-192.xml" />
-    <Content Include="Data\Spring\Objects\Factory\concurrent.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Config\AnotherDaoConfig.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Config\PPCWithTypesTests.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Config\TypeAliases.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Config\DaoConfig.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Config\DatabaseConfig.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Config\PPC-SPRNET-55.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Config\PPCTwoLocationsOneSectionTests.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Config\PPCTwoLocationsTwoSectionsTests.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Config\PropertyPlaceholderConfigurerTests.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Config\PropertyResourceConfigurerTests.xml" />
-    <Content Include="Data\Spring\Objects\Factory\leaf.xml" />
-    <Content Include="Data\Spring\Objects\Factory\middle.xml" />
-    <Content Include="Data\Spring\Objects\Factory\root.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\abstract.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\autowire.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\bad-external-resources.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\bad-named-constructor-arg.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\child.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\classnotfound.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\collections.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\constructor-arg.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\array-autowire.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\objectNameGeneration.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\simple-constructor-arg.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\expressions.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\default-autowire.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\default-lazy-init.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\dependenciesmaterializethis.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\enums.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\event-wiring-prototypes.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\event-wiring.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\external-resources.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\factory-methods.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\factorycircle.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\field-props-factory.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\initializers.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\invalid-factory.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\invalid.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\invoke-factory.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\lazy-init-multithreaded.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\locale.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\no-objects.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\notfullyspecified.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\parent.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\reftypes.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\resource.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\Resources\resource-imports.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\satisfiedalldependencycheck.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\satisfiedobjectdependencycheck.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\satisfiedsimpledependencycheck.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\schema-validation.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\test.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\unsatisfiedalldependencycheckmissingobjects.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\unsatisfiedAllDependencyCheckMissingSimple.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\unsatisfiedobjectdependencycheck.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\unsatisfiedsimpledependencycheck.xml" />
-    <Content Include="Data\Spring\Objects\Factory\Xml\wellformed-but-bad.xml" />
-    <EmbeddedResource Include="Objects\Factory\Attributes\RequiredWithOneRequiredPropertyOmitted.xml" />
-    <EmbeddedResource Include="Objects\Factory\Attributes\RequiredWithThreeRequiredPropertiesOmitted.xml" />
-    <EmbeddedResource Include="Objects\Factory\Attributes\RequiredWithAllRequiredPropertiesProvided.xml" />
-    <EmbeddedResource Include="Objects\Factory\Attributes\RequiredWithCustomAttribute.xml" />
-    <Content Include="Spring.Core.Tests.dll.config" />
-    <EmbeddedResource Include="Util\ConfigXmlDocumentTests_SampleConfig.xml" />
-    <EmbeddedResource Include="Context\contextlifecycle.xml" />
-    <EmbeddedResource Include="Context\Support\objects.xml" />
-    <EmbeddedResource Include="Objects\Factory\TestResource.txt" />
-    <EmbeddedResource Include="Objects\TestObject.resx">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="Resources\Tesla.sr-Cyrl-CS.resx">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="Resources\Spring.Context.Tests.sr-Cyrl-CS.resx">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="Resources\Images.resx">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="Resources\SampleResources.resx">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="Resources\SimpleAppContext.xml" />
-    <EmbeddedResource Include="Resources\Spring.Context.Tests.pt-BR.resx">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="Resources\Spring.Context.Tests.resx">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="Resources\Spring.Context.Tests.sr-SP-Cyrl.resx">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="Resources\Spring.Context.Tests.sr.resx">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="Resources\Tesla.resx">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="Resources\Tesla.sr-SP-Cyrl.resx">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="Resources\Tesla.sr.resx">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="TestResource.txt" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Aop\Spring.Aop.2005.csproj">
-      <Project>{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}</Project>
-      <Name>Spring.Aop.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>echo "Copying .xml files for tests"
-xcopy "$(ProjectDir)Data" ..\..\..\..\build\VS.Net.2005\Spring.Core.Tests\$(ConfigurationName)\ /y /s /q /d
-xcopy "$(ProjectDir)$(TargetFileName).config" ..\..\..\..\build\VS.Net.2005\Spring.Core.Tests\$(ConfigurationName)\ /y /s /q</PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/test/Spring/Spring.Data.Integration.Tests/Spring.Data.Integration.Tests.2003.csproj b/test/Spring/Spring.Data.Integration.Tests/Spring.Data.Integration.Tests.2003.csproj
deleted file mode 100644
index 54f6a85c..00000000
--- a/test/Spring/Spring.Data.Integration.Tests/Spring.Data.Integration.Tests.2003.csproj
+++ /dev/null
@@ -1,439 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{A9D3732A-D40B-4C35-80CE-9C4A53D2DEAD}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Data.Integration.Tests"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = 'echo "Copying .xml files for tests"&#xd;&#xa;xcopy "$(ProjectDir)Data" ..\..\..\..\build\VS.Net.2003\Spring.Data.Integration.Tests\$(ConfigurationName)\ /y /s /q /d&#xd;&#xa;xcopy  "$(ProjectDir)$(TargetFileName).config" ..\..\..\..\build\VS.Net.2003\Spring.Data.Integration.Tests\$(ConfigurationName)\ /y /s /q'
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Data.Integration.Tests\Debug-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Data.Integration.Tests\Release-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "nunit.framework"
-                    AssemblyName = "nunit.framework"
-                    HintPath = "..\..\..\lib\Net\1.1\nunit.framework.dll"
-                />
-                <Reference
-                    Name = "System.Data.OracleClient"
-                    AssemblyName = "System.Data.OracleClient"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.OracleClient.dll"
-                />
-                <Reference
-                    Name = "Spring.Aop.2003"
-                    Project = "{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Core.2003"
-                    Project = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Core.Tests.2003"
-                    Project = "{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Data.2003"
-                    Project = "{E10A3BED-795F-41CB-A4A8-8C4B342ACDDF}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\lib\Net\1.1\Common.Logging.dll"
-                />
-                <Reference
-                    Name = "Spring.Testing.NUnit.2003"
-                    Project = "{6B8639E3-88BB-4F7B-9F23-699E84C30D58}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "Spring.Data.Integration.Tests.build"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Spring.Data.Integration.Tests.dll.config"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\AccountCreditDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\AccountDebitDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\AccountManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\AdoDaoTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\AdoTemplatePerformanceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\AdoTemplateTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\adoTemplateTests.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\autoDeclarativeServices.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\AutoDeclarativeTxTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\CallCreateTestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\ConsoleLoggingAroundAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\CreateTestObject.sql"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\CreateTestObjectNonQuery.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\CreditsDebitsSchema.sql"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\declarativeServices.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\DeclarativeTxTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\DTC1.1AppContext.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\DTCAppContext.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\DTCAppContextNoInterfaces.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\DTCTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\DTCTestsNoInterfaces.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\IAccountCreditDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\IAccountDebitDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\IAccountManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\ITestCoordinator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\ITestObjectDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\ITestObjectManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\MappingAdoQueryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NativeAdoTestObjectDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NativeAdoTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\nativeAdoTests.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\NestedTxScopeTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\OracleAdoTemplateTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\oracleAdoTemplateTests.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\SimpleAccountCreditDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\SimpleAccountDebitDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\SimpleAccountManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\SQLiteTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\StoredProcedureTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\templateTests.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\TestCoordinator.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\TestObjectDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\TestObjectManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\TestObjectQuery.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\testobjects-sqlserver.sql"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\TestObjectStoredProcedure.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\TestTxIsolationLevel.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\TestTxIsolationLevelTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\TransactionTemplateTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Generic\GenericAdoTemplateTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Generic\GenericAdoTemplateTests.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Generic\ITestObjectDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Generic\TestObjectDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Generic\TestObjectRowMapper.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Northwind\AdoTemplateShipperDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Northwind\IShipperDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Northwind\NativeAdoShipperDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Northwind\Shipper.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Objects\Generic\MappingVacationQuery.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Objects\Generic\StoredProcedureTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Objects\Generic\Vacation.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Objects\Generic\VacationRowMapper.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Support\SimpleExceptionTranslationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/test/Spring/Spring.Data.Integration.Tests/Spring.Data.Integration.Tests.2005.csproj b/test/Spring/Spring.Data.Integration.Tests/Spring.Data.Integration.Tests.2005.csproj
deleted file mode 100644
index f1439cb2..00000000
--- a/test/Spring/Spring.Data.Integration.Tests/Spring.Data.Integration.Tests.2005.csproj
+++ /dev/null
@@ -1,206 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{91766D21-C568-459F-9BEA-759B011F23CF}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.Data.Integration.Tests</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Library</OutputType>
-    <RootNamespace>Spring</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.Integration.Tests\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>67, 618</NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningsAsErrors>168</WarningsAsErrors>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.Integration.Tests\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=2.1.0.0, Culture=neutral, PublicKeyToken=65e474d141e25e07, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="DotNetMock, Version=0.7.4.0, Culture=neutral, PublicKeyToken=805ea88df19095f6">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\DotNetMock.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.framework, Version=2.2.5.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="System">
-      <Name>System</Name>
-    </Reference>
-    <Reference Include="System.configuration" />
-    <Reference Include="System.Data">
-      <Name>System.Data</Name>
-    </Reference>
-    <Reference Include="System.Data.OracleClient" />
-    <Reference Include="System.Drawing">
-      <Name>System.Drawing</Name>
-    </Reference>
-    <Reference Include="System.Transactions" />
-    <Reference Include="System.Xml">
-      <Name>System.XML</Name>
-    </Reference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Aop\Spring.Aop.2005.csproj">
-      <Project>{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}</Project>
-      <Name>Spring.Aop.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Data\Spring.Data.2005.csproj">
-      <Project>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</Project>
-      <Name>Spring.Data.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Testing.NUnit\Spring.Testing.NUnit.2005.csproj">
-      <Project>{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}</Project>
-      <Name>Spring.Testing.NUnit.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Core.Tests\Spring.Core.Tests.2005.csproj">
-      <Project>{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}</Project>
-      <Name>Spring.Core.Tests.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <ItemGroup>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="Data\AccountCreditDao.cs" />
-    <Compile Include="Data\AccountDebitDao.cs" />
-    <Compile Include="Data\AccountManager.cs" />
-    <Compile Include="Data\AdoDaoTests.cs" />
-    <Compile Include="Data\AdoTemplatePerformanceTests.cs" />
-    <Compile Include="Data\AdoTemplateTests.cs" />
-    <Compile Include="Data\AutoDeclarativeTxTests.cs" />
-    <Compile Include="Data\CallCreateTestObject.cs" />
-    <Compile Include="Data\ConsoleLoggingAroundAdvice.cs" />
-    <Compile Include="Data\OracleAdoTemplateTests.cs" />
-    <Compile Include="Data\TestTxIsolationLevelTests.cs" />
-    <Compile Include="Data\Generic\GenericAdoTemplateTests.cs" />
-    <Compile Include="Data\Generic\ITestObjectDao.cs" />
-    <Compile Include="Data\Objects\Generic\VacationRowMapper.cs" />
-    <Compile Include="Data\Objects\Generic\StoredProcedureTests.cs" />
-    <Compile Include="Data\Generic\TestObjectDao.cs" />
-    <Compile Include="Data\Generic\TestObjectRowMapper.cs" />
-    <Compile Include="Data\ITestCoordinator.cs" />
-    <Compile Include="Data\Objects\Generic\Vacation.cs" />
-    <Compile Include="Data\SimpleAccountManager.cs" />
-    <Compile Include="Data\SimpleAccountDebitDao.cs" />
-    <Compile Include="Data\SimpleAccountCreditDao.cs" />
-    <Compile Include="Data\DTCTestsNoInterfaces.cs" />
-    <Compile Include="Data\CreateTestObjectNonQuery.cs" />
-    <Compile Include="Data\DeclarativeTxTests.cs" />
-    <Compile Include="Data\DTCTests.cs" />
-    <Compile Include="Data\IAccountCreditDao.cs" />
-    <Compile Include="Data\IAccountDebitDao.cs" />
-    <Compile Include="Data\IAccountManager.cs" />
-    <Compile Include="Data\ITestObjectDao.cs" />
-    <Compile Include="Data\ITestObjectManager.cs" />
-    <Compile Include="Data\MappingAdoQueryTests.cs" />
-    <Compile Include="Data\NativeAdoTestObjectDao.cs" />
-    <Compile Include="Data\NativeAdoTests.cs" />
-    <Compile Include="Data\Northwind\AdoTemplateShipperDao.cs" />
-    <Compile Include="Data\Northwind\IShipperDao.cs" />
-    <Compile Include="Data\Northwind\NativeAdoShipperDao.cs" />
-    <Compile Include="Data\Northwind\Shipper.cs" />
-    <Compile Include="Data\SQLiteTests.cs" />
-    <Compile Include="Data\StoredProcedureTests.cs" />
-    <Compile Include="Data\Support\SimpleExceptionTranslationTests.cs" />
-    <Compile Include="Data\TestCoordinator.cs" />
-    <Compile Include="Data\TestObjectDao.cs" />
-    <Compile Include="Data\TestObjectManager.cs" />
-    <Compile Include="Data\TestObjectQuery.cs" />
-    <Compile Include="Data\TestObjectStoredProcedure.cs" />
-    <Compile Include="Data\TransactionTemplateTests.cs" />
-    <Compile Include="Data\NestedTxScopeTests.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\adoTemplateTests.xml" />
-    <EmbeddedResource Include="Data\declarativeServices.xml" />
-    <EmbeddedResource Include="Data\DTCAppContext.xml" />
-    <EmbeddedResource Include="Data\autoDeclarativeServices.xml" />
-    <EmbeddedResource Include="Data\DTCAppContextNoInterfaces.xml" />
-    <EmbeddedResource Include="Data\Generic\GenericAdoTemplateTests.xml" />
-    <EmbeddedResource Include="Data\nativeAdoTests.xml" />
-    <EmbeddedResource Include="Data\oracleAdoTemplateTests.xml" />
-    <EmbeddedResource Include="Data\templateTests.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="Spring.Data.Integration.Tests.build" />
-    <None Include="Spring.Data.Integration.Tests.dll.config">
-      <CopyToOutputDirectory>Always</CopyToOutputDirectory>
-    </None>
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\TestTxIsolationLevel.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <Content Include="Data\CreateTestObject.sql" />
-    <Content Include="Data\CreditsDebitsSchema.sql" />
-    <Content Include="Data\DTC1.1AppContext.xml" />
-    <Content Include="Data\testobjects-sqlserver.sql" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>
-    </PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/test/Spring/Spring.Data.NHibernate.Integration.Tests/Spring.Data.NHibernate.Integration.Tests.2003.csproj b/test/Spring/Spring.Data.NHibernate.Integration.Tests/Spring.Data.NHibernate.Integration.Tests.2003.csproj
deleted file mode 100644
index a3823a90..00000000
--- a/test/Spring/Spring.Data.NHibernate.Integration.Tests/Spring.Data.NHibernate.Integration.Tests.2003.csproj
+++ /dev/null
@@ -1,267 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{8DA67FF2-C473-4329-8FF6-3747182196D7}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Data.NHibernate.Integration.Tests"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = 'echo "Copying .xml files for tests"&#xd;&#xa;xcopy "$(ProjectDir)Data" ..\..\..\..\build\VS.Net.2003\$(TargetName)\$(ConfigurationName)\ /y /s /q /d&#xd;&#xa;copy  "$(ProjectDir)$(TargetFileName).config" ..\..\..\..\build\VS.Net.2003\$(TargetName)\$(ConfigurationName)\$(TargetFileName).config'
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Data.NHibernate.Integration.Tests\Debug-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Data.NHibernate.Integration.Tests\Debug-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "nunit.framework"
-                    AssemblyName = "nunit.framework"
-                    HintPath = "..\..\..\lib\Net\1.1\nunit.framework.dll"
-                />
-                <Reference
-                    Name = "NHibernate"
-                    AssemblyName = "NHibernate"
-                    HintPath = "..\..\..\lib\NHibernate12\net\1.1\NHibernate.dll"
-                />
-                <Reference
-                    Name = "Castle.DynamicProxy"
-                    AssemblyName = "Castle.DynamicProxy"
-                    HintPath = "..\..\..\lib\NHibernate12\net\1.1\Castle.DynamicProxy.dll"
-                />
-                <Reference
-                    Name = "Iesi.Collections"
-                    AssemblyName = "Iesi.Collections"
-                    HintPath = "..\..\..\lib\NHibernate12\net\1.1\Iesi.Collections.dll"
-                />
-                <Reference
-                    Name = "log4net"
-                    AssemblyName = "log4net"
-                    HintPath = "..\..\..\lib\NHibernate12\net\1.1\log4net.dll"
-                />
-                <Reference
-                    Name = "Common.Logging.Log4Net"
-                    AssemblyName = "Common.Logging.Log4Net"
-                    HintPath = "..\..\..\lib\Net\1.1\Common.Logging.Log4Net.dll"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\lib\Net\1.1\Common.Logging.dll"
-                />
-                <Reference
-                    Name = "Spring.Core.2003"
-                    Project = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Data.2003"
-                    Project = "{E10A3BED-795F-41CB-A4A8-8C4B342ACDDF}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Data.NHibernate12.2003"
-                    Project = "{2E12AE3E-5690-46A5-9F89-80F1D3004ADB}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Spring.Data.NHibernate.Integration.Tests.dll.config"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\NHibernate\AccountCreditDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\AccountDebitDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\AccountManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\AuditDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\Credit.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\Credit.hbm.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\NHibernate\creditdebit.sql"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\NHibernate\Debit.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\Debit.hbm.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\NHibernate\IAccountCreditDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\IAccountDebitDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\IAccountManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\IAuditDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\ITestObjectDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\MultipleDbTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\MultipleDbTests.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\NHibernate\NativeNHTestObjectDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\NativeNHTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\NHDAOTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\NHDAOTests.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\NHibernate\NHTestObjectDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\TemplateTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\templateTests.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\NHibernate\TestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\TestObject.hbm.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/test/Spring/Spring.Data.NHibernate.Integration.Tests/Spring.Data.NHibernate.Integration.Tests.2005.csproj b/test/Spring/Spring.Data.NHibernate.Integration.Tests/Spring.Data.NHibernate.Integration.Tests.2005.csproj
deleted file mode 100644
index e7af015f..00000000
--- a/test/Spring/Spring.Data.NHibernate.Integration.Tests/Spring.Data.NHibernate.Integration.Tests.2005.csproj
+++ /dev/null
@@ -1,129 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{4A07E150-ED90-407C-8CAD-4760444DDFD9}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Data.NHibernate.Integration.Tests</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.NHibernate.Integration.Tests\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.NHibernate.Integration.Tests\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Castle.DynamicProxy, Version=1.1.5.0, Culture=neutral, PublicKeyToken=407dd0808d44fbdc, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate12\net\2.0\Castle.DynamicProxy.dll</HintPath>
-    </Reference>
-    <Reference Include="Common.Logging, Version=1.0.2.0, Culture=neutral, PublicKeyToken=af08829b84f0328e">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="Iesi.Collections, Version=1.0.0.3, Culture=neutral, PublicKeyToken=aa95f207798dfdb4, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate12\net\2.0\Iesi.Collections.dll</HintPath>
-    </Reference>
-    <Reference Include="log4net, Version=1.2.10.0, Culture=neutral, PublicKeyToken=1b44e1d426115821, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate12\net\2.0\log4net.dll</HintPath>
-    </Reference>
-    <Reference Include="NHibernate, Version=1.2.1.4000, Culture=neutral, PublicKeyToken=aa95f207798dfdb4, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate12\net\2.0\NHibernate.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.framework, Version=2.4.1.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="AssemblyInfo.cs" />
-    <Compile Include="Data\NHibernate\AccountCreditDao.cs" />
-    <Compile Include="Data\NHibernate\AccountDebitDao.cs" />
-    <Compile Include="Data\NHibernate\AccountManager.cs" />
-    <Compile Include="Data\NHibernate\AuditDao.cs" />
-    <Compile Include="Data\NHibernate\Credit.cs" />
-    <Compile Include="Data\NHibernate\DbProviderTemplateTests.cs" />
-    <Compile Include="Data\NHibernate\Debit.cs" />
-    <Compile Include="Data\NHibernate\IAccountCreditDao.cs" />
-    <Compile Include="Data\NHibernate\IAccountDebitDao.cs" />
-    <Compile Include="Data\NHibernate\IAccountManager.cs" />
-    <Compile Include="Data\NHibernate\IAuditDao.cs" />
-    <Compile Include="Data\NHibernate\ITestObjectDao.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Data\NHibernate\MultipleDbTests.cs" />
-    <Compile Include="Data\NHibernate\NativeNHTestObjectDao.cs" />
-    <Compile Include="Data\NHibernate\NativeNHTests.cs" />
-    <Compile Include="Data\NHibernate\NHDAOTests.cs" />
-    <Compile Include="Data\NHibernate\NHTestObjectDao.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Data\NHibernate\TemplateTests.cs" />
-    <Compile Include="Data\NHibernate\TestObject.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\NHibernate\dbProviderTemplateTests.xml" />
-    <EmbeddedResource Include="Data\NHibernate\Credit.hbm.xml" />
-    <Content Include="Data\NHibernate\creditdebit.sql" />
-    <EmbeddedResource Include="Data\NHibernate\Debit.hbm.xml" />
-    <Content Include="Data\NHibernate\MultipleDbTests.xml" />
-    <EmbeddedResource Include="Data\NHibernate\NHDAOTests.xml" />
-    <EmbeddedResource Include="Data\NHibernate\templateTests.xml" />
-    <EmbeddedResource Include="Data\NHibernate\TestObject.hbm.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Aop\Spring.Aop.2005.csproj">
-      <Project>{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}</Project>
-      <Name>Spring.Aop.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Data.NHibernate12\Spring.Data.NHibernate12.2005.csproj">
-      <Project>{90F2D070-6F98-4926-A626-BD7A6071D6D9}</Project>
-      <Name>Spring.Data.NHibernate12.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Data\Spring.Data.2005.csproj">
-      <Project>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</Project>
-      <Name>Spring.Data.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="Spring.Data.NHibernate.Integration.Tests.dll.config" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it.
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-  <PropertyGroup>
-    <PostBuildEvent>echo "Copying .xml files for tests"
-xcopy "$(ProjectDir)Data" ..\..\..\..\build\VS.Net.2005\Spring.Data.NHibernate.Integration.Tests\$(ConfigurationName)\ /y /s /q /d
-xcopy "$(ProjectDir)$(TargetFileName).config" ..\..\..\..\build\VS.Net.2005\Spring.Data.NHibernate.Integration.Tests\$(ConfigurationName)\ /y /s /q</PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/test/Spring/Spring.Data.NHibernate.Tests/Spring.Data.NHibernate.Tests.2003.csproj b/test/Spring/Spring.Data.NHibernate.Tests/Spring.Data.NHibernate.Tests.2003.csproj
deleted file mode 100644
index 2c562b07..00000000
--- a/test/Spring/Spring.Data.NHibernate.Tests/Spring.Data.NHibernate.Tests.2003.csproj
+++ /dev/null
@@ -1,227 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{8755D942-7828-4971-835B-37A5992C06C9}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Data.NHibernate.Tests"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = 'echo "Copying .xml files for tests"&#xd;&#xa;xcopy "$(ProjectDir)Data" ..\..\..\..\build\VS.Net.2003\Spring.Data.NHibernate.Tests\$(ConfigurationName)\ /y /s /q /d&#xd;&#xa;xcopy  "$(ProjectDir)$(TargetFileName).config" ..\..\..\..\build\VS.Net.2003\Spring.Data.NHibernate.Tests\$(ConfigurationName)\ /y /s /q'
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Data.NHibernate.Tests\Debug-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Data.NHibernate.Tests\Release-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "System.XML.dll"
-                />
-                <Reference
-                    Name = "nunit.framework"
-                    AssemblyName = "nunit.framework"
-                    HintPath = "..\..\..\lib\net\1.1\nunit.framework.dll"
-                />
-                <Reference
-                    Name = "Spring.Core.2003"
-                    Project = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Aop.2003"
-                    Project = "{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Data.2003"
-                    Project = "{E10A3BED-795F-41CB-A4A8-8C4B342ACDDF}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Data.Tests.2003"
-                    Project = "{C5585365-561C-4EC4-8956-87FFBD9AB1CD}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Rhino.Mocks"
-                    AssemblyName = "Rhino.Mocks"
-                    HintPath = "..\..\..\lib\Net\1.1\Rhino.Mocks.dll"
-                />
-                <Reference
-                    Name = "NHibernate"
-                    AssemblyName = "NHibernate"
-                    HintPath = "..\..\..\lib\NHibernate12\net\1.1\NHibernate.dll"
-                />
-                <Reference
-                    Name = "Castle.DynamicProxy"
-                    AssemblyName = "Castle.DynamicProxy"
-                    HintPath = "..\..\..\lib\NHibernate12\net\1.1\Castle.DynamicProxy.dll"
-                />
-                <Reference
-                    Name = "HashCodeProvider"
-                    AssemblyName = "HashCodeProvider"
-                    HintPath = "..\..\..\lib\NHibernate12\net\1.1\HashCodeProvider.dll"
-                />
-                <Reference
-                    Name = "Iesi.Collections"
-                    AssemblyName = "Iesi.Collections"
-                    HintPath = "..\..\..\lib\NHibernate12\net\1.1\Iesi.Collections.dll"
-                />
-                <Reference
-                    Name = "log4net"
-                    AssemblyName = "log4net"
-                    HintPath = "..\..\..\lib\NHibernate12\net\1.1\log4net.dll"
-                />
-                <Reference
-                    Name = "Spring.Data.NHibernate12.2003"
-                    Project = "{2E12AE3E-5690-46A5-9F89-80F1D3004ADB}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Spring.Data.NHibernate.Tests.dll.config"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Data\NHibernate\HibernateTransactionManagerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\ISimpleService.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\ITestObjectDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\LocalSessionFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\NHTestObjectDao.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\SessionFactoryUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\SimpleService.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\TestObject.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\TestObject.hbm.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\NHibernate\Config\AopConfiguration.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\Config\AopConfiguration.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\NHibernate\Support\ConfigSectionSessionScopeSettingsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\Support\SessionScopeSettingsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\NHibernate\Support\SessionScopeTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/test/Spring/Spring.Data.NHibernate.Tests/Spring.Data.NHibernate.Tests.2005.csproj b/test/Spring/Spring.Data.NHibernate.Tests/Spring.Data.NHibernate.Tests.2005.csproj
deleted file mode 100644
index d496d81d..00000000
--- a/test/Spring/Spring.Data.NHibernate.Tests/Spring.Data.NHibernate.Tests.2005.csproj
+++ /dev/null
@@ -1,128 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Data.NHibernate.Tests</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.NHibernate.Tests\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0,NH_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.NHibernate.Tests\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Castle.Core, Version=1.0.3.0, Culture=neutral, PublicKeyToken=407dd0808d44fbdc, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate20\net\2.0\Castle.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="Castle.DynamicProxy2, Version=2.0.3.0, Culture=neutral, PublicKeyToken=407dd0808d44fbdc, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate20\net\2.0\Castle.DynamicProxy2.dll</HintPath>
-    </Reference>
-    <Reference Include="Common.Logging, Version=1.1.0.0, Culture=neutral, PublicKeyToken=af08829b84f0328e">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="Iesi.Collections, Version=1.0.0.3, Culture=neutral, PublicKeyToken=aa95f207798dfdb4, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate20\net\2.0\Iesi.Collections.dll</HintPath>
-    </Reference>
-    <Reference Include="log4net, Version=1.2.10.0, Culture=neutral, PublicKeyToken=1b44e1d426115821, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate20\net\2.0\log4net.dll</HintPath>
-    </Reference>
-    <Reference Include="NHibernate, Version=2.0.1.4000, Culture=neutral, PublicKeyToken=aa95f207798dfdb4, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate20\net\2.0\NHibernate.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.framework, Version=2.2.7.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="Rhino.Mocks, Version=2.9.6.40380, Culture=neutral, PublicKeyToken=0b3305902db7183f, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Rhino.Mocks.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Aop\Spring.Aop.2005.csproj">
-      <Project>{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}</Project>
-      <Name>Spring.Aop.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Data.NHibernate20\Spring.Data.NHibernate20.2005.csproj">
-      <Project>{71368632-B8B7-4A6A-8C65-8DA848120C82}</Project>
-      <Name>Spring.Data.NHibernate20.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Data\Spring.Data.2005.csproj">
-      <Project>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</Project>
-      <Name>Spring.Data.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Data.Tests\Spring.Data.Tests.2005.csproj">
-      <Project>{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}</Project>
-      <Name>Spring.Data.Tests.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="Data\NHibernate\Config\AopConfiguration.cs" />
-    <Compile Include="Data\NHibernate\HibernateTransactionManagerTests.cs" />
-    <Compile Include="Data\NHibernate\ISimpleService.cs" />
-    <Compile Include="Data\NHibernate\ITestObjectDao.cs" />
-    <Compile Include="Data\NHibernate\LocalSessionFactoryObjectTests.cs" />
-    <Compile Include="Data\NHibernate\NHTestObjectDao.cs" />
-    <Compile Include="Data\NHibernate\SessionFactoryUtilsTests.cs" />
-    <Compile Include="Data\NHibernate\SimpleService.cs" />
-    <Compile Include="Data\NHibernate\Support\ConfigSectionSessionScopeSettingsTests.cs" />
-    <Compile Include="Data\NHibernate\Support\SessionScopeSettingsTests.cs" />
-    <Compile Include="Data\NHibernate\Support\SessionScopeTests.cs" />
-    <Compile Include="Data\NHibernate\TestObject.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\NHibernate\Config\AopConfiguration.xml" />
-    <EmbeddedResource Include="Data\NHibernate\TestObject.hbm.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="Spring.Data.NHibernate.Tests.dll.config">
-      <CopyToOutputDirectory>Always</CopyToOutputDirectory>
-    </None>
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\NHibernate\Config\AopConfigurationTxPointcut.xml" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it.
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-  <PropertyGroup>
-    <PostBuildEvent>echo "Copying .xml files for tests"
-xcopy "$(ProjectDir)Data" ..\..\..\..\build\VS.Net.2005\Spring.Data.NHibernate.Tests\$(ConfigurationName)\ /y /s /q /d
-xcopy "$(ProjectDir)$(TargetFileName).config" ..\..\..\..\build\VS.Net.2005\Spring.Data.NHibernate.Tests\$(ConfigurationName)\ /y /s /q</PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/test/Spring/Spring.Data.NHibernate20.Integration.Tests/Spring.Data.NHibernate20.Integration.Tests.2005.csproj b/test/Spring/Spring.Data.NHibernate20.Integration.Tests/Spring.Data.NHibernate20.Integration.Tests.2005.csproj
deleted file mode 100644
index 8332a56e..00000000
--- a/test/Spring/Spring.Data.NHibernate20.Integration.Tests/Spring.Data.NHibernate20.Integration.Tests.2005.csproj
+++ /dev/null
@@ -1,173 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{4A07E150-ED90-407C-8CAD-4760444DDFD9}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Data.NHibernate20.Integration.Tests</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.NHibernate20.Integration.Tests\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0,NH_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.NHibernate20.Integration.Tests\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Castle.DynamicProxy, Version=1.1.5.0, Culture=neutral, PublicKeyToken=407dd0808d44fbdc, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate20\net\2.0\Castle.DynamicProxy.dll</HintPath>
-    </Reference>
-    <Reference Include="Common.Logging, Version=1.0.2.0, Culture=neutral, PublicKeyToken=af08829b84f0328e">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="Iesi.Collections, Version=1.0.0.3, Culture=neutral, PublicKeyToken=aa95f207798dfdb4, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate20\net\2.0\Iesi.Collections.dll</HintPath>
-    </Reference>
-    <Reference Include="log4net, Version=1.2.10.0, Culture=neutral, PublicKeyToken=1b44e1d426115821, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate20\net\2.0\log4net.dll</HintPath>
-    </Reference>
-    <Reference Include="NHibernate, Version=1.2.1.4000, Culture=neutral, PublicKeyToken=aa95f207798dfdb4, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate20\net\2.0\NHibernate.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.framework, Version=2.4.1.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\AccountCreditDao.cs">
-      <Link>Data\NHibernate\AccountCreditDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\AccountDebitDao.cs">
-      <Link>Data\NHibernate\AccountDebitDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\AccountManager.cs">
-      <Link>Data\NHibernate\AccountManager.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\AuditDao.cs">
-      <Link>Data\NHibernate\AuditDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\Credit.cs">
-      <Link>Data\NHibernate\Credit.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\DbProviderTemplateTests.cs">
-      <Link>Data\NHibernate\DbProviderTemplateTests.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\Debit.cs">
-      <Link>Data\NHibernate\Debit.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\IAccountCreditDao.cs">
-      <Link>Data\NHibernate\IAccountCreditDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\IAccountDebitDao.cs">
-      <Link>Data\NHibernate\IAccountDebitDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\IAccountManager.cs">
-      <Link>Data\NHibernate\IAccountManager.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\IAuditDao.cs">
-      <Link>Data\NHibernate\IAuditDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\ITestObjectDao.cs">
-      <Link>Data\NHibernate\ITestObjectDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\MultipleDbTests.cs">
-      <Link>Data\NHibernate\MultipleDbTests.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\NativeNHTestObjectDao.cs">
-      <Link>Data\NHibernate\NativeNHTestObjectDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\NativeNHTests.cs">
-      <Link>Data\NHibernate\NativeNHTests.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\NHDAOTests.cs">
-      <Link>Data\NHibernate\NHDAOTests.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\NHTestObjectDao.cs">
-      <Link>Data\NHibernate\NHTestObjectDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\TemplateTests.cs">
-      <Link>Data\NHibernate\TemplateTests.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\TestObject.cs">
-      <Link>Data\NHibernate\TestObject.cs</Link>
-    </Compile>
-    <Compile Include="AssemblyInfo.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\creditdebit.sql">
-      <Link>Data\NHibernate\creditdebit.sql</Link>
-    </None>
-    <None Include="Spring.Data.NHibernate20.Integration.Tests.dll.config" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Aop\Spring.Aop.2005.csproj">
-      <Project>{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}</Project>
-      <Name>Spring.Aop.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Data.NHibernate20\Spring.Data.NHibernate20.2005.csproj">
-      <Project>{71368632-B8B7-4A6A-8C65-8DA848120C82}</Project>
-      <Name>Spring.Data.NHibernate20.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Data\Spring.Data.2005.csproj">
-      <Project>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</Project>
-      <Name>Spring.Data.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\NHibernate\dbProviderTemplateTests.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\NHibernate\templateTests.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\NHibernate\Credit.hbm.xml" />
-    <EmbeddedResource Include="Data\NHibernate\NHDAOTests.xml" />
-    <EmbeddedResource Include="Data\NHibernate\TestObject.hbm.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\NHibernate\Debit.hbm.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\NHibernate\MultipleDbTests.xml" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it.
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-  <PropertyGroup>
-    <PostBuildEvent>echo "Copying .xml files for tests"
-xcopy "$(ProjectDir)Data" ..\..\..\..\build\VS.Net.2005\Spring.Data.NHibernate20.Integration.Tests\$(ConfigurationName)\ /y /s /q /d
-xcopy  "$(ProjectDir)$(TargetFileName).config" ..\..\..\..\build\VS.Net.2005\Spring.Data.NHibernate20.Integration.Tests\$(ConfigurationName)\ /y /s /q</PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/test/Spring/Spring.Data.NHibernate20.Tests/Spring.Data.NHibernate20.Tests.2005.csproj b/test/Spring/Spring.Data.NHibernate20.Tests/Spring.Data.NHibernate20.Tests.2005.csproj
deleted file mode 100644
index 9bd71dc5..00000000
--- a/test/Spring/Spring.Data.NHibernate20.Tests/Spring.Data.NHibernate20.Tests.2005.csproj
+++ /dev/null
@@ -1,149 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Data.NHibernate20.Tests</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.NHibernate20.Tests\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0,NH_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.NHibernate20.Tests\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Castle.Core, Version=1.0.3.0, Culture=neutral, PublicKeyToken=407dd0808d44fbdc, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate20\net\2.0\Castle.Core.dll</HintPath>
-    </Reference>
-    <Reference Include="Castle.DynamicProxy2, Version=2.0.3.0, Culture=neutral, PublicKeyToken=407dd0808d44fbdc, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate20\net\2.0\Castle.DynamicProxy2.dll</HintPath>
-    </Reference>
-    <Reference Include="Common.Logging, Version=1.1.0.0, Culture=neutral, PublicKeyToken=af08829b84f0328e">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="Iesi.Collections, Version=1.0.0.3, Culture=neutral, PublicKeyToken=aa95f207798dfdb4, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate20\net\2.0\Iesi.Collections.dll</HintPath>
-    </Reference>
-    <Reference Include="log4net, Version=1.2.10.0, Culture=neutral, PublicKeyToken=1b44e1d426115821, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate20\net\2.0\log4net.dll</HintPath>
-    </Reference>
-    <Reference Include="NHibernate, Version=2.0.1.4000, Culture=neutral, PublicKeyToken=aa95f207798dfdb4, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate20\net\2.0\NHibernate.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.framework, Version=2.2.7.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="Rhino.Mocks, Version=2.9.6.40380, Culture=neutral, PublicKeyToken=0b3305902db7183f, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Rhino.Mocks.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\Config\AopConfiguration.cs">
-      <Link>Data\NHibernate\Config\AopConfiguration.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\HibernateTransactionManagerTests.cs">
-      <Link>Data\NHibernate\HibernateTransactionManagerTests.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\ISimpleService.cs">
-      <Link>Data\NHibernate\ISimpleService.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\ITestObjectDao.cs">
-      <Link>Data\NHibernate\ITestObjectDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\LocalSessionFactoryObjectTests.cs">
-      <Link>Data\NHibernate\LocalSessionFactoryObjectTests.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\NHTestObjectDao.cs">
-      <Link>Data\NHibernate\NHTestObjectDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\SimpleService.cs">
-      <Link>Data\NHibernate\SimpleService.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\Support\ConfigSectionSessionScopeSettingsTests.cs">
-      <Link>Data\NHibernate\Support\ConfigSectionSessionScopeSettingsTests.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\Support\SessionScopeSettingsTests.cs">
-      <Link>Data\NHibernate\Support\SessionScopeSettingsTests.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\Support\SessionScopeTests.cs">
-      <Link>Data\NHibernate\Support\SessionScopeTests.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\TestObject.cs">
-      <Link>Data\NHibernate\TestObject.cs</Link>
-    </Compile>
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="Spring.Data.NHibernate20.Tests.dll.config">
-      <CopyToOutputDirectory>Always</CopyToOutputDirectory>
-    </None>
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Aop\Spring.Aop.2005.csproj">
-      <Project>{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}</Project>
-      <Name>Spring.Aop.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Data.NHibernate20\Spring.Data.NHibernate20.2005.csproj">
-      <Project>{71368632-B8B7-4A6A-8C65-8DA848120C82}</Project>
-      <Name>Spring.Data.NHibernate20.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Data\Spring.Data.2005.csproj">
-      <Project>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</Project>
-      <Name>Spring.Data.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Data.Tests\Spring.Data.Tests.2005.csproj">
-      <Project>{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}</Project>
-      <Name>Spring.Data.Tests.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\NHibernate\Config\AopConfiguration.xml" />
-    <EmbeddedResource Include="Data\NHibernate\Config\AopConfigurationTxPointcut.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\NHibernate\TestObject.hbm.xml" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it.
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-  <PropertyGroup>
-    <PostBuildEvent>echo "Copying .xml files for tests"
-xcopy "$(ProjectDir)Data" ..\..\..\..\build\VS.Net.2005\Spring.Data.NHibernate20.Tests\$(ConfigurationName)\ /y /s /q /d
-xcopy  "$(ProjectDir)$(TargetFileName).config" ..\..\..\..\build\VS.Net.2005\Spring.Data.NHibernate20.Tests\$(ConfigurationName)\ /y /s /q</PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/test/Spring/Spring.Data.NHibernate21.Integration.Tests/Spring.Data.NHibernate21.Integration.Tests.2005.csproj b/test/Spring/Spring.Data.NHibernate21.Integration.Tests/Spring.Data.NHibernate21.Integration.Tests.2005.csproj
deleted file mode 100644
index 4a1f1dac..00000000
--- a/test/Spring/Spring.Data.NHibernate21.Integration.Tests/Spring.Data.NHibernate21.Integration.Tests.2005.csproj
+++ /dev/null
@@ -1,173 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{4A07E150-ED90-407C-8CAD-4760444DDFD9}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Data.NHibernate21.Integration.Tests</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.NHibernate21.Integration.Tests\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0,NH_2_0,NH_2_1</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.NHibernate21.Integration.Tests\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0,NH_2_0,NH_2_1</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=1.0.2.0, Culture=neutral, PublicKeyToken=af08829b84f0328e">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="Iesi.Collections, Version=1.0.0.3, Culture=neutral, PublicKeyToken=aa95f207798dfdb4, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate21\net\2.0\Iesi.Collections.dll</HintPath>
-    </Reference>
-    <Reference Include="LinFu.DynamicProxy, Version=1.0.3.14911, Culture=neutral, PublicKeyToken=62a6874124340d6e, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate21\net\2.0\LinFu.DynamicProxy.dll</HintPath>
-    </Reference>
-    <Reference Include="log4net, Version=1.2.10.0, Culture=neutral, PublicKeyToken=1b44e1d426115821, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate21\net\2.0\log4net.dll</HintPath>
-    </Reference>
-    <Reference Include="NHibernate, Version=1.2.1.4000, Culture=neutral, PublicKeyToken=aa95f207798dfdb4, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate21\net\2.0\NHibernate.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.framework, Version=2.4.1.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\AccountCreditDao.cs">
-      <Link>Data\NHibernate\AccountCreditDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\AccountDebitDao.cs">
-      <Link>Data\NHibernate\AccountDebitDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\AccountManager.cs">
-      <Link>Data\NHibernate\AccountManager.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\AuditDao.cs">
-      <Link>Data\NHibernate\AuditDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\Credit.cs">
-      <Link>Data\NHibernate\Credit.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\DbProviderTemplateTests.cs">
-      <Link>Data\NHibernate\DbProviderTemplateTests.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\Debit.cs">
-      <Link>Data\NHibernate\Debit.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\IAccountCreditDao.cs">
-      <Link>Data\NHibernate\IAccountCreditDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\IAccountDebitDao.cs">
-      <Link>Data\NHibernate\IAccountDebitDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\IAccountManager.cs">
-      <Link>Data\NHibernate\IAccountManager.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\IAuditDao.cs">
-      <Link>Data\NHibernate\IAuditDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\ITestObjectDao.cs">
-      <Link>Data\NHibernate\ITestObjectDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\MultipleDbTests.cs">
-      <Link>Data\NHibernate\MultipleDbTests.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\NativeNHTestObjectDao.cs">
-      <Link>Data\NHibernate\NativeNHTestObjectDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\NativeNHTests.cs">
-      <Link>Data\NHibernate\NativeNHTests.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\NHDAOTests.cs">
-      <Link>Data\NHibernate\NHDAOTests.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\NHTestObjectDao.cs">
-      <Link>Data\NHibernate\NHTestObjectDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\TemplateTests.cs">
-      <Link>Data\NHibernate\TemplateTests.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\TestObject.cs">
-      <Link>Data\NHibernate\TestObject.cs</Link>
-    </Compile>
-    <Compile Include="AssemblyInfo.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="..\Spring.Data.NHibernate.Integration.Tests\Data\NHibernate\creditdebit.sql">
-      <Link>Data\NHibernate\creditdebit.sql</Link>
-    </None>
-    <None Include="Spring.Data.NHibernate21.Integration.Tests.dll.config" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Aop\Spring.Aop.2005.csproj">
-      <Project>{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}</Project>
-      <Name>Spring.Aop.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Data.NHibernate21\Spring.Data.NHibernate21.2005.csproj">
-      <Project>{71368632-B8B7-4A6A-8C65-8DA848120C82}</Project>
-      <Name>Spring.Data.NHibernate21.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Data\Spring.Data.2005.csproj">
-      <Project>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</Project>
-      <Name>Spring.Data.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\NHibernate\dbProviderTemplateTests.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\NHibernate\templateTests.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\NHibernate\Credit.hbm.xml" />
-    <EmbeddedResource Include="Data\NHibernate\NHDAOTests.xml" />
-    <EmbeddedResource Include="Data\NHibernate\TestObject.hbm.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\NHibernate\Debit.hbm.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\NHibernate\MultipleDbTests.xml" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it.
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-  <PropertyGroup>
-    <PostBuildEvent>echo "Copying .xml files for tests"
-xcopy "$(ProjectDir)Data" ..\..\..\..\build\VS.Net.2005\Spring.Data.NHibernate21.Integration.Tests\$(ConfigurationName)\ /y /s /q /d
-xcopy  "$(ProjectDir)$(TargetFileName).config" ..\..\..\..\build\VS.Net.2005\Spring.Data.NHibernate21.Integration.Tests\$(ConfigurationName)\ /y /s /q</PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/test/Spring/Spring.Data.NHibernate21.Tests/Spring.Data.NHibernate21.Tests.2005.csproj b/test/Spring/Spring.Data.NHibernate21.Tests/Spring.Data.NHibernate21.Tests.2005.csproj
deleted file mode 100644
index b717d3d4..00000000
--- a/test/Spring/Spring.Data.NHibernate21.Tests/Spring.Data.NHibernate21.Tests.2005.csproj
+++ /dev/null
@@ -1,149 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Data.NHibernate21.Tests</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.NHibernate21.Tests\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0,NH_2_0,NH_2_1</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.NHibernate21.Tests\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0,NH_2_0;NH_2_1</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=1.1.0.0, Culture=neutral, PublicKeyToken=af08829b84f0328e">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="Iesi.Collections, Version=1.0.0.1, Culture=neutral, PublicKeyToken=154fdcb44c4484fc">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate21\net\2.0\Iesi.Collections.dll</HintPath>
-    </Reference>
-    <Reference Include="LinFu.DynamicProxy, Version=1.0.3.14911, Culture=neutral, PublicKeyToken=62a6874124340d6e, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate21\net\2.0\LinFu.DynamicProxy.dll</HintPath>
-    </Reference>
-    <Reference Include="log4net, Version=1.2.9.0, Culture=neutral, PublicKeyToken=b32731d11ce58905">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate21\net\2.0\log4net.dll</HintPath>
-    </Reference>
-    <Reference Include="NHibernate, Version=1.0.4.0, Culture=neutral, PublicKeyToken=154fdcb44c4484fc">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate21\net\2.0\NHibernate.dll</HintPath>
-    </Reference>
-    <Reference Include="NHibernate.ByteCode.LinFu, Version=2.1.0.4000, Culture=neutral, PublicKeyToken=aa95f207798dfdb4, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\NHibernate21\net\2.0\NHibernate.ByteCode.LinFu.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.framework, Version=2.2.7.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="Rhino.Mocks, Version=2.9.6.40380, Culture=neutral, PublicKeyToken=0b3305902db7183f, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Rhino.Mocks.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\Config\AopConfiguration.cs">
-      <Link>Data\NHibernate\Config\AopConfiguration.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\HibernateTransactionManagerTests.cs">
-      <Link>Data\NHibernate\HibernateTransactionManagerTests.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\ISimpleService.cs">
-      <Link>Data\NHibernate\ISimpleService.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\ITestObjectDao.cs">
-      <Link>Data\NHibernate\ITestObjectDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\LocalSessionFactoryObjectTests.cs">
-      <Link>Data\NHibernate\LocalSessionFactoryObjectTests.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\NHTestObjectDao.cs">
-      <Link>Data\NHibernate\NHTestObjectDao.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\SimpleService.cs">
-      <Link>Data\NHibernate\SimpleService.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\Support\ConfigSectionSessionScopeSettingsTests.cs">
-      <Link>Data\NHibernate\Support\ConfigSectionSessionScopeSettingsTests.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\Support\SessionScopeSettingsTests.cs">
-      <Link>Data\NHibernate\Support\SessionScopeSettingsTests.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\Support\SessionScopeTests.cs">
-      <Link>Data\NHibernate\Support\SessionScopeTests.cs</Link>
-    </Compile>
-    <Compile Include="..\Spring.Data.NHibernate.Tests\Data\NHibernate\TestObject.cs">
-      <Link>Data\NHibernate\TestObject.cs</Link>
-    </Compile>
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="Spring.Data.NHibernate21.Tests.dll.config">
-      <CopyToOutputDirectory>Always</CopyToOutputDirectory>
-    </None>
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Aop\Spring.Aop.2005.csproj">
-      <Project>{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}</Project>
-      <Name>Spring.Aop.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Data.NHibernate21\Spring.Data.NHibernate21.2005.csproj">
-      <Project>{71368632-B8B7-4A6A-8C65-8DA848120C82}</Project>
-      <Name>Spring.Data.NHibernate21.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Data\Spring.Data.2005.csproj">
-      <Project>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</Project>
-      <Name>Spring.Data.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Data.Tests\Spring.Data.Tests.2005.csproj">
-      <Project>{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}</Project>
-      <Name>Spring.Data.Tests.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\NHibernate\Config\AopConfiguration.xml" />
-    <EmbeddedResource Include="Data\NHibernate\Config\AopConfigurationTxPointcut.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\NHibernate\TestObject.hbm.xml" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it.
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-  <PropertyGroup>
-    <PostBuildEvent>echo "Copying .xml files for tests"
-xcopy "$(ProjectDir)Data" ..\..\..\..\build\VS.Net.2005\Spring.Data.NHibernate21.Tests\$(ConfigurationName)\ /y /s /q /d
-xcopy  "$(ProjectDir)$(TargetFileName).config" ..\..\..\..\build\VS.Net.2005\Spring.Data.NHibernate21.Tests\$(ConfigurationName)\ /y /s /q</PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/test/Spring/Spring.Data.Tests/Spring.Data.Tests.2003.csproj b/test/Spring/Spring.Data.Tests/Spring.Data.Tests.2003.csproj
deleted file mode 100644
index f76a4572..00000000
--- a/test/Spring/Spring.Data.Tests/Spring.Data.Tests.2003.csproj
+++ /dev/null
@@ -1,408 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{C5585365-561C-4EC4-8956-87FFBD9AB1CD}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Data.Tests"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = 'echo copying  "$(ProjectDir)$(TargetFileName).config" to  "..\..\..\..\build\VS.Net.2003\Spring.Core.Tests\$(ConfigurationName)\$(TargetFileName).config"&#xd;&#xa;copy  "$(ProjectDir)$(TargetFileName).config" ..\..\..\..\build\VS.Net.2003\Spring.Core.Tests\$(ConfigurationName)\$(TargetFileName).config'
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = "0618"
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Data.Tests\Debug-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE,NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Data.Tests\Release-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "System.Drawing"
-                    AssemblyName = "System.Drawing"
-                    HintPath = "..\..\..\..\..\WINNT\Microsoft.NET\Framework\v1.1.4322\System.Drawing.dll"
-                />
-                <Reference
-                    Name = "System.Windows.Forms"
-                    AssemblyName = "System.Windows.Forms"
-                    HintPath = "..\..\..\..\..\WINNT\Microsoft.NET\Framework\v1.1.4322\System.Windows.Forms.dll"
-                />
-                <Reference
-                    Name = "DotNetMock"
-                    AssemblyName = "DotNetMock"
-                    HintPath = "..\..\..\lib\Net\1.1\DotNetMock.dll"
-                />
-                <Reference
-                    Name = "nunit.framework"
-                    AssemblyName = "nunit.framework"
-                    HintPath = "..\..\..\lib\Net\1.1\nunit.framework.dll"
-                />
-                <Reference
-                    Name = "Spring.Aop.2003"
-                    Project = "{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Core.2003"
-                    Project = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Core.Tests.2003"
-                    Project = "{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Data.2003"
-                    Project = "{E10A3BED-795F-41CB-A4A8-8C4B342ACDDF}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\lib\Net\1.1\Common.Logging.dll"
-                />
-                <Reference
-                    Name = "Rhino.Mocks"
-                    AssemblyName = "Rhino.Mocks"
-                    HintPath = "..\..\..\lib\Net\1.1\Rhino.Mocks.dll"
-                />
-                <Reference
-                    Name = "System.EnterpriseServices"
-                    AssemblyName = "System.EnterpriseServices"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.EnterpriseServices.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "DataExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Spring.Data.Tests.build"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Spring.Data.Tests.dll.config"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Dao\IncorrectResultSizeDataAccessExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\IncorrectUpdateSemanticsDataAccessExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Dao\UncategorizedDataAccessExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\AdoPlatformTransactionManagerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\AutoDeclarativeTxTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\AutoDeclarativeTxTests.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\ITestCoord.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\ITestObjectMgr.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\LoggingAroundAdvice.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\TestCoord.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\TestObjectMgr.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Common\AdditionalProviders.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\Common\DbParametersTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Common\DbProviderFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Common\DbProviderFactoryTests.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\Common\MultiDelegatingDbProviderTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Common\UserCredentialsDbProviderTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Core\ServiceDomainTransactionManagerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Objects\AbstractAdoQueryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Objects\AdoOperationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Objects\AdoQueryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Objects\StoredProcedureTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Support\ErrorCodeExceptionTranslatorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Support\TestDbProvider.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Support\TestSqlException.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\CallCountingTransactionManager.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\CommonTypes.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\HeuristicCompletionExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\InvalidTimeoutExceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Config\TxNamespaceParserTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Config\TxNamespaceParserTests.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\AbstractTransactionAspectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\DefaultTransactionAttributeTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\MatchAlwaysTransactionAttributeSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\MatchAlwaysTransactionAttributeSourceTests.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\NoRollbackRuleAttributeTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\RollbackRuleAttributeTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\RuleBasedTransactionAttributeTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\TransactionAttributeEditorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\TransactionAttributeSourceAdvisorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\TransactionAttributeSourceEditorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\TransactionAttributeSourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Interceptor\TransactionInterceptorTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\AbstractPlatformTransactionManagerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\DefaultTransactionDefinitionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\DefaultTransactionStatusTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\ResourceHolderSupportTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\TransactionSynchronizationAdapterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\TransactionSynchronizationManagerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Transaction\Support\TransactionTemplateTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/test/Spring/Spring.Data.Tests/Spring.Data.Tests.2005.csproj b/test/Spring/Spring.Data.Tests/Spring.Data.Tests.2005.csproj
deleted file mode 100644
index ab4919b2..00000000
--- a/test/Spring/Spring.Data.Tests/Spring.Data.Tests.2005.csproj
+++ /dev/null
@@ -1,199 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.Data.Tests</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Library</OutputType>
-    <RootNamespace>Spring</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.Tests\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>67, 618</NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-    <UseVSHostingProcess>true</UseVSHostingProcess>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Data.Tests\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>618</NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=2.1.0.0, Culture=neutral, PublicKeyToken=65e474d141e25e07, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="DotNetMock, Version=0.7.4.0, Culture=neutral, PublicKeyToken=805ea88df19095f6">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\DotNetMock.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.framework, Version=2.2.5.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="Rhino.Mocks, Version=2.9.6.40380, Culture=neutral, PublicKeyToken=0b3305902db7183f">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Rhino.Mocks.dll</HintPath>
-    </Reference>
-    <Reference Include="System">
-      <Name>System</Name>
-    </Reference>
-    <Reference Include="System.configuration" />
-    <Reference Include="System.Data">
-      <Name>System.Data</Name>
-    </Reference>
-    <Reference Include="System.Data.OracleClient" />
-    <Reference Include="System.Drawing">
-      <Name>System.Drawing</Name>
-    </Reference>
-    <Reference Include="System.EnterpriseServices" />
-    <Reference Include="System.Transactions" />
-    <Reference Include="System.Xml">
-      <Name>System.XML</Name>
-    </Reference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Aop\Spring.Aop.2005.csproj">
-      <Project>{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}</Project>
-      <Name>Spring.Aop.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Data\Spring.Data.2005.csproj">
-      <Project>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</Project>
-      <Name>Spring.Data.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Core.Tests\Spring.Core.Tests.2005.csproj">
-      <Project>{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}</Project>
-      <Name>Spring.Core.Tests.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <ItemGroup>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="..\CommonAssemblyInfo.cs">
-      <Link>CommonAssemblyInfo.cs</Link>
-    </Compile>
-    <Compile Include="AssemblyInfo.cs" />
-    <Compile Include="Dao\IncorrectResultSizeDataAccessExceptionTests.cs" />
-    <Compile Include="Dao\IncorrectUpdateSemanticsDataAccessExceptionTests.cs" />
-    <Compile Include="Dao\UncategorizedDataAccessExceptionTests.cs" />
-    <Compile Include="DataExceptionTests.cs" />
-    <Compile Include="Data\AdoPlatformTransactionManagerTests.cs" />
-    <Compile Include="Data\AutoDeclarativeTxTests.cs" />
-    <Compile Include="Data\Common\DbProviderFactoryTests.cs" />
-    <Compile Include="Data\LoggingAroundAdvice.cs" />
-    <Compile Include="Data\ITestCoord.cs" />
-    <Compile Include="Data\ITestObjectMgr.cs" />
-    <Compile Include="Data\Objects\AdoQueryTests.cs" />
-    <Compile Include="Data\TestCoord.cs" />
-    <Compile Include="Data\TestObjectMgr.cs" />
-    <Compile Include="Support\ErrorCodeExceptionTranslatorTests.cs" />
-    <Compile Include="Support\TestDbProvider.cs" />
-    <Compile Include="Support\TestSqlException.cs" />
-    <Compile Include="Transaction\CallCountingTransactionManager.cs" />
-    <Compile Include="Transaction\CommonTypes.cs" />
-    <Compile Include="Transaction\Config\TxNamespaceParserTests.cs" />
-    <Compile Include="Transaction\HeuristicCompletionExceptionTests.cs" />
-    <Compile Include="Transaction\Interceptor\DefaultTransactionAttributeTests.cs" />
-    <Compile Include="Transaction\Interceptor\MatchAlwaysTransactionAttributeSourceTests.cs" />
-    <Compile Include="Transaction\Interceptor\NoRollbackRuleAttributeTests.cs" />
-    <Compile Include="Transaction\Interceptor\RollbackRuleAttributeTests.cs" />
-    <Compile Include="Transaction\Interceptor\RuleBasedTransactionAttributeTests.cs" />
-    <Compile Include="Transaction\Interceptor\TransactionAttributeEditorTests.cs" />
-    <Compile Include="Transaction\Interceptor\TransactionAttributeSourceAdvisorTests.cs" />
-    <Compile Include="Transaction\Interceptor\TransactionAttributeSourceEditorTests.cs" />
-    <Compile Include="Transaction\InvalidTimeoutExceptionTests.cs" />
-    <Compile Include="Transaction\Support\AbstractPlatformTransactionManagerTests.cs" />
-    <Compile Include="Transaction\Support\DefaultTransactionDefinitionTests.cs" />
-    <Compile Include="Transaction\Support\DefaultTransactionStatusTests.cs" />
-    <Compile Include="Transaction\Support\ResourceHolderSupportTests.cs" />
-    <Compile Include="Transaction\Support\TransactionSynchronizationAdapterTests.cs" />
-    <Compile Include="Transaction\Support\TransactionSynchronizationManagerTests.cs" />
-    <Compile Include="Transaction\Support\TransactionTemplateTests.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\AutoDeclarativeTxTests.xml" />
-    <EmbeddedResource Include="Data\Common\AdditionalProviders.xml" />
-    <EmbeddedResource Include="Data\Common\DbProviderFactoryTests.xml" />
-    <Content Include="Spring.Data.Tests.dll.config" />
-    <EmbeddedResource Include="Transaction\Interceptor\MatchAlwaysTransactionAttributeSourceTests.xml" />
-    <EmbeddedResource Include="Transaction\Config\TxNamespaceParserTests.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="Dao\Attributes\PersistenceExceptionTranslationAdvisorTests.cs" />
-    <Compile Include="Dao\Attributes\PersistenceExceptionTranslationInterceptorTests.cs" />
-    <Compile Include="Dao\Attributes\PersistenceExceptionTranslationPostProcessorTests.cs" />
-    <Compile Include="Dao\Support\DataAccessUtilsTests.cs" />
-    <Compile Include="Data\Common\DbParametersTests.cs" />
-    <Compile Include="Data\Common\MultiDelegatingDbProviderTests.cs" />
-    <Compile Include="Data\Common\UserCredentialsDbProviderTests.cs" />
-    <Compile Include="Data\Core\ServiceDomainTransactionManagerTests.cs" />
-    <Compile Include="Data\Core\TxScopeTransactionManagerIntegrationTests.cs" />
-    <Compile Include="Data\Core\TxScopeTransactionManagerTests.cs" />
-    <Compile Include="Data\Objects\AbstractAdoQueryTests.cs" />
-    <Compile Include="Data\Objects\AdoOperationTests.cs" />
-    <Compile Include="Data\Objects\StoredProcedureTests.cs" />
-    <Compile Include="Transaction\Interceptor\AbstractTransactionAspectTests.cs" />
-    <Compile Include="Transaction\Interceptor\TransactionAttributeSourceTests.cs" />
-    <Compile Include="Transaction\Interceptor\TransactionInterceptorTests.cs" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>echo "Copying .xml files for tests"
-xcopy "$(ProjectDir)Data" ..\..\..\..\build\VS.Net.2005\Spring.Data.Tests\$(ConfigurationName)\ /y /s /q /d
-xcopy "$(ProjectDir)$(TargetFileName).config" ..\..\..\..\build\VS.Net.2005\Spring.Data.Tests\$(ConfigurationName)\ /y /s /q</PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/test/Spring/Spring.Messaging.Ems.Tests/Spring.Messaging.Ems.Tests.2005.csproj b/test/Spring/Spring.Messaging.Ems.Tests/Spring.Messaging.Ems.Tests.2005.csproj
deleted file mode 100644
index 775aa849..00000000
--- a/test/Spring/Spring.Messaging.Ems.Tests/Spring.Messaging.Ems.Tests.2005.csproj
+++ /dev/null
@@ -1,101 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{94E4E1B4-D424-4EB9-BF34-2EE8CC3D7048}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Messaging.Ems.Tests</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.Messaging.Ems.Tests\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.Messaging.Ems.Tests\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=1.2.0.0, Culture=neutral, PublicKeyToken=af08829b84f0328e">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.framework, Version=2.2.7.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="Rhino.Mocks, Version=2.9.6.40380, Culture=neutral, PublicKeyToken=0b3305902db7183f, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Rhino.Mocks.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="TIBCO.EMS, Version=1.0.0.0, Culture=neutral, PublicKeyToken=5b83db8ff05c64ba, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\TIBCO.EMS.dll</HintPath>
-    </Reference>
-    <Reference Include="TIBCO.EMS.ADMIN, Version=1.0.0.0, Culture=neutral, PublicKeyToken=5b83db8ff05c64ba, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\TIBCO.EMS.ADMIN.dll</HintPath>
-    </Reference>
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Aop\Spring.Aop.2005.csproj">
-      <Project>{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}</Project>
-      <Name>Spring.Aop.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Data\Spring.Data.2005.csproj">
-      <Project>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</Project>
-      <Name>Spring.Data.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Messaging.Ems\Spring.Messaging.Ems.2005.csproj">
-      <Project>{900E3839-301E-48B1-BAEB-B6645620ACFF}</Project>
-      <Name>Spring.Messaging.Ems.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Testing.NUnit\Spring.Testing.NUnit.2005.csproj">
-      <Project>{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}</Project>
-      <Name>Spring.Testing.NUnit.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Core.Tests\Spring.Core.Tests.2005.csproj">
-      <Project>{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}</Project>
-      <Name>Spring.Core.Tests.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="Messaging\Ems\Config\EmsNamespaceHandlerTests.cs" />
-    <Compile Include="Messaging\Ems\Connections\TestMessageListener.cs" />
-    <Compile Include="Messaging\Ems\Core\MessageTemplateTests.cs" />
-    <Compile Include="Messaging\Ems\Integration\LoggingExceptionHandler.cs" />
-    <Compile Include="Messaging\Ems\Integration\SimpleMessageListener.cs" />
-    <Compile Include="Messaging\Ems\Integration\SimpleMessageListenerContainerTests.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Messaging\Ems\Integration\SimpleMessageListenerContainerTests.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Messaging\Ems\Config\EmsNamespaceHandlerTests.xml" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/test/Spring/Spring.Messaging.Nms.Tests/Spring.Messaging.Nms.Tests.2003.csproj b/test/Spring/Spring.Messaging.Nms.Tests/Spring.Messaging.Nms.Tests.2003.csproj
deleted file mode 100644
index f08c4c0e..00000000
--- a/test/Spring/Spring.Messaging.Nms.Tests/Spring.Messaging.Nms.Tests.2003.csproj
+++ /dev/null
@@ -1,100 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.3077"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{F58E0148-FA69-44D4-9AB0-65498E9F3221}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Messaging.Nms.Tests"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.NET.2003\Spring.Messaging.Nms.Tests\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.NET.2003\Spring.Messaging.Nms.Tests\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "Spring.Messaging.Nms.2003"
-                    Project = "{C17B27C2-4343-45BA-9A21-73C3CEC19BAD}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/test/Spring/Spring.Messaging.Nms.Tests/Spring.Messaging.Nms.Tests.2005.csproj b/test/Spring/Spring.Messaging.Nms.Tests/Spring.Messaging.Nms.Tests.2005.csproj
deleted file mode 100644
index 218b323f..00000000
--- a/test/Spring/Spring.Messaging.Nms.Tests/Spring.Messaging.Nms.Tests.2005.csproj
+++ /dev/null
@@ -1,119 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{FA7A6931-7DBE-4A32-A312-51FAD2E80332}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Messaging.Nms.Tests</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.Messaging.Nms.Tests\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>bin\Release\</OutputPath>
-    <DefineConstants>TRACE</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Accessibility" />
-    <Reference Include="Apache.NMS, Version=1.0.0.0, Culture=neutral, PublicKeyToken=65e474d141e25e07, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Apache.NMS.dll</HintPath>
-    </Reference>
-    <Reference Include="Apache.NMS.ActiveMQ, Version=1.0.0.0, Culture=neutral, PublicKeyToken=65e474d141e25e07, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Apache.NMS.ActiveMQ.dll</HintPath>
-    </Reference>
-    <Reference Include="Common.Logging, Version=1.2.0.0, Culture=neutral, PublicKeyToken=af08829b84f0328e">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.framework, Version=2.2.7.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="Rhino.Mocks, Version=2.9.6.40380, Culture=neutral, PublicKeyToken=0b3305902db7183f, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Rhino.Mocks.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Data\Spring.Data.2005.csproj">
-      <Project>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</Project>
-      <Name>Spring.Data.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Messaging.Nms\Spring.Messaging.Nms.2005.csproj">
-      <Project>{AEB1578C-9018-4D49-B440-789F38DD2F29}</Project>
-      <Name>Spring.Messaging.Nms.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Testing.NUnit\Spring.Testing.NUnit.2005.csproj">
-      <Project>{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}</Project>
-      <Name>Spring.Testing.NUnit.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Core.Tests\Spring.Core.Tests.2005.csproj">
-      <Project>{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}</Project>
-      <Name>Spring.Core.Tests.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="Messaging\Nms\Config\NmsNamespaceHandlerTests.cs" />
-    <Compile Include="Messaging\Nms\Connections\CachingConnectionFactoryTests.cs" />
-    <Compile Include="Messaging\Nms\Connections\MessageTransactionManagerTests.cs" />
-    <Compile Include="Messaging\Nms\Connections\SingleConnectionFactoryTests.cs" />
-    <Compile Include="Messaging\Nms\Connections\TestConnection.cs" />
-    <Compile Include="Messaging\Nms\Connections\TestExceptionListener.cs" />
-    <Compile Include="Messaging\Nms\Connections\TestMessageConsumer.cs" />
-    <Compile Include="Messaging\Nms\Connections\TestMessageListener.cs" />
-    <Compile Include="Messaging\Nms\Connections\TestMessageProducer.cs" />
-    <Compile Include="Messaging\Nms\Connections\TestSession.cs" />
-    <Compile Include="Messaging\Nms\Core\MessageTemplateTests.cs" />
-    <Compile Include="Messaging\Nms\Core\SimpleMessageConverterTests.cs" />
-    <Compile Include="Messaging\Nms\Core\SimpleMessageListenerContainerTests.cs" />
-    <Compile Include="Messaging\Nms\Integration\LoggingExceptionHandler.cs" />
-    <Compile Include="Messaging\Nms\Integration\SimpleMessageListener.cs" />
-    <Compile Include="Messaging\Nms\Integration\SimpleMessageListenerContainerTests.cs" />
-    <Compile Include="Messaging\Nms\Connections\TestConnectionFactory.cs" />
-    <Compile Include="Messaging\Nms\Listener\Adapter\IMessageContentsHandler.cs" />
-    <Compile Include="Messaging\Nms\Listener\Adapter\MessageContentsHandler.cs" />
-    <Compile Include="Messaging\Nms\Listener\Adapter\MessageListenerAdapterTests.cs" />
-    <Compile Include="Messaging\Nms\StubQueue.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Messaging\Nms\Integration\SimpleMessageListenerContainerTests.xml" />
-    <EmbeddedResource Include="Messaging\Nms\Config\NmsNamespaceHandlerTests.xml" />
-    <Content Include="Spring.Messaging.Nms.Tests.dll.config">
-      <CopyToOutputDirectory>Always</CopyToOutputDirectory>
-    </Content>
-  </ItemGroup>
-  <ItemGroup>
-    <Folder Include="Properties\" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/test/Spring/Spring.Messaging.Tests/Spring.Messaging.Tests.2005.csproj b/test/Spring/Spring.Messaging.Tests/Spring.Messaging.Tests.2005.csproj
deleted file mode 100644
index bf150d00..00000000
--- a/test/Spring/Spring.Messaging.Tests/Spring.Messaging.Tests.2005.csproj
+++ /dev/null
@@ -1,123 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{41BC3AEA-7EB3-48BF-B1EC-84119376AC98}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Messaging.Tests</AssemblyName>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.Messaging.Tests\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.Messaging.Tests\Debug\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=1.2.0.0, Culture=neutral, PublicKeyToken=af08829b84f0328e">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.framework, Version=2.4.1.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="Rhino.Mocks, Version=2.9.6.40380, Culture=neutral, PublicKeyToken=0b3305902db7183f, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Rhino.Mocks.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Messaging" />
-    <Reference Include="System.Transactions" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="Messaging\Core\MessageQueueTemplateTests.cs" />
-    <Compile Include="Messaging\Support\MessageQueueFactoryObjectTests.cs" />
-    <Compile Include="Properties\AssemblyInfo.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Data\Spring.Data.2005.csproj">
-      <Project>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</Project>
-      <Name>Spring.Data.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Messaging\Spring.Messaging.2005.csproj">
-      <Project>{0E23AE41-D8D8-41C2-84A2-D35564049F0D}</Project>
-      <Name>Spring.Messaging.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Testing.NUnit\Spring.Testing.NUnit.2005.csproj">
-      <Project>{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}</Project>
-      <Name>Spring.Testing.NUnit.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Core.Tests\Spring.Core.Tests.2005.csproj">
-      <Project>{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}</Project>
-      <Name>Spring.Core.Tests.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Messaging\Listener\NonTransactionalMessageListenerContainerTests.xml" />
-    <EmbeddedResource Include="Messaging\Listener\MultiThreadedNonTransactionalMessageListenerContainerTests.xml" />
-    <EmbeddedResource Include="Messaging\Listener\TransactionalMessageListenerContainerTests.xml" />
-    <EmbeddedResource Include="Messaging\queue-context.xml" />
-    <EmbeddedResource Include="Messaging\Core\MessageQueueTemplateTests.xml" />
-    <EmbeddedResource Include="Messaging\Listener\DistributedTxMessageListenerContainerTests.xml" />
-    <EmbeddedResource Include="Messaging\Core\MessageQueueMetadataCacheTests.xml" />
-    <Content Include="Spring.Messaging.Tests.dll.config">
-      <CopyToOutputDirectory>Always</CopyToOutputDirectory>
-    </Content>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="Messaging\Core\MessageQueueMetadataCacheTests.cs" />
-    <Compile Include="Messaging\Core\MessageQueueUtils.cs" />
-    <Compile Include="Messaging\Core\ThreadingTests.cs" />
-    <Compile Include="Messaging\Listener\Adapter\MessageListenerAdapterTests.cs" />
-    <Compile Include="Messaging\Listener\DistributedTxMessageListenerContainerTests.cs" />
-    <Compile Include="Messaging\Listener\LoggingExceptionHandler.cs" />
-    <Compile Include="Messaging\Listener\NonTransactionalMessageListenerContainerTests.cs" />
-    <Compile Include="Messaging\Listener\MultiThreadedNonTransactionalMessageListenerContainerTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Messaging\Listener\SimpleExceptionHandler.cs" />
-    <Compile Include="Messaging\Listener\SimpleHandler.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Messaging\Listener\SimpleMessageListener.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Messaging\Listener\TransactionalMessageListenerContainerTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Messaging\Listener\WaitingHandler.cs" />
-    <Compile Include="Messaging\Support\MessageAlreadyProcessedException.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="Spring.Messaging.Tests.build" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it.
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/test/Spring/Spring.Scheduling.Quartz.Integration.Tests/Spring.Scheduling.Quartz.Integration.Tests.2003.csproj b/test/Spring/Spring.Scheduling.Quartz.Integration.Tests/Spring.Scheduling.Quartz.Integration.Tests.2003.csproj
deleted file mode 100644
index 5fcd35a3..00000000
--- a/test/Spring/Spring.Scheduling.Quartz.Integration.Tests/Spring.Scheduling.Quartz.Integration.Tests.2003.csproj
+++ /dev/null
@@ -1,170 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{ED644EA8-B6AE-457C-BF32-516DAE541FAC}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Scheduling.Quartz.Integration.Tests"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.NET.2003\Spring.Scheduling.Quartz.Integration.Tests\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.NET.2003\Spring.Scheduling.Quartz.Integration.Tests\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "Spring.Scheduling.Quartz.2003"
-                    Project = "{0C0D8C65-90DE-4914-9940-4C684C54971B}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\lib\net\1.1\Spring.Core.dll"
-                />
-                <Reference
-                    Name = "nunit.framework"
-                    AssemblyName = "nunit.framework"
-                    HintPath = "..\..\..\lib\net\1.1\nunit.framework.dll"
-                />
-                <Reference
-                    Name = "Quartz"
-                    AssemblyName = "Quartz"
-                    HintPath = "..\..\..\lib\net\1.1\Quartz.dll"
-                />
-                <Reference
-                    Name = "Nullables"
-                    AssemblyName = "Nullables"
-                    HintPath = "..\..\..\lib\net\1.1\Nullables.dll"
-                />
-                <Reference
-                    Name = "Rhino.Mocks"
-                    AssemblyName = "Rhino.Mocks"
-                    HintPath = "..\..\..\lib\net\1.1\Rhino.Mocks.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "Scheduling\Quartz\AdaptableJobFactoryTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\CronTriggerObjectTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\JobDetailObjectTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\MethodInvokingJobDetailFactoryObjectTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\MethodInvokingJobTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\SchedulerFactoryObjectTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\SimpleTriggerObjectTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\SpringObjectJobFactoryTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\TestUtil.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\TriggerObjectTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/test/Spring/Spring.Scheduling.Quartz.Integration.Tests/Spring.Scheduling.Quartz.Integration.Tests.2005.csproj b/test/Spring/Spring.Scheduling.Quartz.Integration.Tests/Spring.Scheduling.Quartz.Integration.Tests.2005.csproj
deleted file mode 100644
index d295daf0..00000000
--- a/test/Spring/Spring.Scheduling.Quartz.Integration.Tests/Spring.Scheduling.Quartz.Integration.Tests.2005.csproj
+++ /dev/null
@@ -1,82 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003" ToolsVersion="3.5">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{E4328F68-C3FC-43E2-9D63-30CEC55215B0}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Scheduling.Quartz.Integration.Tests</AssemblyName>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <OldToolsVersion>2.0</OldToolsVersion>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.Scheduling.Quartz.Integration.Tests\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.Scheduling.Quartz.Integration.Tests\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="nunit.framework, Version=2.2.7.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="Quartz, Version=0.7.0.15571, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\net\2.0\Quartz.dll</HintPath>
-    </Reference>
-    <Reference Include="Rhino.Mocks, Version=2.9.6.40380, Culture=neutral, PublicKeyToken=0b3305902db7183f, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Rhino.Mocks.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Scheduling.Quartz\Spring.Scheduling.Quartz.2005.csproj">
-      <Project>{E823D54C-CE82-4868-929F-5F95A999F61E}</Project>
-      <Name>Spring.Scheduling.Quartz.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="Spring.Scheduling.Quartz.Integration.Tests.dll.config">
-      <CopyToOutputDirectory>PreserveNewest</CopyToOutputDirectory>
-    </None>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="Scheduling\Quartz\LocalDataSourceJobStoreTest.cs" />
-    <Compile Include="Scheduling\Quartz\TestJob.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Scheduling\Quartz\LocalDataSourceJobStoreTest.xml" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/test/Spring/Spring.Scheduling.Quartz.Tests/Spring.Scheduling.Quartz.Tests.2003.csproj b/test/Spring/Spring.Scheduling.Quartz.Tests/Spring.Scheduling.Quartz.Tests.2003.csproj
deleted file mode 100644
index 5d64c651..00000000
--- a/test/Spring/Spring.Scheduling.Quartz.Tests/Spring.Scheduling.Quartz.Tests.2003.csproj
+++ /dev/null
@@ -1,170 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{ED644EA8-B6AE-457C-BF32-516DAE541FAC}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Scheduling.Quartz.Tests"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = ""
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.NET.2003\Spring.Scheduling.Quartz.Tests\Debug\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.NET.2003\Spring.Scheduling.Quartz.Tests\Release\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "Spring.Scheduling.Quartz.2003"
-                    Project = "{0C0D8C65-90DE-4914-9940-4C684C54971B}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Core"
-                    AssemblyName = "Spring.Core"
-                    HintPath = "..\..\..\lib\net\1.1\Spring.Core.dll"
-                />
-                <Reference
-                    Name = "nunit.framework"
-                    AssemblyName = "nunit.framework"
-                    HintPath = "..\..\..\lib\net\1.1\nunit.framework.dll"
-                />
-                <Reference
-                    Name = "Quartz"
-                    AssemblyName = "Quartz"
-                    HintPath = "..\..\..\lib\net\1.1\Quartz.dll"
-                />
-                <Reference
-                    Name = "Nullables"
-                    AssemblyName = "Nullables"
-                    HintPath = "..\..\..\lib\net\1.1\Nullables.dll"
-                />
-                <Reference
-                    Name = "Rhino.Mocks"
-                    AssemblyName = "Rhino.Mocks"
-                    HintPath = "..\..\..\lib\net\1.1\Rhino.Mocks.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "Scheduling\Quartz\AdaptableJobFactoryTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\CronTriggerObjectTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\JobDetailObjectTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\MethodInvokingJobDetailFactoryObjectTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\MethodInvokingJobTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\SchedulerFactoryObjectTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\SimpleTriggerObjectTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\SpringObjectJobFactoryTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\TestUtil.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Scheduling\Quartz\TriggerObjectTest.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/test/Spring/Spring.Scheduling.Quartz.Tests/Spring.Scheduling.Quartz.Tests.2005.csproj b/test/Spring/Spring.Scheduling.Quartz.Tests/Spring.Scheduling.Quartz.Tests.2005.csproj
deleted file mode 100644
index 34a3e208..00000000
--- a/test/Spring/Spring.Scheduling.Quartz.Tests/Spring.Scheduling.Quartz.Tests.2005.csproj
+++ /dev/null
@@ -1,111 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003" ToolsVersion="3.5">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{9FE720ED-2BD9-4FB9-89C8-FFFA4A491CB5}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Scheduling.Quartz.Tests</AssemblyName>
-    <FileUpgradeFlags>
-    </FileUpgradeFlags>
-    <OldToolsVersion>2.0</OldToolsVersion>
-    <UpgradeBackupLocation>
-    </UpgradeBackupLocation>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.Scheduling.Quartz.Tests\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.NET.2005\Spring.Scheduling.Quartz.Tests\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="nunit.framework, Version=2.2.7.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="Quartz, Version=0.7.0.15571, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\net\2.0\Quartz.dll</HintPath>
-    </Reference>
-    <Reference Include="Rhino.Mocks, Version=2.9.6.40380, Culture=neutral, PublicKeyToken=0b3305902db7183f, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Rhino.Mocks.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Scheduling.Quartz\Spring.Scheduling.Quartz.2005.csproj">
-      <Project>{E823D54C-CE82-4868-929F-5F95A999F61E}</Project>
-      <Name>Spring.Scheduling.Quartz.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Core.Tests\Spring.Core.Tests.2005.csproj">
-      <Project>{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}</Project>
-      <Name>Spring.Core.Tests.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="Scheduling\Quartz\AdaptableJobFactoryTest.cs" />
-    <Compile Include="Scheduling\Quartz\QuartzSupportTests.cs" />
-    <Compile Include="Scheduling\Quartz\QuartzTestObject.cs" />
-    <Compile Include="Scheduling\Quartz\SchedulerFactoryObjectTest.cs" />
-    <Compile Include="Scheduling\Quartz\SpringObjectJobFactoryTest.cs" />
-    <Compile Include="Scheduling\Quartz\TestMethodInvokingTask.cs" />
-    <Compile Include="Scheduling\Quartz\TestUtil.cs" />
-    <Compile Include="Scheduling\Quartz\TriggerObjectTest.cs" />
-    <Compile Include="Scheduling\Quartz\SimpleTriggerObjectTest.cs" />
-    <Compile Include="Scheduling\Quartz\CronTriggerObjectTest.cs" />
-    <Compile Include="Scheduling\Quartz\JobDetailObjectTest.cs" />
-    <Compile Include="Scheduling\Quartz\MethodInvokingJobDetailFactoryObjectTest.cs" />
-    <Compile Include="Scheduling\Quartz\MethodInvokingJobTest.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <None Include="Spring.Scheduling.Quartz.Tests.dll.config">
-      <CopyToOutputDirectory>PreserveNewest</CopyToOutputDirectory>
-    </None>
-  </ItemGroup>
-  <ItemGroup>
-    <Content Include="job-scheduling-data.xml">
-      <CopyToOutputDirectory>PreserveNewest</CopyToOutputDirectory>
-    </Content>
-    <Content Include="multipleAnonymousMethodInvokingJobDetailFB.xml">
-      <CopyToOutputDirectory>PreserveNewest</CopyToOutputDirectory>
-    </Content>
-    <Content Include="multipleSchedulers.xml">
-      <CopyToOutputDirectory>PreserveNewest</CopyToOutputDirectory>
-    </Content>
-    <Content Include="schedulerAccessorObject.xml">
-      <CopyToOutputDirectory>PreserveNewest</CopyToOutputDirectory>
-    </Content>
-    <Content Include="schedulerRepositoryExposure.xml">
-      <CopyToOutputDirectory>PreserveNewest</CopyToOutputDirectory>
-    </Content>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it. 
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/test/Spring/Spring.Services.Tests/Spring.Services.Tests.2003.csproj b/test/Spring/Spring.Services.Tests/Spring.Services.Tests.2003.csproj
deleted file mode 100644
index ed64cc1b..00000000
--- a/test/Spring/Spring.Services.Tests/Spring.Services.Tests.2003.csproj
+++ /dev/null
@@ -1,283 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{EB2687B7-8B26-4FBC-852A-4128D5CACAFC}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Services.Tests"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = 'echo "Copying .xml files for Spring.Services tests"&#xd;&#xa;xcopy /f /y /s /d /i "$(ProjectDir)Data" ..\..\..\..\build\VS.NET.2003\Spring.Services.Tests\$(ConfigurationName)\ &#xd;&#xa;rem xcopy "$(ProjectDir)$(TargetFileName)-1.1.config" ..\..\..\..\build\VS.NET.2003\Spring.Services.Tests\$(ConfigurationName)\$(TargetFileName).config  /s /q&#xd;&#xa;copy /y "$(ProjectDir)$(TargetFileName)-1.1.config" ..\..\..\..\build\VS.Net.2003\Spring.Services.Tests\$(ConfigurationName)\$(TargetFileName).config '
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = "0618"
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Services.Tests\Debug-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "true"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Services.Tests\Release-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "nunit.framework"
-                    AssemblyName = "nunit.framework"
-                    HintPath = "..\..\..\lib\Net\1.1\nunit.framework.dll"
-                />
-                <Reference
-                    Name = "system.runtime.remoting"
-                    AssemblyName = "System.Runtime.Remoting"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\system.runtime.remoting.dll"
-                />
-                <Reference
-                    Name = "Spring.Core.2003"
-                    Project = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Core.Tests.2003"
-                    Project = "{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Services.2003"
-                    Project = "{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "System.Web.Services"
-                    AssemblyName = "System.Web.Services"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Web.Services.dll"
-                />
-                <Reference
-                    Name = "System.EnterpriseServices"
-                    AssemblyName = "System.EnterpriseServices"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.EnterpriseServices.dll"
-                />
-                <Reference
-                    Name = "DotNetMock"
-                    AssemblyName = "DotNetMock"
-                    HintPath = "..\..\..\lib\Net\1.1\DotNetMock.dll"
-                />
-                <Reference
-                    Name = "Spring.Aop.2003"
-                    Project = "{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Aop.Tests.2003"
-                    Project = "{2111596A-0327-4C9D-8919-294FBD988A23}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Rhino.Mocks"
-                    AssemblyName = "Rhino.Mocks"
-                    HintPath = "..\..\..\lib\Net\1.1\Rhino.Mocks.dll"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Spring.Services.Tests.build"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Spring.Services.Tests.dll-1.1.config"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Data\Spring\Remoting\autowire.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\Spring\Remoting\cao.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\Spring\Remoting\caoLifetimeService.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\Spring\Remoting\remotingConfigurer.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\Spring\Remoting\saoLifetimeService.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\Spring\Remoting\saoSingleCall.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\Spring\Remoting\saoSingleton.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\Spring\Remoting\saoSingleton-aop.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\Spring\Remoting\saoSingleton-autowired.xml"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Web\Services\configurableFactory.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\Spring\Web\Services\document-literal.wsdl"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\Spring\Web\Services\nestedSchema.wsdl"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Web\Services\nestedSchema.xsd"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Web\Services\rpc-literal.wsdl"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Data\Spring\Web\Services\Service.cs.fyi"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "EnterpriseServices\ExportedServicedComponentSample.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "EnterpriseServices\ServicedComponentExporterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\BaseRemotingTestFixture.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\CaoExporterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\CaoFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\ISimpleCounter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\RemoteObjectFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\RemotingConfigParserTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\RemotingConfigurerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\SaoExporterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\SaoFactoryObjectTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Remoting\SimpleCounter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Services\WebServiceProxyFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/test/Spring/Spring.Services.Tests/Spring.Services.Tests.2005.csproj b/test/Spring/Spring.Services.Tests/Spring.Services.Tests.2005.csproj
deleted file mode 100644
index e28d90c7..00000000
--- a/test/Spring/Spring.Services.Tests/Spring.Services.Tests.2005.csproj
+++ /dev/null
@@ -1,196 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{EB2687B7-8B26-4FBC-852A-4128D5CACAFC}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.Services.Tests</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Library</OutputType>
-    <RootNamespace>Spring</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Services.Tests\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>0618</NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>true</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-    <UseVSHostingProcess>true</UseVSHostingProcess>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Services.Tests\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="DotNetMock, Version=0.7.4.0, Culture=neutral, PublicKeyToken=805ea88df19095f6">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\DotNetMock.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.framework">
-      <Name>nunit.framework</Name>
-      <HintPath>..\..\..\lib\Net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="Rhino.Mocks, Version=3.4.0.0, Culture=neutral, PublicKeyToken=0b3305902db7183f, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Rhino.Mocks.dll</HintPath>
-    </Reference>
-    <Reference Include="System">
-      <Name>System</Name>
-    </Reference>
-    <Reference Include="System.Data">
-      <Name>System.Data</Name>
-    </Reference>
-    <Reference Include="System.EnterpriseServices" />
-    <Reference Include="System.Runtime.Remoting" />
-    <Reference Include="System.Web.Services" />
-    <Reference Include="System.Xml">
-      <Name>System.XML</Name>
-    </Reference>
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="AssemblyInfo.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="EnterpriseServices\ExportedServicedComponentSample.cs" />
-    <Compile Include="EnterpriseServices\ServicedComponentExporterTests.cs" />
-    <Compile Include="Remoting\BaseRemotingTestFixture.cs" />
-    <Compile Include="Remoting\CaoExporterTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Remoting\CaoFactoryObjectTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Remoting\RemotingConfigParserTests.cs" />
-    <Compile Include="Remoting\RemotingConfigurerTests.cs" />
-    <Compile Include="Remoting\ISimpleCounter.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Remoting\RemoteObjectFactoryTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Remoting\SaoExporterTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Remoting\SaoFactoryObjectTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Remoting\SimpleCounter.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Web\Services\WebServiceProxyFactoryTests.cs" />
-    <EmbeddedResource Include="Data\Spring\Web\Services\rpc-literal.wsdl" />
-    <EmbeddedResource Include="Data\Spring\Web\Services\document-literal.wsdl" />
-    <None Include="Data\Spring\Web\Services\nestedSchema.xsd">
-      <SubType>Designer</SubType>
-    </None>
-    <None Include="Data\Spring\Web\Services\Service.cs.fyi" />
-    <None Include="Spring.Services.Tests.build" />
-    <None Include="Spring.Services.Tests.dll.config">
-      <CopyToOutputDirectory>PreserveNewest</CopyToOutputDirectory>
-    </None>
-    <None Include="Data\Spring\Web\Services\nestedSchema.wsdl">
-    </None>
-    <EmbeddedResource Include="Data\Spring\Remoting\autowire.xml">
-    </EmbeddedResource>
-    <EmbeddedResource Include="Data\Spring\Remoting\cao.xml">
-    </EmbeddedResource>
-    <EmbeddedResource Include="Data\Spring\Remoting\caoLifetimeService.xml">
-    </EmbeddedResource>
-    <EmbeddedResource Include="Data\Spring\Remoting\saoLifetimeService.xml">
-    </EmbeddedResource>
-    <EmbeddedResource Include="Data\Spring\Remoting\saoSingleCall.xml">
-    </EmbeddedResource>
-    <EmbeddedResource Include="Data\Spring\Remoting\saoSingleton.xml">
-    </EmbeddedResource>
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\Spring\Remoting\remotingConfigurer.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Aop\Spring.Aop.2005.csproj">
-      <Project>{3A3A4E65-45A6-4B20-B460-0BEDC302C02C}</Project>
-      <Name>Spring.Aop.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Services\Spring.Services.2005.csproj">
-      <Project>{B58E34CF-6E70-481D-AC87-1BC2D13C21FB}</Project>
-      <Name>Spring.Services.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Aop.Tests\Spring.Aop.Tests.2005.csproj">
-      <Project>{2111596A-0327-4C9D-8919-294FBD988A23}</Project>
-      <Name>Spring.Aop.Tests.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Core.Tests\Spring.Core.Tests.2005.csproj">
-      <Project>{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}</Project>
-      <Name>Spring.Core.Tests.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\Spring\Web\Services\configurableFactory.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\Spring\Remoting\saoSingleton-aop.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Data\Spring\Remoting\saoSingleton-autowired.xml" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>echo "Copying .xml files for Spring.Services tests"
-xcopy "$(ProjectDir)Data" ..\..\..\..\build\VS.Net.2005\Spring.Services.Tests\$(ConfigurationName)\ /y /s /q /d
-xcopy "$(ProjectDir)$(TargetFileName).config" ..\..\..\..\build\VS.Net.2005\Spring.Services.Tests\$(ConfigurationName)\ /y /s /q</PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file
diff --git a/test/Spring/Spring.Testing.NUnit.Tests/Spring.Testing.NUnit.Tests.2003.csproj b/test/Spring/Spring.Testing.NUnit.Tests/Spring.Testing.NUnit.Tests.2003.csproj
deleted file mode 100644
index 855b37c7..00000000
--- a/test/Spring/Spring.Testing.NUnit.Tests/Spring.Testing.NUnit.Tests.2003.csproj
+++ /dev/null
@@ -1,128 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{E2689B4A-A951-420E-A274-BE5EBCD5F8D8}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Testing.NUnit.Tests"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = 'echo "Copying .xml files for tests"&#xd;&#xa;xcopy "$(ProjectDir)Data" ..\..\..\..\build\VS.Net.2003\$(TargetName)\$(ConfigurationName)\ /y /s /q /d&#xd;&#xa;copy  "$(ProjectDir)$(TargetFileName).config" ..\..\..\..\build\VS.Net.2003\$(TargetName)\$(ConfigurationName)\$(TargetFileName).config'
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "OnBuildSuccess"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Testing.NUnit.Tests\Debug-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Testing.NUnit.Tests\Release-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "Spring.Testing.NUnit.2003"
-                    Project = "{6B8639E3-88BB-4F7B-9F23-699E84C30D58}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "nunit.framework"
-                    AssemblyName = "nunit.framework"
-                    HintPath = "..\..\..\lib\Net\1.1\nunit.framework.dll"
-                />
-                <Reference
-                    Name = "Spring.Data.Tests.2003"
-                    Project = "{C5585365-561C-4EC4-8956-87FFBD9AB1CD}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Core.2003"
-                    Project = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Spring.Testing.NUnit.Tests.dll.config"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Testing\NUnit\AbstractDependencyInjectionSpringContextTestsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Testing\NUnit\TestApplicationContext.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/test/Spring/Spring.Testing.NUnit.Tests/Spring.Testing.NUnit.Tests.2005.csproj b/test/Spring/Spring.Testing.NUnit.Tests/Spring.Testing.NUnit.Tests.2005.csproj
deleted file mode 100644
index 53dbd57e..00000000
--- a/test/Spring/Spring.Testing.NUnit.Tests/Spring.Testing.NUnit.Tests.2005.csproj
+++ /dev/null
@@ -1,90 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{4D6D616B-7643-4D6B-8E5E-14ECFDB9AF82}</ProjectGuid>
-    <OutputType>Library</OutputType>
-    <AppDesignerFolder>Properties</AppDesignerFolder>
-    <RootNamespace>Spring</RootNamespace>
-    <AssemblyName>Spring.Testing.NUnit.Tests</AssemblyName>
-    <StartupObject>
-    </StartupObject>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <DebugSymbols>true</DebugSymbols>
-    <DebugType>full</DebugType>
-    <Optimize>false</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Testing.NUnit.Tests\Debug\</OutputPath>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <DebugType>pdbonly</DebugType>
-    <Optimize>true</Optimize>
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Testing.NUnit.Tests\Release\</OutputPath>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <ErrorReport>prompt</ErrorReport>
-    <WarningLevel>4</WarningLevel>
-  </PropertyGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=1.1.0.0, Culture=neutral, PublicKeyToken=af08829b84f0328e">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.framework, Version=2.4.1.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="Rhino.Mocks, Version=3.4.0.0, Culture=neutral, PublicKeyToken=0b3305902db7183f, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Rhino.Mocks.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <Compile Include="AssemblyInfo.cs" />
-    <Compile Include="Testing\Ado\SimpleAdoTestUtilsTests.cs" />
-    <Compile Include="Testing\NUnit\AbstractDependencyInjectionSpringContextTestsTests.cs" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Data\Spring.Data.2005.csproj">
-      <Project>{AE00E5AB-C39A-436F-86D2-33BFE33E2E40}</Project>
-      <Name>Spring.Data.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Testing.NUnit\Spring.Testing.NUnit.2005.csproj">
-      <Project>{ED204A7B-832F-44C7-BFE3-504AEBE1BCC8}</Project>
-      <Name>Spring.Testing.NUnit.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Core.Tests\Spring.Core.Tests.2005.csproj">
-      <Project>{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}</Project>
-      <Name>Spring.Core.Tests.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Data.Tests\Spring.Data.Tests.2005.csproj">
-      <Project>{ACD39D47-1811-40FA-9E7E-5DEA5B9CE6C0}</Project>
-      <Name>Spring.Data.Tests.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <ItemGroup>
-    <Content Include="Spring.Testing.NUnit.Tests.dll.config">
-      <CopyToOutputDirectory>Always</CopyToOutputDirectory>
-    </Content>
-    <EmbeddedResource Include="Testing\NUnit\TestApplicationContext.xml" />
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <!-- To modify your build process, add your task inside one of the targets below and uncomment it.
-       Other similar extension points exist, see Microsoft.Common.targets.
-  <Target Name="BeforeBuild">
-  </Target>
-  <Target Name="AfterBuild">
-  </Target>
-  -->
-</Project>
\ No newline at end of file
diff --git a/test/Spring/Spring.Web.Tests/Spring.Web.Tests.2003.csproj b/test/Spring/Spring.Web.Tests/Spring.Web.Tests.2003.csproj
deleted file mode 100644
index 1e5e0b7e..00000000
--- a/test/Spring/Spring.Web.Tests/Spring.Web.Tests.2003.csproj
+++ /dev/null
@@ -1,390 +0,0 @@
-<VisualStudioProject>
-    <CSHARP
-        ProjectType = "Local"
-        ProductVersion = "7.10.6030"
-        SchemaVersion = "2.0"
-        ProjectGuid = "{EB2587B7-8B26-4FBC-852A-4128D5CACAFC}"
-    >
-        <Build>
-            <Settings
-                ApplicationIcon = ""
-                AssemblyKeyContainerName = ""
-                AssemblyName = "Spring.Web.Tests"
-                AssemblyOriginatorKeyFile = ""
-                DefaultClientScript = "JScript"
-                DefaultHTMLPageLayout = "Grid"
-                DefaultTargetSchema = "IE50"
-                DelaySign = "false"
-                OutputType = "Library"
-                PreBuildEvent = ""
-                PostBuildEvent = 'echo "Copying .xml files for tests"&#xd;&#xa;xcopy "$(ProjectDir)Data" ..\..\..\..\build\VS.Net.2003\Spring.Web.Tests\$(ConfigurationName)\ /y /s /q /d&#xd;&#xa;'
-                RootNamespace = "Spring"
-                RunPostBuildEvent = "Always"
-                StartupObject = ""
-            >
-                <Config
-                    Name = "Debug-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "DEBUG;TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "true"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = "0618"
-                    Optimize = "false"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Web.Tests\Debug-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "true"
-                    WarningLevel = "4"
-                />
-                <Config
-                    Name = "Release-1.1"
-                    AllowUnsafeBlocks = "false"
-                    BaseAddress = "285212672"
-                    CheckForOverflowUnderflow = "false"
-                    ConfigurationOverrideFile = ""
-                    DefineConstants = "TRACE;NET_1_1"
-                    DocumentationFile = ""
-                    DebugSymbols = "false"
-                    FileAlignment = "4096"
-                    IncrementalBuild = "false"
-                    NoStdLib = "false"
-                    NoWarn = ""
-                    Optimize = "true"
-                    OutputPath = "..\..\..\build\VS.Net.2003\Spring.Web.Tests\Release-1.1\"
-                    RegisterForComInterop = "false"
-                    RemoveIntegerChecks = "false"
-                    TreatWarningsAsErrors = "false"
-                    WarningLevel = "4"
-                />
-            </Settings>
-            <References>
-                <Reference
-                    Name = "System"
-                    AssemblyName = "System"
-                    HintPath = "..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.dll"
-                />
-                <Reference
-                    Name = "System.Data"
-                    AssemblyName = "System.Data"
-                    HintPath = "..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Data.dll"
-                />
-                <Reference
-                    Name = "System.XML"
-                    AssemblyName = "System.Xml"
-                    HintPath = "..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.XML.dll"
-                />
-                <Reference
-                    Name = "System.Web"
-                    AssemblyName = "System.Web"
-                    HintPath = "..\..\..\..\..\..\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Web.dll"
-                />
-                <Reference
-                    Name = "nunit.framework"
-                    AssemblyName = "nunit.framework"
-                    HintPath = "..\..\..\lib\Net\1.1\nunit.framework.dll"
-                />
-                <Reference
-                    Name = "System.Web.Services"
-                    AssemblyName = "System.Web.Services"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Web.Services.dll"
-                />
-                <Reference
-                    Name = "System.Drawing"
-                    AssemblyName = "System.Drawing"
-                    HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Drawing.dll"
-                />
-                <Reference
-                    Name = "Spring.Core.2003"
-                    Project = "{710961A3-0DF4-49E4-A26E-F5B9C044AC84}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Core.Tests.2003"
-                    Project = "{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Spring.Web.2003"
-                    Project = "{BA4789EB-281A-48EA-8763-28B9F0596A18}"
-                    Package = "{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}"
-                />
-                <Reference
-                    Name = "Common.Logging"
-                    AssemblyName = "Common.Logging"
-                    HintPath = "..\..\..\lib\Net\1.1\Common.Logging.dll"
-                />
-                <Reference
-                    Name = "Rhino.Mocks"
-                    AssemblyName = "Rhino.Mocks"
-                    HintPath = "..\..\..\lib\Net\1.1\Rhino.Mocks.dll"
-                />
-                <Reference
-                    Name = "NUnitAsp"
-                    AssemblyName = "NUnitAsp"
-                    HintPath = "..\..\..\lib\Net\1.1\NUnitAsp.dll"
-                />
-                <Reference
-                    Name = "NUnitAspEx"
-                    AssemblyName = "NUnitAspEx"
-                    HintPath = "..\..\..\lib\Net\1.1\NUnitAspEx.dll"
-                />
-                <Reference
-                    Name = "nunit.core.interfaces"
-                    AssemblyName = "nunit.core.interfaces"
-                    HintPath = "..\..\..\lib\Net\1.1\nunit.core.interfaces.dll"
-                    Private = "False"
-                />
-            </References>
-        </Build>
-        <Files>
-            <Include>
-                <File
-                    RelPath = "AssemblyInfo.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Spring.Web.Tests.build"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Caching\AspNetCacheTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\HttpApplicationConfigurerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Context\Support\HttpApplicationConfigurerTests.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Context\Support\WebApplicationContextTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Core\IO\WebResourceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Spring\Context\Support\WebApplicationContextTests\Dummy.aspx"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Context\Support\WebApplicationContextTests\Web.Config"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Support\TestForm.aspx"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Objects\Factory\Support\TestForm.aspx.cs"
-                    DependentUpon = "TestForm.aspx"
-                    SubType = "ASPXCodeBehind"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Data\Spring\Web\Support\PageHandlerFactoryTests\DisablesSession.aspx"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Web\Support\PageHandlerFactoryTests\MaintainsSession1.aspx"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Web\Support\PageHandlerFactoryTests\MaintainsSession2.aspx"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Web\Support\PageHandlerFactoryTests\TransferAfterSetResult.aspx"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Web\Support\PageHandlerFactoryTests\TransferAfterSetResultSave.aspx"
-                    BuildAction = "Content"
-                />
-                <File
-                    RelPath = "Data\Spring\Web\Support\PageHandlerFactoryTests\Web.Config.net-1.1"
-                    BuildAction = "None"
-                />
-                <File
-                    RelPath = "Globalization\Resolvers\DefaultWebCultureResolverTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\WebObjectDefinitionFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Objects\Factory\Support\WebObjectFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "TestSupport\DictionaryModelPersistenceMedium.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "TestSupport\NUnitAdapter.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "TestSupport\SessionMock.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "TestSupport\TestPage.cs"
-                    SubType = "ASPXCodeBehind"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "TestSupport\TestUserControl.cs"
-                    SubType = "ASPXCodeBehind"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "TestSupport\TestWebContext.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "TestSupport\TestWebContextTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "TestSupport\VirtualEnvironmentMock.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "TestSupport\VoidDelegate.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "TestSupport\WebApplicationTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\HttpContextStorageTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Threading\HybridContextStorageTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\WebDIPerformanceTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Util\WebUtilsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Services\WebServiceExporterTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\AbstractHandlerFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\ControlInterceptionTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\ControlInterceptionTests.objects.xml"
-                    BuildAction = "EmbeddedResource"
-                />
-                <File
-                    RelPath = "Web\Support\LocalResourceManagerTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\MimeMediaTypeTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\PageHandlerFactoryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\ResultFactoryRegistryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\Support\ResultTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\PageTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\SessionModelPersistenceMediumTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\UserControlTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\AbstractValidationControlTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\HeadTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\ValidationErrorsTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-                <File
-                    RelPath = "Web\UI\Controls\ValidationSummaryTests.cs"
-                    SubType = "Code"
-                    BuildAction = "Compile"
-                />
-            </Include>
-        </Files>
-    </CSHARP>
-</VisualStudioProject>
-
diff --git a/test/Spring/Spring.Web.Tests/Spring.Web.Tests.2005.csproj b/test/Spring/Spring.Web.Tests/Spring.Web.Tests.2005.csproj
deleted file mode 100644
index 610250d2..00000000
--- a/test/Spring/Spring.Web.Tests/Spring.Web.Tests.2005.csproj
+++ /dev/null
@@ -1,207 +0,0 @@
-<Project DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
-  <PropertyGroup>
-    <ProjectType>Local</ProjectType>
-    <ProductVersion>8.0.50727</ProductVersion>
-    <SchemaVersion>2.0</SchemaVersion>
-    <ProjectGuid>{C67E47AA-1ACD-41B4-A465-4D336A2319CA}</ProjectGuid>
-    <Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
-    <Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
-    <ApplicationIcon>
-    </ApplicationIcon>
-    <AssemblyKeyContainerName>
-    </AssemblyKeyContainerName>
-    <AssemblyName>Spring.Web.Tests</AssemblyName>
-    <AssemblyOriginatorKeyFile>
-    </AssemblyOriginatorKeyFile>
-    <DefaultClientScript>JScript</DefaultClientScript>
-    <DefaultHTMLPageLayout>Grid</DefaultHTMLPageLayout>
-    <DefaultTargetSchema>IE50</DefaultTargetSchema>
-    <DelaySign>false</DelaySign>
-    <OutputType>Library</OutputType>
-    <RootNamespace>Spring</RootNamespace>
-    <RunPostBuildEvent>OnBuildSuccess</RunPostBuildEvent>
-    <StartupObject>
-    </StartupObject>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Web.Tests\Debug\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;DEBUG;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>true</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>0618</NoWarn>
-    <Optimize>false</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>true</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>full</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-    <UseVSHostingProcess>true</UseVSHostingProcess>
-  </PropertyGroup>
-  <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
-    <OutputPath>..\..\..\build\VS.Net.2005\Spring.Web.Tests\Release\</OutputPath>
-    <AllowUnsafeBlocks>false</AllowUnsafeBlocks>
-    <BaseAddress>285212672</BaseAddress>
-    <CheckForOverflowUnderflow>false</CheckForOverflowUnderflow>
-    <ConfigurationOverrideFile>
-    </ConfigurationOverrideFile>
-    <DefineConstants>TRACE;NET_2_0</DefineConstants>
-    <DocumentationFile>
-    </DocumentationFile>
-    <DebugSymbols>false</DebugSymbols>
-    <FileAlignment>4096</FileAlignment>
-    <NoStdLib>false</NoStdLib>
-    <NoWarn>
-    </NoWarn>
-    <Optimize>true</Optimize>
-    <RegisterForComInterop>false</RegisterForComInterop>
-    <RemoveIntegerChecks>false</RemoveIntegerChecks>
-    <TreatWarningsAsErrors>false</TreatWarningsAsErrors>
-    <WarningLevel>4</WarningLevel>
-    <DebugType>none</DebugType>
-    <ErrorReport>prompt</ErrorReport>
-  </PropertyGroup>
-  <ItemGroup>
-    <Compile Include="AssemblyInfo.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Caching\AspNetCacheTests.cs" />
-    <Compile Include="Context\Support\HttpApplicationConfigurerTests.cs" />
-    <Compile Include="Context\Support\WebApplicationContextTests.cs" />
-    <Compile Include="Core\IO\WebResourceTests.cs" />
-    <Compile Include="Data\Spring\Objects\Factory\Support\TestForm.aspx.cs">
-      <DependentUpon>TestForm.aspx</DependentUpon>
-      <SubType>ASPXCodeBehind</SubType>
-    </Compile>
-    <Compile Include="Globalization\Resolvers\DefaultWebCultureResolverTests.cs" />
-    <Compile Include="Objects\Factory\Support\WebObjectDefinitionFactoryTests.cs" />
-    <Compile Include="Objects\Factory\Support\WebObjectFactoryTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="TestSupport\DictionaryModelPersistenceMedium.cs" />
-    <Compile Include="TestSupport\NUnitAdapter.cs" />
-    <Compile Include="TestSupport\SessionMock.cs" />
-    <Compile Include="TestSupport\TestPage.cs">
-      <SubType>ASPXCodeBehind</SubType>
-    </Compile>
-    <Compile Include="TestSupport\TestUserControl.cs">
-      <SubType>ASPXCodeBehind</SubType>
-    </Compile>
-    <Compile Include="TestSupport\TestWebContext.cs" />
-    <Compile Include="TestSupport\TestWebContextTests.cs" />
-    <Compile Include="TestSupport\VirtualEnvironmentMock.cs" />
-    <Compile Include="TestSupport\VoidDelegate.cs" />
-    <Compile Include="TestSupport\WebApplicationTests.cs" />
-    <Compile Include="Threading\HttpContextStorageTests.cs" />
-    <Compile Include="Threading\HybridContextStorageTests.cs" />
-    <Compile Include="Util\WebDIPerformanceTests.cs" />
-    <Compile Include="Util\WebUtilsTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Web\Services\WebServiceExporterTests.cs" />
-    <Compile Include="Web\Support\AbstractHandlerFactoryTests.cs" />
-    <Compile Include="Web\Support\ControlInterceptionTests.cs">
-      <SubType>ASPXCodeBehind</SubType>
-    </Compile>
-    <Compile Include="Web\Support\LocalResourceManagerTests.cs" />
-    <Compile Include="Web\Support\MimeMediaTypeTests.cs" />
-    <Compile Include="Web\Support\PageHandlerFactoryTests.cs" />
-    <Compile Include="Web\Support\ResultFactoryRegistryTests.cs" />
-    <Compile Include="Web\Support\ResultTests.cs">
-      <SubType>Code</SubType>
-    </Compile>
-    <Compile Include="Web\UI\Controls\AbstractValidationControlTests.cs" />
-    <Compile Include="Web\UI\Controls\HeadTests.cs" />
-    <Compile Include="Web\UI\Controls\ValidationErrorsTests.cs" />
-    <Compile Include="Web\UI\Controls\ValidationSummaryTests.cs" />
-    <Compile Include="Web\UI\PageTests.cs">
-    </Compile>
-    <Compile Include="Web\UI\SessionModelPersistenceMediumTests.cs" />
-    <Compile Include="Web\UI\UserControlTests.cs" />
-    <None Include="Data\Spring\Context\Support\WebApplicationContextTests\Web.Config" />
-    <None Include="Data\Spring\Web\Support\LocalResourceManagerTests\Web.Config" />
-    <None Include="Data\Spring\Web\Support\PageHandlerFactoryTests\Web.Config.net-1.1" />
-    <None Include="Data\Spring\Web\Support\PageHandlerFactoryTests\Web.Config.net-2.0" />
-    <None Include="Spring.Web.Tests.build" />
-  </ItemGroup>
-  <ItemGroup>
-    <EmbeddedResource Include="Context\Support\HttpApplicationConfigurerTests.xml" />
-    <Content Include="Data\Spring\Context\Support\WebApplicationContextTests\Dummy.aspx" />
-    <Content Include="Data\Spring\Objects\Factory\Support\TestForm.aspx" />
-    <Content Include="Data\Spring\Web\Support\LocalResourceManagerTests\WithoutResources.aspx" />
-    <Content Include="Data\Spring\Web\Support\LocalResourceManagerTests\WithResources.aspx" />
-    <Content Include="Data\Spring\Web\Support\PageHandlerFactoryTests\ReadOnlySession.aspx" />
-    <Content Include="Data\Spring\Web\Support\PageHandlerFactoryTests\TransferAfterSetResult.aspx" />
-    <Content Include="Data\Spring\Web\Support\PageHandlerFactoryTests\MaintainsSession1.aspx" />
-    <Content Include="Data\Spring\Web\Support\PageHandlerFactoryTests\MaintainsSession2.aspx" />
-    <Content Include="Data\Spring\Web\Support\PageHandlerFactoryTests\DisablesSession.aspx" />
-    <Content Include="Data\Spring\Web\Support\PageHandlerFactoryTests\TransferAfterSetResultSave.aspx" />
-    <EmbeddedResource Include="Data\Spring\Web\Support\LocalResourceManagerTests\App_LocalResources\WithResources.aspx.resx">
-      <SubType>Designer</SubType>
-    </EmbeddedResource>
-    <EmbeddedResource Include="Web\Support\ControlInterceptionTests.objects.xml" />
-  </ItemGroup>
-  <ItemGroup>
-    <Reference Include="Common.Logging, Version=1.1.0.0, Culture=neutral, PublicKeyToken=65e474d141e25e07, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Common.Logging.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.core.interfaces, Version=2.4.1.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\nunit.core.interfaces.dll</HintPath>
-    </Reference>
-    <Reference Include="nunit.framework, Version=2.4.1.0, Culture=neutral, PublicKeyToken=96d09a1eb7f44a77">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\nunit.framework.dll</HintPath>
-    </Reference>
-    <Reference Include="NUnitAsp, Version=1.5.1.27647, Culture=neutral, PublicKeyToken=f9bdb8e9d00f2b23">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\NUnitAsp.dll</HintPath>
-    </Reference>
-    <Reference Include="NUnitAspEx, Version=1.0.2892.39670, Culture=neutral, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\NUnitAspEx.dll</HintPath>
-    </Reference>
-    <Reference Include="Rhino.Mocks, Version=2.9.6.40380, Culture=neutral, PublicKeyToken=0b3305902db7183f, processorArchitecture=MSIL">
-      <SpecificVersion>False</SpecificVersion>
-      <HintPath>..\..\..\lib\Net\2.0\Rhino.Mocks.dll</HintPath>
-    </Reference>
-    <Reference Include="System" />
-    <Reference Include="System.configuration" />
-    <Reference Include="System.Data" />
-    <Reference Include="System.Drawing" />
-    <Reference Include="System.Web" />
-    <Reference Include="System.Web.Services" />
-    <Reference Include="System.XML" />
-  </ItemGroup>
-  <ItemGroup>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Core\Spring.Core.2005.csproj">
-      <Project>{710961A3-0DF4-49E4-A26E-F5B9C044AC84}</Project>
-      <Name>Spring.Core.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\..\..\src\Spring\Spring.Web\Spring.Web.2005.csproj">
-      <Project>{BA4789EB-281A-48EA-8763-28B9F0596A18}</Project>
-      <Name>Spring.Web.2005</Name>
-    </ProjectReference>
-    <ProjectReference Include="..\Spring.Core.Tests\Spring.Core.Tests.2005.csproj">
-      <Project>{44B16BAA-6DF8-447C-9D7F-3AD3D854D904}</Project>
-      <Name>Spring.Core.Tests.2005</Name>
-    </ProjectReference>
-  </ItemGroup>
-  <Import Project="$(MSBuildBinPath)\Microsoft.CSharp.targets" />
-  <PropertyGroup>
-    <PreBuildEvent>
-    </PreBuildEvent>
-    <PostBuildEvent>echo "Copying .xml files for tests"
-%25SystemRoot%25\system32\xcopy "$(ProjectDir)Data" ..\..\..\..\build\VS.Net.2005\Spring.Web.Tests\$(ConfigurationName)\ /y /s /q /d
-</PostBuildEvent>
-  </PropertyGroup>
-</Project>
\ No newline at end of file