Add GitHub Actions configuration (#201)
* new build system based on NUKE build * support test running on Linux
This commit is contained in:
@@ -17,11 +17,11 @@
|
||||
<CommonLoggingVersion>3.4.1</CommonLoggingVersion>
|
||||
<Log4NetVersion>2.0.8</Log4NetVersion>
|
||||
|
||||
<NUnitVersion>3.12.0</NUnitVersion>
|
||||
<NUnitVersion>3.13.1</NUnitVersion>
|
||||
<NUnitTestAdapterVersion>3.17.0</NUnitTestAdapterVersion>
|
||||
<FakeItEasyVersion>6.2.1</FakeItEasyVersion>
|
||||
<FakeItEasyAnalyzerVersion>6.0.0</FakeItEasyAnalyzerVersion>
|
||||
<MicrosoftTestSDKVersion>16.8.0</MicrosoftTestSDKVersion>
|
||||
<MicrosoftTestSDKVersion>16.9.4</MicrosoftTestSDKVersion>
|
||||
|
||||
<TreatWarningsAsErrors>True</TreatWarningsAsErrors>
|
||||
<ComVisible>False</ComVisible>
|
||||
@@ -30,6 +30,8 @@
|
||||
|
||||
<LangVersion>latest</LangVersion>
|
||||
<TargetFullFrameworkVersion>net461</TargetFullFrameworkVersion>
|
||||
|
||||
<IsPackable>false</IsPackable>
|
||||
|
||||
</PropertyGroup>
|
||||
|
||||
|
||||
@@ -1,13 +1,13 @@
|
||||
#region License
|
||||
/*
|
||||
* Copyright 2002-2010 the original author or authors.
|
||||
*
|
||||
*
|
||||
* Licensed under the Apache License, Version 2.0 (the "License");
|
||||
* you may not use this file except in compliance with the License.
|
||||
* You may obtain a copy of the License at
|
||||
*
|
||||
*
|
||||
* http://www.apache.org/licenses/LICENSE-2.0
|
||||
*
|
||||
*
|
||||
* Unless required by applicable law or agreed to in writing, software
|
||||
* distributed under the License is distributed on an "AS IS" BASIS,
|
||||
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
|
||||
@@ -34,22 +34,22 @@ namespace Spring.Aop.Framework.Adapter
|
||||
/// </summary>
|
||||
/// <author>Dmitriy Kopylenko</author>
|
||||
/// <author>Simon White (.NET)</author>
|
||||
[TestFixture]
|
||||
[Platform("Win")]
|
||||
public class AdvisorAdapterRegistrationTests
|
||||
{
|
||||
[Test]
|
||||
public void AdvisorAdapterRegistrationManagerNotPresentInContext()
|
||||
public void AdvisorAdapterRegistrationManagerNotPresentInContext()
|
||||
{
|
||||
string configLocation = ReadOnlyXmlTestResource.GetFilePath("withoutBPPContext.xml", typeof(AdvisorAdapterRegistrationTests));
|
||||
IApplicationContext ctx = new XmlApplicationContext(configLocation);
|
||||
ITestObject to = (ITestObject) ctx.GetObject("testObject");
|
||||
// just invoke any method to see if advice fired
|
||||
try
|
||||
try
|
||||
{
|
||||
to.ReturnsThis();
|
||||
Assert.Fail("Should throw UnknownAdviceTypeException");
|
||||
}
|
||||
catch (UnknownAdviceTypeException)
|
||||
catch (UnknownAdviceTypeException)
|
||||
{
|
||||
// expected
|
||||
Assert.AreEqual(0, GetAdviceImpl(to).InvocationCounter);
|
||||
@@ -57,24 +57,24 @@ namespace Spring.Aop.Framework.Adapter
|
||||
}
|
||||
|
||||
[Test]
|
||||
public void AdvisorAdapterRegistrationManagerPresentInContext()
|
||||
public void AdvisorAdapterRegistrationManagerPresentInContext()
|
||||
{
|
||||
string configLocation = ReadOnlyXmlTestResource.GetFilePath("withBPPContext.xml", typeof(AdvisorAdapterRegistrationTests));
|
||||
IApplicationContext ctx = new XmlApplicationContext(configLocation);
|
||||
ITestObject to = (ITestObject) ctx.GetObject("testObject");
|
||||
// just invoke any method to see if advice fired
|
||||
try
|
||||
try
|
||||
{
|
||||
to.ReturnsThis();
|
||||
Assert.AreEqual(1, GetAdviceImpl(to).InvocationCounter);
|
||||
}
|
||||
catch (UnknownAdviceTypeException)
|
||||
catch (UnknownAdviceTypeException)
|
||||
{
|
||||
Assert.Fail("Should not throw UnknownAdviceTypeException");
|
||||
}
|
||||
}
|
||||
|
||||
private SimpleBeforeAdviceImpl GetAdviceImpl(ITestObject to)
|
||||
private SimpleBeforeAdviceImpl GetAdviceImpl(ITestObject to)
|
||||
{
|
||||
IAdvised advised = (IAdvised) to;
|
||||
IAdvisor advisor = advised.Advisors[0];
|
||||
|
||||
@@ -51,7 +51,7 @@ namespace Spring.Aop.Framework.AutoProxy
|
||||
public class ObjectWithoutInterface
|
||||
{
|
||||
public virtual void Foo()
|
||||
{ }
|
||||
{ }
|
||||
}
|
||||
|
||||
public class TransparentProxyFactory : IFactoryObject
|
||||
@@ -162,12 +162,13 @@ namespace Spring.Aop.Framework.AutoProxy
|
||||
}
|
||||
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void ProxyTransparentProxy()
|
||||
{
|
||||
DefaultListableObjectFactory of = new DefaultListableObjectFactory();
|
||||
|
||||
ConstructorArgumentValues ctorArgs = new ConstructorArgumentValues();
|
||||
ctorArgs.AddNamedArgumentValue("objectType", typeof(ITestObject));
|
||||
ctorArgs.AddNamedArgumentValue("objectType", typeof(ITestObject));
|
||||
of.RegisterObjectDefinition("bar", new RootObjectDefinition(typeof(TransparentProxyFactory), ctorArgs, null));
|
||||
|
||||
TestAutoProxyCreator apc = new TestAutoProxyCreator(of);
|
||||
|
||||
@@ -1,5 +1,5 @@
|
||||
/*
|
||||
* Copyright © 2002-2011 the original author or authors.
|
||||
* Copyright © 2002-2011 the original author or authors.
|
||||
*
|
||||
* Licensed under the Apache License, Version 2.0 (the "License");
|
||||
* you may not use this file except in compliance with the License.
|
||||
@@ -532,6 +532,7 @@ namespace Spring.Aop.Framework.DynamicProxy
|
||||
}
|
||||
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void ProxyMethodWithRefOutParametersWithDirectCall()
|
||||
{
|
||||
PublicRefOutTestObject target = new PublicRefOutTestObject();
|
||||
@@ -547,6 +548,7 @@ namespace Spring.Aop.Framework.DynamicProxy
|
||||
}
|
||||
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void ProxyMethodWithRefOutParametersWithDynamicReflection()
|
||||
{
|
||||
PublicRefOutTestObject target = new PublicRefOutTestObject();
|
||||
@@ -566,6 +568,7 @@ namespace Spring.Aop.Framework.DynamicProxy
|
||||
}
|
||||
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public virtual void ProxyMethodWithRefOutParametersWithStandardReflection()
|
||||
{
|
||||
InternalRefOutTestObject target = new InternalRefOutTestObject();
|
||||
@@ -660,6 +663,7 @@ namespace Spring.Aop.Framework.DynamicProxy
|
||||
}
|
||||
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void ProxyGenericMethodWithRefOutParametersWithDirectCall()
|
||||
{
|
||||
PublicRefOutGenericTestObject target = new PublicRefOutGenericTestObject();
|
||||
@@ -675,6 +679,7 @@ namespace Spring.Aop.Framework.DynamicProxy
|
||||
}
|
||||
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void ProxyGenericMethodWithRefOutParametersWithDynamicReflection()
|
||||
{
|
||||
PublicRefOutGenericTestObject target = new PublicRefOutGenericTestObject();
|
||||
@@ -694,6 +699,7 @@ namespace Spring.Aop.Framework.DynamicProxy
|
||||
}
|
||||
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public virtual void ProxyGenericMethodWithRefOutParametersWithStandardReflection()
|
||||
{
|
||||
InternalRefOutGenericTestObject target = new InternalRefOutGenericTestObject();
|
||||
@@ -844,6 +850,7 @@ namespace Spring.Aop.Framework.DynamicProxy
|
||||
}
|
||||
|
||||
[Test(Description = "http://opensource.atlassian.com/projects/spring/browse/SPRNET-340")]
|
||||
[Platform("Win")]
|
||||
public void MultiThreadedProxyCreation()
|
||||
{
|
||||
MultiThreadedProxyCreation(5);
|
||||
|
||||
@@ -1,13 +1,13 @@
|
||||
#region License
|
||||
/*
|
||||
* Copyright 2002-2010 the original author or authors.
|
||||
*
|
||||
*
|
||||
* Licensed under the Apache License, Version 2.0 (the "License");
|
||||
* you may not use this file except in compliance with the License.
|
||||
* You may obtain a copy of the License at
|
||||
*
|
||||
*
|
||||
* http://www.apache.org/licenses/LICENSE-2.0
|
||||
*
|
||||
*
|
||||
* Unless required by applicable law or agreed to in writing, software
|
||||
* distributed under the License is distributed on an "AS IS" BASIS,
|
||||
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
|
||||
@@ -55,7 +55,7 @@ namespace Spring.Aop.Support
|
||||
// Interceptor behind regexp advisor
|
||||
NopInterceptor nop = (NopInterceptor) iof.GetObject("NopInterceptor");
|
||||
Assert.AreEqual(0, nop.Count);
|
||||
|
||||
|
||||
int newAge = 12;
|
||||
// Not advised
|
||||
advised.Exceptional(null);
|
||||
@@ -74,20 +74,20 @@ namespace Spring.Aop.Support
|
||||
{
|
||||
IObjectFactory iof = new XmlObjectFactory(new ReadOnlyXmlTestResource("RegularExpressionSetterTests.xml", GetType()));
|
||||
IPerson advised = (IPerson) iof.GetObject("SettersAndReturnsThisAdvised");
|
||||
|
||||
|
||||
// Interceptor behind regexp advisor
|
||||
NopInterceptor nop = (NopInterceptor) iof.GetObject("NopInterceptor");
|
||||
Assert.AreEqual(0, nop.Count);
|
||||
|
||||
|
||||
int newAge = 12;
|
||||
// Not advised
|
||||
advised.Exceptional(null);
|
||||
Assert.AreEqual(0, nop.Count);
|
||||
|
||||
|
||||
// This is proxied
|
||||
advised.ReturnsThis();
|
||||
Assert.AreEqual(1, nop.Count);
|
||||
|
||||
|
||||
// Only setter is advised
|
||||
advised.SetAge(newAge);
|
||||
Assert.AreEqual(2, nop.Count);
|
||||
@@ -97,6 +97,7 @@ namespace Spring.Aop.Support
|
||||
}
|
||||
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void Serialization()
|
||||
{
|
||||
IObjectFactory iof = new XmlObjectFactory(new ReadOnlyXmlTestResource("RegularExpressionSetterTests.xml", GetType()));
|
||||
@@ -104,12 +105,12 @@ namespace Spring.Aop.Support
|
||||
// Interceptor behind regexp advisor
|
||||
NopInterceptor nop = (NopInterceptor) iof.GetObject("NopInterceptor");
|
||||
Assert.AreEqual(0, nop.Count);
|
||||
|
||||
|
||||
int newAge = 12;
|
||||
// Not advised
|
||||
Assert.AreEqual(0, p.GetAge());
|
||||
Assert.AreEqual(0, nop.Count);
|
||||
|
||||
|
||||
// This is proxied
|
||||
p.SetAge(newAge);
|
||||
Assert.AreEqual(1, nop.Count);
|
||||
@@ -117,7 +118,7 @@ namespace Spring.Aop.Support
|
||||
Assert.AreEqual(newAge, p.GetAge());
|
||||
// Only setter fired
|
||||
Assert.AreEqual(2, nop.Count);
|
||||
|
||||
|
||||
// Serialize and continue...
|
||||
|
||||
#if !NETCOREAPP // deep chains for Type serialization problems, not worth the effort at the moment
|
||||
|
||||
@@ -25,7 +25,14 @@
|
||||
<ItemGroup>
|
||||
<Compile Include="..\Spring.Core.Tests\TestAssemblySetup.cs" Link="TestAssemblySetup.cs" />
|
||||
<Content Include="App.config" CopyToOutputDirectory="PreserveNewest" />
|
||||
<Content Include="Data\**\*.xml" CopyToOutputDirectory="PreserveNewest" />
|
||||
<None Include="Data\**\*">
|
||||
<Link>Data\%(RecursiveDir)%(Filename)%(Extension)</Link>
|
||||
<CopyToOutputDirectory>PreserveNewest</CopyToOutputDirectory>
|
||||
</None>
|
||||
<None Include="Data\**\*">
|
||||
<Link>%(RecursiveDir)%(Filename)%(Extension)</Link>
|
||||
<CopyToOutputDirectory>PreserveNewest</CopyToOutputDirectory>
|
||||
</None>
|
||||
<EmbeddedResource Include="Aop\Config\AopNamespaceParserTests.xml" />
|
||||
<EmbeddedResource Include="Data\Spring\Aop\Framework\adapter\withBPPContext.xml" />
|
||||
<EmbeddedResource Include="Data\Spring\Aop\Framework\adapter\withoutBPPContext.xml" />
|
||||
|
||||
@@ -1,7 +1,7 @@
|
||||
#region License
|
||||
|
||||
/*
|
||||
* Copyright © 2002-2011 the original author or authors.
|
||||
* Copyright © 2002-2011 the original author or authors.
|
||||
*
|
||||
* Licensed under the Apache License, Version 2.0 (the "License");
|
||||
* you may not use this file except in compliance with the License.
|
||||
@@ -32,19 +32,19 @@ namespace Spring.Core.IO
|
||||
/// Unit tests for the FileSystemResourceTest class.
|
||||
/// </summary>
|
||||
/// <author>Rick Evans</author>
|
||||
[TestFixture]
|
||||
[Platform("Win")]
|
||||
public class FileSystemResourceTests : FileSystemResourceCommonTests
|
||||
{
|
||||
protected override FileSystemResource CreateResourceInstance( string resourceName )
|
||||
{
|
||||
return new FileSystemResource(resourceName);
|
||||
}
|
||||
|
||||
|
||||
[Test]
|
||||
public void LeadingProtocolIsNotTreatedRelative()
|
||||
{
|
||||
FileSystemResource res = new FileSystemResource(@"file://\\server\share\samples\artfair\");
|
||||
FileSystemResource res2 = (FileSystemResource) res.CreateRelative(@"file://./index.html");
|
||||
FileSystemResource res2 = (FileSystemResource) res.CreateRelative(@"file://./index.html");
|
||||
Assert.AreEqual(new Uri(Path.Combine(Environment.CurrentDirectory, "index.html")).AbsolutePath, res2.Uri.AbsolutePath);
|
||||
}
|
||||
|
||||
@@ -94,7 +94,7 @@ namespace Spring.Core.IO
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
|
||||
[Test]
|
||||
public void Resolution_WithProtocolAndSpecialHomeCharacter()
|
||||
{
|
||||
@@ -116,7 +116,7 @@ namespace Spring.Core.IO
|
||||
"The file name with file://~/.. must have resolved to a file " +
|
||||
"in the parent directory of the currently executing domain.");
|
||||
}
|
||||
|
||||
|
||||
[Test]
|
||||
public void CreateRelativeWithParent()
|
||||
{
|
||||
@@ -198,7 +198,7 @@ namespace Spring.Core.IO
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
|
||||
[Test]
|
||||
public void RelativeLocalFileSystemResourceWhenNotRelative()
|
||||
{
|
||||
@@ -259,8 +259,8 @@ namespace Spring.Core.IO
|
||||
IResource rel5 = res.CreateRelative(@"..\..\index.html");
|
||||
Assert.IsTrue(rel5 is FileSystemResource);
|
||||
Assert.AreEqual(@"file [c:\index.html]", rel5.Description);
|
||||
}
|
||||
|
||||
}
|
||||
|
||||
[Test]
|
||||
public void RelativeUncResourceWhenNotRelative()
|
||||
{
|
||||
@@ -321,6 +321,6 @@ namespace Spring.Core.IO
|
||||
IResource rel5 = res.CreateRelative(@"..\..\index.html");
|
||||
Assert.IsTrue(rel5 is FileSystemResource);
|
||||
Assert.AreEqual(@"file [\\server\share\index.html]", rel5.Description);
|
||||
}
|
||||
}
|
||||
}
|
||||
}
|
||||
@@ -43,7 +43,7 @@ namespace Spring.Core.IO
|
||||
public void FixtureSetUp()
|
||||
{
|
||||
// enable (null appender) logging, just to ensure that the logging code is correct
|
||||
LogManager.Adapter = new NoOpLoggerFactoryAdapter();
|
||||
LogManager.Adapter = new NoOpLoggerFactoryAdapter();
|
||||
}
|
||||
|
||||
[Test]
|
||||
@@ -80,6 +80,7 @@ namespace Spring.Core.IO
|
||||
}
|
||||
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void ConvertFromWithEnvironmentVariableExpansion()
|
||||
{
|
||||
string filename = Guid.NewGuid().ToString();
|
||||
|
||||
@@ -52,6 +52,7 @@ namespace Spring.Core.IO
|
||||
}
|
||||
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void GetValidFileInfo()
|
||||
{
|
||||
UrlResource urlResource = new UrlResource(FILE_PROTOCOL_PREFIX + "C:/temp");
|
||||
|
||||
@@ -1,14 +1,14 @@
|
||||
#region License
|
||||
|
||||
/*
|
||||
* Copyright © 2002-2011 the original author or authors.
|
||||
*
|
||||
* Copyright © 2002-2011 the original author or authors.
|
||||
*
|
||||
* Licensed under the Apache License, Version 2.0 (the "License");
|
||||
* you may not use this file except in compliance with the License.
|
||||
* You may obtain a copy of the License at
|
||||
*
|
||||
*
|
||||
* http://www.apache.org/licenses/LICENSE-2.0
|
||||
*
|
||||
*
|
||||
* Unless required by applicable law or agreed to in writing, software
|
||||
* distributed under the License is distributed on an "AS IS" BASIS,
|
||||
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
|
||||
@@ -32,7 +32,7 @@ namespace Spring.Core.TypeConversion
|
||||
/// Unit tests for the RegistryKeyConverter class.
|
||||
/// </summary>
|
||||
/// <author>Aleksandar Seovic</author>
|
||||
[TestFixture]
|
||||
[Platform("Win")]
|
||||
public sealed class RegistryKeyConverterTests
|
||||
{
|
||||
[Test]
|
||||
|
||||
@@ -3,18 +3,18 @@
|
||||
<objects xmlns="http://www.springframework.net">
|
||||
<object id="resource1" type="Spring.Objects.ResourceTestObject, Spring.Core.Tests">
|
||||
<property name="resource">
|
||||
<value>file:///temp/spring-test.properties</value>
|
||||
<value>file://./temp/spring-test.properties</value>
|
||||
</property>
|
||||
<property name="inputStream">
|
||||
<value>file:///temp/spring-test.properties</value>
|
||||
<value>file://./temp/spring-test.properties</value>
|
||||
</property>
|
||||
</object>
|
||||
<object id="resource2" type="Spring.Objects.ResourceTestObject, Spring.Core.Tests">
|
||||
<constructor-arg index="0">
|
||||
<value>file:///temp/spring-test.properties</value>
|
||||
<value>file://./temp/spring-test.properties</value>
|
||||
</constructor-arg>
|
||||
<constructor-arg index="1">
|
||||
<value>file:///temp/spring-test.properties</value>
|
||||
<value>file://./temp/spring-test.properties</value>
|
||||
</constructor-arg>
|
||||
</object>
|
||||
</objects>
|
||||
|
||||
@@ -28,7 +28,6 @@ namespace Spring.Globalization.Formatters
|
||||
/// Unit tests for CurrencyFormatter class.
|
||||
/// </summary>
|
||||
/// <author>Aleksandar Seovic</author>
|
||||
[TestFixture]
|
||||
public class CurrencyFormatterTests
|
||||
{
|
||||
[Test]
|
||||
@@ -54,6 +53,7 @@ namespace Spring.Globalization.Formatters
|
||||
}
|
||||
#if !MONO
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void FormatUsingDefaults()
|
||||
{
|
||||
CurrencyFormatter fmt = new CurrencyFormatter("en-US");
|
||||
@@ -108,6 +108,7 @@ namespace Spring.Globalization.Formatters
|
||||
}
|
||||
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void ParseUsingDefaults()
|
||||
{
|
||||
CurrencyFormatter fmt = new CurrencyFormatter("en-US");
|
||||
@@ -160,6 +161,7 @@ namespace Spring.Globalization.Formatters
|
||||
}
|
||||
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void FormatUsingCustomSettings()
|
||||
{
|
||||
CurrencyFormatter fmt = new CurrencyFormatter("en-US");
|
||||
@@ -189,8 +191,6 @@ namespace Spring.Globalization.Formatters
|
||||
Assert.AreEqual("-1.234,56 din", fmt.Format(-1234.56));
|
||||
}
|
||||
|
||||
|
||||
|
||||
fmt = new CurrencyFormatter(CultureInfoUtils.SerbianCyrillicCultureName);
|
||||
fmt.GroupSizes = new int[] { 1, 2 };
|
||||
fmt.GroupSeparator = "'";
|
||||
@@ -213,6 +213,7 @@ namespace Spring.Globalization.Formatters
|
||||
}
|
||||
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void ParseUsingCustomSettings()
|
||||
{
|
||||
CurrencyFormatter fmt = new CurrencyFormatter("en-US");
|
||||
|
||||
@@ -28,7 +28,6 @@ namespace Spring.Globalization.Formatters
|
||||
/// Unit tests for DateTimeFormatter class.
|
||||
/// </summary>
|
||||
/// <author>Aleksandar Seovic</author>
|
||||
[TestFixture]
|
||||
public class DateTimeFormatterTests
|
||||
{
|
||||
[Test]
|
||||
@@ -54,6 +53,7 @@ namespace Spring.Globalization.Formatters
|
||||
}
|
||||
#if !MONO
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void FormatUsingDefaults()
|
||||
{
|
||||
DateTimeFormatter fmt = new DateTimeFormatter("d", "en-US");
|
||||
@@ -103,6 +103,7 @@ namespace Spring.Globalization.Formatters
|
||||
}
|
||||
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void ParseUsingDefaults()
|
||||
{
|
||||
DateTimeFormatter fmt = new DateTimeFormatter("d", "en-US");
|
||||
|
||||
@@ -54,6 +54,7 @@ namespace Spring.Globalization.Formatters
|
||||
}
|
||||
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void FormatUsingDefaults()
|
||||
{
|
||||
FloatFormatter fmt = new FloatFormatter(FloatFormatter.DefaultFormat, "en-US");
|
||||
|
||||
@@ -28,7 +28,6 @@ namespace Spring.Globalization.Formatters
|
||||
/// Unit tests for NumberFormatter class.
|
||||
/// </summary>
|
||||
/// <author>Aleksandar Seovic</author>
|
||||
[TestFixture]
|
||||
public class NumberFormatterTests
|
||||
{
|
||||
[Test]
|
||||
@@ -54,6 +53,7 @@ namespace Spring.Globalization.Formatters
|
||||
}
|
||||
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void FormatUsingDefaults()
|
||||
{
|
||||
NumberFormatter fmt = new NumberFormatter("en-US");
|
||||
@@ -70,6 +70,7 @@ namespace Spring.Globalization.Formatters
|
||||
}
|
||||
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void ParseUsingDefaults()
|
||||
{
|
||||
NumberFormatter fmt = new NumberFormatter("en-US");
|
||||
@@ -86,6 +87,7 @@ namespace Spring.Globalization.Formatters
|
||||
}
|
||||
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void FormatUsingCustomSettings()
|
||||
{
|
||||
NumberFormatter fmt = new NumberFormatter("en-US");
|
||||
|
||||
@@ -28,7 +28,6 @@ namespace Spring.Globalization.Formatters
|
||||
/// Unit tests for PercentFormatter class.
|
||||
/// </summary>
|
||||
/// <author>Aleksandar Seovic</author>
|
||||
[TestFixture]
|
||||
public class PercentFormatterTests
|
||||
{
|
||||
[Test]
|
||||
@@ -54,6 +53,7 @@ namespace Spring.Globalization.Formatters
|
||||
}
|
||||
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void FormatUsingDefaults()
|
||||
{
|
||||
PercentFormatter fmt = new PercentFormatter("en-US");
|
||||
|
||||
@@ -1,7 +1,7 @@
|
||||
#region License
|
||||
|
||||
/*
|
||||
* Copyright © 2002-2011 the original author or authors.
|
||||
* Copyright © 2002-2011 the original author or authors.
|
||||
*
|
||||
* Licensed under the Apache License, Version 2.0 (the "License");
|
||||
* you may not use this file except in compliance with the License.
|
||||
@@ -41,8 +41,8 @@ namespace Spring.Objects.Factory.Config
|
||||
EnvironmentVariableSource vs = new EnvironmentVariableSource();
|
||||
|
||||
// existing vars
|
||||
Assert.AreEqual(Environment.GetEnvironmentVariable("path"), vs.ResolveVariable("PATH"));
|
||||
Assert.AreEqual(Environment.GetEnvironmentVariable("PATH"), vs.ResolveVariable("path"));
|
||||
Assert.AreEqual(Environment.GetEnvironmentVariable("path"), vs.ResolveVariable("path"));
|
||||
Assert.AreEqual(Environment.GetEnvironmentVariable("PATH"), vs.ResolveVariable("PATH"));
|
||||
Assert.AreEqual(Environment.GetEnvironmentVariable("ComputerName"), vs.ResolveVariable("computerName"));
|
||||
|
||||
// non-existant variable
|
||||
|
||||
@@ -47,7 +47,7 @@ namespace Spring.Objects.Factory.Config
|
||||
private static string testConnectionString = @"Provider=Microsoft.Jet.OLEDB.4.0; Data Source=c:\Northwind.mdb;User ID=Admin;Password=;";
|
||||
private static string testConnectionStringTwo = @"Provider=Microsoft.Jet.OLEDB.4.0; Data Source=c:\Northwind.mdb;User ID=Admin;Password=Ernie;";
|
||||
#endif
|
||||
|
||||
|
||||
[SetUp]
|
||||
public void SetUp()
|
||||
{
|
||||
@@ -140,7 +140,7 @@ namespace Spring.Objects.Factory.Config
|
||||
IConfigurableListableObjectFactory mock = A.Fake<IConfigurableListableObjectFactory>();
|
||||
A.CallTo(() => mock.GetObjectDefinitionNames(false)).Returns(new string [] {defName});
|
||||
A.CallTo(() => mock.GetObjectDefinition(defName, false)).Returns(def);
|
||||
|
||||
|
||||
PropertyPlaceholderConfigurer cfg = new PropertyPlaceholderConfigurer();
|
||||
NameValueCollection defaultProperties = new NameValueCollection();
|
||||
const string expectedName = "Rick Evans";
|
||||
@@ -159,7 +159,7 @@ namespace Spring.Objects.Factory.Config
|
||||
const string defName = "foo";
|
||||
const string placeholder = "${name}";
|
||||
MutablePropertyValues pvs = new MutablePropertyValues();
|
||||
|
||||
|
||||
|
||||
const string theProperty = "name";
|
||||
pvs.Add(theProperty, placeholder);
|
||||
@@ -188,6 +188,7 @@ namespace Spring.Objects.Factory.Config
|
||||
/// variable is replaced.
|
||||
/// </summary>
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void WithEnvironmentVariableFallback()
|
||||
{
|
||||
StaticApplicationContext ac = new StaticApplicationContext();
|
||||
@@ -233,6 +234,7 @@ namespace Spring.Objects.Factory.Config
|
||||
/// variable setting to override the explicitly defined name value collection.
|
||||
/// </summary>
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void WithOverridingEnvironmentProperty()
|
||||
{
|
||||
StaticApplicationContext ac = new StaticApplicationContext();
|
||||
@@ -312,14 +314,14 @@ namespace Spring.Objects.Factory.Config
|
||||
public void SunnyDay()
|
||||
{
|
||||
StaticApplicationContext ac = new StaticApplicationContext();
|
||||
|
||||
|
||||
|
||||
MutablePropertyValues pvs = new MutablePropertyValues();
|
||||
pvs.Add("age", "${age}");
|
||||
RootObjectDefinition def
|
||||
= new RootObjectDefinition("${fqn}", new ConstructorArgumentValues(), pvs);
|
||||
ac.RegisterObjectDefinition("tb3", def);
|
||||
|
||||
|
||||
|
||||
|
||||
pvs = new MutablePropertyValues();
|
||||
@@ -387,7 +389,7 @@ namespace Spring.Objects.Factory.Config
|
||||
Assert.AreEqual(98, inner2.Age);
|
||||
Assert.AreEqual("namemyvar${", inner2.Name);
|
||||
}
|
||||
|
||||
|
||||
/// <summary>
|
||||
/// Makes sure that an appropriate exception is raised when trying
|
||||
/// to resolve this placeholder... ${foo} with this value... foo=ba${foo}r
|
||||
@@ -404,7 +406,7 @@ namespace Spring.Objects.Factory.Config
|
||||
NameValueCollection properties = new NameValueCollection();
|
||||
const string expectedName = "ba${foo}r";
|
||||
properties.Add("foo", expectedName);
|
||||
|
||||
|
||||
IConfigurableListableObjectFactory mock = A.Fake<IConfigurableListableObjectFactory>();
|
||||
A.CallTo(() => mock.GetObjectDefinitionNames(false)).Returns(new string[] {"foo"});
|
||||
A.CallTo(() => mock.GetObjectDefinition(null, false)).WithAnyArguments().Returns(def);
|
||||
@@ -437,7 +439,7 @@ namespace Spring.Objects.Factory.Config
|
||||
IConfigurableListableObjectFactory mock = A.Fake<IConfigurableListableObjectFactory>();
|
||||
A.CallTo(() => mock.GetObjectDefinitionNames(false)).Returns(new string[] {"foo"});
|
||||
A.CallTo(() => mock.GetObjectDefinition(null, false)).WithAnyArguments().Returns(def);
|
||||
|
||||
|
||||
PropertyPlaceholderConfigurer cfg = new PropertyPlaceholderConfigurer();
|
||||
cfg.Properties = properties;
|
||||
cfg.PostProcessObjectFactory(mock);
|
||||
@@ -602,7 +604,7 @@ namespace Spring.Objects.Factory.Config
|
||||
{
|
||||
IApplicationContext ctx = new XmlApplicationContext(
|
||||
"file://Spring/Objects/Factory/Config/PPCWithTypesTests.xml");
|
||||
|
||||
|
||||
object obj = ctx["testObject"];
|
||||
Assert.IsTrue(obj is TestObject);
|
||||
|
||||
|
||||
@@ -1,7 +1,7 @@
|
||||
#region License
|
||||
|
||||
/*
|
||||
* Copyright © 2002-2011 the original author or authors.
|
||||
* Copyright © 2002-2011 the original author or authors.
|
||||
*
|
||||
* Licensed under the Apache License, Version 2.0 (the "License");
|
||||
* you may not use this file except in compliance with the License.
|
||||
@@ -32,7 +32,7 @@ namespace Spring.Objects.Factory.Config
|
||||
/// Unit tests for the RegistryVariableSource class.
|
||||
/// </summary>
|
||||
/// <author>Aleksandar Seovic</author>
|
||||
[TestFixture]
|
||||
[Platform("Win")]
|
||||
public sealed class RegistryVariableSourceTests
|
||||
{
|
||||
private RegistryKey key;
|
||||
|
||||
@@ -1,7 +1,7 @@
|
||||
#region License
|
||||
|
||||
/*
|
||||
* Copyright © 2002-2011 the original author or authors.
|
||||
* Copyright © 2002-2011 the original author or authors.
|
||||
*
|
||||
* Licensed under the Apache License, Version 2.0 (the "License");
|
||||
* you may not use this file except in compliance with the License.
|
||||
@@ -105,7 +105,7 @@ namespace Spring.Objects.Factory.Config
|
||||
[Test]
|
||||
public void WithinApplicationContext()
|
||||
{
|
||||
IApplicationContext ctx = new XmlApplicationContext("file://Spring/Objects/Factory/Config/typeAliases.xml");
|
||||
IApplicationContext ctx = new XmlApplicationContext("file://Spring/Objects/Factory/Config/TypeAliases.xml");
|
||||
|
||||
object obj1 = ctx.GetObject("testObject1");
|
||||
Assert.IsNotNull(obj1);
|
||||
|
||||
@@ -703,7 +703,7 @@ namespace Spring.Objects.Factory.Xml
|
||||
[Test]
|
||||
public void DependenciesMaterializeThis()
|
||||
{
|
||||
IResource resource = new ReadOnlyXmlTestResource("dependenciesMaterializeThis.xml", GetType());
|
||||
IResource resource = new ReadOnlyXmlTestResource("dependenciesmaterializethis.xml", GetType());
|
||||
XmlObjectFactory bf = new XmlObjectFactory(resource);
|
||||
DummyBo bos = (DummyBo) bf.GetObject("boSingleton");
|
||||
DummyBo bop = (DummyBo) bf.GetObject("boPrototype");
|
||||
@@ -796,7 +796,7 @@ namespace Spring.Objects.Factory.Xml
|
||||
[Test]
|
||||
public void FactoryReferenceCircle()
|
||||
{
|
||||
IResource resource = new ReadOnlyXmlTestResource("factoryCircle.xml", GetType());
|
||||
IResource resource = new ReadOnlyXmlTestResource("factorycircle.xml", GetType());
|
||||
XmlObjectFactory xof = new XmlObjectFactory(resource);
|
||||
TestObject tb = (TestObject) xof.GetObject("singletonFactory");
|
||||
DummyFactory db = (DummyFactory) xof.GetObject("&singletonFactory");
|
||||
@@ -1062,14 +1062,14 @@ namespace Spring.Objects.Factory.Xml
|
||||
[Test]
|
||||
public void UnsatisfiedObjectDependencyCheck()
|
||||
{
|
||||
XmlObjectFactory xof = new XmlObjectFactory(new ReadOnlyXmlTestResource("unsatisfiedObjectDependencyCheck.xml", GetType()));
|
||||
XmlObjectFactory xof = new XmlObjectFactory(new ReadOnlyXmlTestResource("unsatisfiedobjectdependencycheck.xml", GetType()));
|
||||
Assert.Throws<UnsatisfiedDependencyException>(() => xof.GetObject("a", typeof(DependenciesObject)));
|
||||
}
|
||||
|
||||
[Test]
|
||||
public void UnsatisfiedSimpleDependencyCheck()
|
||||
{
|
||||
XmlObjectFactory xof = new XmlObjectFactory(new ReadOnlyXmlTestResource("unsatisfiedSimpleDependencyCheck.xml", GetType()));
|
||||
XmlObjectFactory xof = new XmlObjectFactory(new ReadOnlyXmlTestResource("unsatisfiedsimpledependencycheck.xml", GetType()));
|
||||
Assert.Throws<UnsatisfiedDependencyException>(() => xof.GetObject("a", typeof(DependenciesObject)));
|
||||
}
|
||||
|
||||
@@ -1078,7 +1078,7 @@ namespace Spring.Objects.Factory.Xml
|
||||
{
|
||||
XmlObjectFactory xof
|
||||
= new XmlObjectFactory(
|
||||
new ReadOnlyXmlTestResource("satisfiedObjectDependencyCheck.xml", GetType()));
|
||||
new ReadOnlyXmlTestResource("satisfiedobjectdependencycheck.xml", GetType()));
|
||||
DependenciesObject a = (DependenciesObject) xof.GetObject("a");
|
||||
Assert.IsNotNull(a.Spouse);
|
||||
}
|
||||
@@ -1089,7 +1089,7 @@ namespace Spring.Objects.Factory.Xml
|
||||
XmlObjectFactory xof =
|
||||
new XmlObjectFactory(
|
||||
new ReadOnlyXmlTestResource(
|
||||
"satisfiedSimpleDependencyCheck.xml", GetType()));
|
||||
"satisfiedsimpledependencycheck.xml", GetType()));
|
||||
DependenciesObject a = (DependenciesObject) xof.GetObject("a");
|
||||
Assert.AreEqual(a.Age, 33);
|
||||
}
|
||||
@@ -1097,7 +1097,7 @@ namespace Spring.Objects.Factory.Xml
|
||||
[Test]
|
||||
public void UnsatisfiedAllDependencyCheck()
|
||||
{
|
||||
XmlObjectFactory xof= new XmlObjectFactory(new ReadOnlyXmlTestResource("unsatisfiedAllDependencyCheckMissingObjects.xml", GetType()));
|
||||
XmlObjectFactory xof= new XmlObjectFactory(new ReadOnlyXmlTestResource("unsatisfiedalldependencycheckmissingobjects.xml", GetType()));
|
||||
Assert.Throws<UnsatisfiedDependencyException>(() => xof.GetObject("a", typeof(DependenciesObject)));
|
||||
}
|
||||
|
||||
@@ -1106,7 +1106,7 @@ namespace Spring.Objects.Factory.Xml
|
||||
{
|
||||
XmlObjectFactory xof
|
||||
= new XmlObjectFactory(
|
||||
new ReadOnlyXmlTestResource("satisfiedAllDependencyCheck.xml", GetType()));
|
||||
new ReadOnlyXmlTestResource("satisfiedalldependencycheck.xml", GetType()));
|
||||
DependenciesObject a = (DependenciesObject) xof.GetObject("a");
|
||||
Assert.AreEqual(a.Age, 33);
|
||||
Assert.IsNotNull(a.Name);
|
||||
@@ -1346,7 +1346,7 @@ namespace Spring.Objects.Factory.Xml
|
||||
try
|
||||
{
|
||||
new XmlObjectFactory(
|
||||
new ReadOnlyXmlTestResource("classNotFound.xml", GetType()));
|
||||
new ReadOnlyXmlTestResource("classnotfound.xml", GetType()));
|
||||
}
|
||||
catch (ObjectDefinitionStoreException ex)
|
||||
{
|
||||
@@ -1356,6 +1356,7 @@ namespace Spring.Objects.Factory.Xml
|
||||
|
||||
#if !NETCOREAPP
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void AnObjectCanBeIstantiatedWithANotFullySpecifiedAssemblyName()
|
||||
{
|
||||
IResource resource = new ReadOnlyXmlTestResource("notfullyspecified.xml", GetType());
|
||||
@@ -1368,8 +1369,7 @@ namespace Spring.Objects.Factory.Xml
|
||||
[Test]
|
||||
public void ResourceAndInputStream()
|
||||
{
|
||||
//string filename = @"C:\temp\spring-test.properties";
|
||||
string filename = @"/temp/spring-test.properties";
|
||||
string filename = "./temp/spring-test.properties";
|
||||
FileInfo file = new FileInfo(filename);
|
||||
bool tempDirWasCreated = false;
|
||||
try
|
||||
|
||||
@@ -1,5 +1,5 @@
|
||||
/*
|
||||
* Copyright © 2002-2011 the original author or authors.
|
||||
* Copyright © 2002-2011 the original author or authors.
|
||||
*
|
||||
* Licensed under the Apache License, Version 2.0 (the "License");
|
||||
* you may not use this file except in compliance with the License.
|
||||
@@ -125,7 +125,7 @@ namespace Spring.Proxy
|
||||
{
|
||||
ConstructorInfo ci = typeof(FakeServiceKnownTypeAttribute).GetConstructor(new Type[] { typeof(Type) });
|
||||
CustomAttributeBuilder cab = new CustomAttributeBuilder(ci, new object[] { typeof(TestObject) });
|
||||
|
||||
|
||||
IProxyTypeBuilder builder = GetProxyBuilder();
|
||||
builder.TargetType = typeof(ClassWithFakeServiceKnownTypeAttribute);
|
||||
builder.TypeAttributes.Add(cab);
|
||||
@@ -273,6 +273,7 @@ namespace Spring.Proxy
|
||||
#if !MONO && !NETCOREAPP
|
||||
// http://connect.microsoft.com/VisualStudio/feedback/ViewFeedback.aspx?FeedbackID=94803
|
||||
[Test]
|
||||
[Platform("Win")]
|
||||
public void ProxySecurityAttribute()
|
||||
{
|
||||
IProxyTypeBuilder builder = GetProxyBuilder();
|
||||
|
||||
@@ -3,6 +3,7 @@
|
||||
<TargetFrameworks>net5.0;$(TargetFullFrameworkVersion)</TargetFrameworks>
|
||||
<NoWarn>$(NoWarn);SYSLIB0001;SYSLIB0003;SYSLIB0011</NoWarn>
|
||||
<ProduceReferenceAssembly>false</ProduceReferenceAssembly>
|
||||
<GenerateResourceUsePreserializedResources>true</GenerateResourceUsePreserializedResources>
|
||||
</PropertyGroup>
|
||||
<ItemGroup>
|
||||
<ProjectReference Include="..\..\..\src\Spring\Spring.Aop\Spring.Aop.csproj" />
|
||||
@@ -21,7 +22,7 @@
|
||||
<PackageReference Include="Newtonsoft.Json" Version="12.0.3" />
|
||||
<PackageReference Include="NUnit" Version="$(NUnitVersion)" />
|
||||
<PackageReference Include="NUnit3TestAdapter" Version="$(NUnitTestAdapterVersion)" />
|
||||
<PackageReference Include="System.Resources.Extensions" Version="4.7.1" />
|
||||
<PackageReference Include="System.Resources.Extensions" Version="5.0.0" />
|
||||
</ItemGroup>
|
||||
<ItemGroup Condition=" '$(TargetFramework)' == '$(TargetFullFrameworkVersion)' ">
|
||||
<Reference Include="Microsoft.CSharp" />
|
||||
@@ -45,12 +46,16 @@
|
||||
<Compile Remove="Util\ObjectUtilsTests.cs" />
|
||||
</ItemGroup>
|
||||
<ItemGroup>
|
||||
<Content Include="App.config">
|
||||
<None Include="App.config" Link="testhost.dll.config" CopyToOutputDirectory="PreserveNewest" />
|
||||
<None Include="App.config" Link="ReSharperTestRunner64.dll.config" CopyToOutputDirectory="PreserveNewest" />
|
||||
<None Include="Data\**\*">
|
||||
<Link>Data\%(RecursiveDir)%(Filename)%(Extension)</Link>
|
||||
<CopyToOutputDirectory>PreserveNewest</CopyToOutputDirectory>
|
||||
</Content>
|
||||
<Content Include="Data\**">
|
||||
</None>
|
||||
<None Include="Data\**\*">
|
||||
<Link>%(RecursiveDir)%(Filename)%(Extension)</Link>
|
||||
<CopyToOutputDirectory>PreserveNewest</CopyToOutputDirectory>
|
||||
</Content>
|
||||
</None>
|
||||
<Compile Remove="Context\Attributes\FailAssemblyObjectDefinitionScannerTests.cs" />
|
||||
<EmbeddedResource Include="Context\Attributes\*.xml" />
|
||||
<EmbeddedResource Include="Context\Support\*.xml" />
|
||||
@@ -71,9 +76,4 @@
|
||||
<EmbeddedResource Include="Resources\SimpleAppContext.xml" />
|
||||
<EmbeddedResource Include="TestResource.txt" />
|
||||
</ItemGroup>
|
||||
<Target Name="PostBuild" AfterTargets="PostBuildEvent">
|
||||
<Exec Command="xcopy "$(ProjectDir)Data" "$(OutDir)" /y /s /q /d" />
|
||||
<Exec Command="copy "$(ProjectDir)App.config" "$(OutDir)testhost.dll.config"" />
|
||||
<Exec Command="copy "$(ProjectDir)App.config" "$(OutDir)ReSharperTestRunner64.dll.config"" />
|
||||
</Target>
|
||||
</Project>
|
||||
@@ -14,16 +14,19 @@ namespace Spring
|
||||
[OneTimeSetUp]
|
||||
public void SetUp()
|
||||
{
|
||||
// while R# is broken (https://youtrack.jetbrains.com/issue/RSRP-451142)
|
||||
string codeBase = Assembly.GetExecutingAssembly().Location;
|
||||
UriBuilder uri = new UriBuilder(codeBase);
|
||||
string path = Uri.UnescapeDataString(uri.Path);
|
||||
var pathToUse = Path.GetDirectoryName(path);
|
||||
Directory.SetCurrentDirectory(pathToUse);
|
||||
|
||||
CultureInfo enUs = new CultureInfo("en-US");
|
||||
Thread.CurrentThread.CurrentCulture = enUs;
|
||||
Thread.CurrentThread.CurrentUICulture = enUs;
|
||||
try
|
||||
{
|
||||
// while R# is broken (https://youtrack.jetbrains.com/issue/RSRP-451142)
|
||||
string codeBase = Assembly.GetExecutingAssembly().Location;
|
||||
UriBuilder uri = new UriBuilder(codeBase);
|
||||
string path = Uri.UnescapeDataString(uri.Path);
|
||||
var pathToUse = Path.GetDirectoryName(path);
|
||||
Directory.SetCurrentDirectory(pathToUse);
|
||||
}
|
||||
catch
|
||||
{
|
||||
// ignored
|
||||
}
|
||||
}
|
||||
}
|
||||
}
|
||||
@@ -1,7 +1,7 @@
|
||||
#region License
|
||||
|
||||
/*
|
||||
* Copyright © 2002-2011 the original author or authors.
|
||||
* Copyright © 2002-2011 the original author or authors.
|
||||
*
|
||||
* Licensed under the Apache License, Version 2.0 (the "License");
|
||||
* you may not use this file except in compliance with the License.
|
||||
@@ -36,41 +36,39 @@ namespace Spring.Threading
|
||||
protected abstract IThreadStorage CreateStorage();
|
||||
|
||||
protected virtual void ThreadSetup()
|
||||
{}
|
||||
{
|
||||
}
|
||||
|
||||
protected virtual void ThreadCleanup()
|
||||
{}
|
||||
{
|
||||
}
|
||||
|
||||
[OneTimeSetUp]
|
||||
public void FixtureSetUp()
|
||||
[SetUp]
|
||||
public void SetUp()
|
||||
{
|
||||
ThreadSetup();
|
||||
}
|
||||
|
||||
[OneTimeTearDown]
|
||||
public void FixtureTearDown()
|
||||
[TearDown]
|
||||
public void TearDown()
|
||||
{
|
||||
// cleanup storage
|
||||
var storage = CreateStorage();
|
||||
storage.FreeNamedDataSlot("key");
|
||||
storage.FreeNamedDataSlot("KEY");
|
||||
storage.FreeNamedDataSlot("KeY");
|
||||
|
||||
ThreadCleanup();
|
||||
}
|
||||
|
||||
[TearDown]
|
||||
public void TearDown()
|
||||
{
|
||||
// cleanup storage
|
||||
IThreadStorage storage = CreateStorage();
|
||||
storage.FreeNamedDataSlot("key");
|
||||
storage.FreeNamedDataSlot("KEY");
|
||||
storage.FreeNamedDataSlot("KeY");
|
||||
}
|
||||
|
||||
[Test]
|
||||
public void IsCaseSensitive()
|
||||
{
|
||||
IThreadStorage storage = CreateStorage();
|
||||
var storage = CreateStorage();
|
||||
|
||||
object value1 = new object();
|
||||
object value2 = new object();
|
||||
object value3 = new object();
|
||||
var value1 = new object();
|
||||
var value2 = new object();
|
||||
var value3 = new object();
|
||||
|
||||
storage.SetData("key", value1);
|
||||
storage.SetData("KEY", value2);
|
||||
@@ -84,10 +82,10 @@ namespace Spring.Threading
|
||||
[Test]
|
||||
public void AllowReplaceData()
|
||||
{
|
||||
IThreadStorage storage = CreateStorage();
|
||||
var storage = CreateStorage();
|
||||
|
||||
object value1 = new object();
|
||||
object value2 = new object();
|
||||
var value1 = new object();
|
||||
var value2 = new object();
|
||||
|
||||
storage.SetData("key", value1);
|
||||
Assert.AreSame(value1, storage.GetData("key"));
|
||||
@@ -100,7 +98,7 @@ namespace Spring.Threading
|
||||
[Test]
|
||||
public void UnknownKeyReturnsNull()
|
||||
{
|
||||
IThreadStorage storage = CreateStorage();
|
||||
var storage = CreateStorage();
|
||||
|
||||
Assert.AreSame(null, storage.GetData("key"));
|
||||
}
|
||||
@@ -108,9 +106,9 @@ namespace Spring.Threading
|
||||
[Test]
|
||||
public void FreeNamedDataSlotRemovesData()
|
||||
{
|
||||
IThreadStorage storage = CreateStorage();
|
||||
var storage = CreateStorage();
|
||||
|
||||
object value1 = new object();
|
||||
var value1 = new object();
|
||||
storage.SetData("key", value1);
|
||||
Assert.AreSame(value1, storage.GetData("key"));
|
||||
storage.FreeNamedDataSlot("key");
|
||||
@@ -120,15 +118,15 @@ namespace Spring.Threading
|
||||
[Test]
|
||||
public void UsesDistinguishedStorageOnDifferentThreads()
|
||||
{
|
||||
IThreadStorage storage = CreateStorage();
|
||||
var storage = CreateStorage();
|
||||
|
||||
object value1 = new object();
|
||||
var value1 = new object();
|
||||
storage.SetData("key", value1);
|
||||
|
||||
ThreadTestHelper helper = new ThreadTestHelper(this,storage);
|
||||
var helper = new ThreadTestHelper(this, storage);
|
||||
helper.Execute();
|
||||
|
||||
Assert.AreNotSame( value1, helper.value );
|
||||
Assert.AreNotSame(value1, helper.value);
|
||||
Assert.IsNull(helper.value);
|
||||
}
|
||||
|
||||
@@ -149,7 +147,7 @@ namespace Spring.Threading
|
||||
|
||||
public void Execute()
|
||||
{
|
||||
Thread t = new Thread(new ThreadStart(this.Run));
|
||||
var t = new Thread(new ThreadStart(Run));
|
||||
t.Start();
|
||||
t.Join();
|
||||
}
|
||||
@@ -157,7 +155,7 @@ namespace Spring.Threading
|
||||
private void Run()
|
||||
{
|
||||
outer.ThreadSetup();
|
||||
value = this.storage.GetData("key");
|
||||
value = storage.GetData("key");
|
||||
}
|
||||
}
|
||||
|
||||
|
||||
@@ -1,7 +1,7 @@
|
||||
#region License
|
||||
|
||||
/*
|
||||
* Copyright © 2002-2011 the original author or authors.
|
||||
* Copyright © 2002-2011 the original author or authors.
|
||||
*
|
||||
* Licensed under the Apache License, Version 2.0 (the "License");
|
||||
* you may not use this file except in compliance with the License.
|
||||
@@ -50,6 +50,7 @@ namespace Spring.Data.NHibernate.Config
|
||||
}
|
||||
|
||||
[Test]
|
||||
[Ignore("TODO Connects to database")]
|
||||
public void ProxyDataAccessAndServiceLayer()
|
||||
{
|
||||
Assert.IsFalse(AopUtils.IsAopProxy( ctx["DbProvider"] ));
|
||||
|
||||
@@ -26,9 +26,6 @@
|
||||
</Reference>
|
||||
</ItemGroup>
|
||||
<ItemGroup>
|
||||
<Compile Include="..\GenCommonAssemblyInfo.cs">
|
||||
<Link>GenCommonAssemblyInfo.cs</Link>
|
||||
</Compile>
|
||||
<EmbeddedResource Include="Messaging\Ems\Core\EmsTemplateTests.xml" />
|
||||
<EmbeddedResource Include="Messaging\Ems\Config\EmsNamespaceHandlerTests.xml" />
|
||||
<EmbeddedResource Include="Messaging\Ems\Listener\SimpleMessageListenerContainerTests.xml" />
|
||||
|
||||
@@ -19,13 +19,11 @@
|
||||
<PackageReference Include="NUnit3TestAdapter" Version="$(NUnitTestAdapterVersion)" />
|
||||
</ItemGroup>
|
||||
<ItemGroup>
|
||||
<Content Include="App.config">
|
||||
<None Include="App.config">
|
||||
<Link>testhost.dll.config</Link>
|
||||
<CopyToOutputDirectory>PreserveNewest</CopyToOutputDirectory>
|
||||
</Content>
|
||||
</None>
|
||||
<EmbeddedResource Include="Messaging\Nms\Integration\SimpleMessageListenerContainerTests.xml" />
|
||||
<EmbeddedResource Include="Messaging\Nms\Config\NmsNamespaceHandlerTests.xml" />
|
||||
</ItemGroup>
|
||||
<Target Name="PostBuild" AfterTargets="PostBuildEvent">
|
||||
<Exec Command="copy "$(ProjectDir)App.config" "$(OutDir)testhost.dll.config"" />
|
||||
</Target>
|
||||
</Project>
|
||||
@@ -569,7 +569,7 @@ namespace Spring.Scheduling.Quartz
|
||||
factoryObject.AfterPropertiesSet();
|
||||
await factoryObject.Start();
|
||||
|
||||
Thread.Sleep(500);
|
||||
await Task.Delay(TimeSpan.FromSeconds(1));
|
||||
Assert.IsTrue(DummyJob.count > 0);
|
||||
Assert.AreEqual(DummyJob.count, taskExecutor.count);
|
||||
|
||||
@@ -601,7 +601,7 @@ namespace Spring.Scheduling.Quartz
|
||||
factoryObject.AfterPropertiesSet();
|
||||
await factoryObject.Start();
|
||||
|
||||
DummyRunnable.runEvent.WaitOne(500);
|
||||
DummyRunnable.runEvent.WaitOne(1000);
|
||||
Assert.IsTrue(DummyRunnable.count > 0);
|
||||
|
||||
factoryObject.Dispose();
|
||||
@@ -742,7 +742,7 @@ namespace Spring.Scheduling.Quartz
|
||||
factoryObject.AfterPropertiesSet();
|
||||
await factoryObject.Start();
|
||||
|
||||
Thread.Sleep(500);
|
||||
await Task.Delay(TimeSpan.FromSeconds(1));
|
||||
Assert.AreEqual(10, DummyRunnable.param);
|
||||
Assert.IsTrue(DummyRunnable.count > 0);
|
||||
|
||||
@@ -777,7 +777,7 @@ namespace Spring.Scheduling.Quartz
|
||||
factoryObject.AfterPropertiesSet();
|
||||
await factoryObject.Start();
|
||||
|
||||
Thread.Sleep(500);
|
||||
await Task.Delay(TimeSpan.FromSeconds(1));
|
||||
Assert.AreEqual(10, DummyJobObject.param);
|
||||
Assert.IsTrue(DummyJobObject.count > 0);
|
||||
|
||||
@@ -800,7 +800,7 @@ namespace Spring.Scheduling.Quartz
|
||||
factoryObject.AfterPropertiesSet();
|
||||
await factoryObject.Start();
|
||||
|
||||
Thread.Sleep(500);
|
||||
await Task.Delay(TimeSpan.FromSeconds(1));
|
||||
Assert.AreEqual(10, DummyJob.param);
|
||||
Assert.IsTrue(DummyJob.count > 0);
|
||||
|
||||
|
||||
@@ -0,0 +1,35 @@
|
||||
#region License
|
||||
// /*
|
||||
// * Copyright 2018 the original author or authors.
|
||||
// *
|
||||
// * Licensed under the Apache License, Version 2.0 (the "License");
|
||||
// * you may not use this file except in compliance with the License.
|
||||
// * You may obtain a copy of the License at
|
||||
// *
|
||||
// * http://www.apache.org/licenses/LICENSE-2.0
|
||||
// *
|
||||
// * Unless required by applicable law or agreed to in writing, software
|
||||
// * distributed under the License is distributed on an "AS IS" BASIS,
|
||||
// * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
|
||||
// * See the License for the specific language governing permissions and
|
||||
// * limitations under the License.
|
||||
// */
|
||||
#endregion
|
||||
|
||||
using NUnitAspEx;
|
||||
using NUnitAspEx.Client;
|
||||
|
||||
namespace Spring.Web.Conversation
|
||||
{
|
||||
public static class HttpWebclientExtensions
|
||||
{
|
||||
|
||||
public static HttpWebClient CreateClientWithDefaultPort(this IAspFixtureHost host)
|
||||
{
|
||||
HttpWebClient clnt = host.CreateWebClient();
|
||||
// fix port which otherwise defaults to -1 breaking everything
|
||||
clnt.BaseAddress = clnt.BaseAddress.Replace("aspfixturehost/", "aspfixturehost:80/");
|
||||
return clnt;
|
||||
}
|
||||
}
|
||||
}
|
||||
Binary file not shown.
@@ -92,7 +92,7 @@
|
||||
<assemblyIdentity name="System.Data.SQLite"
|
||||
publicKeyToken="db937bc2d44ff139"
|
||||
culture="neutral"/>
|
||||
<bindingRedirect oldVersion="0.0.0.0-65535.65535.65535.65535" newVersion="1.0.91.0"/>
|
||||
<bindingRedirect oldVersion="0.0.0.0-65535.65535.65535.65535" newVersion="1.0.113.0"/>
|
||||
</dependentAssembly>
|
||||
</assemblyBinding>
|
||||
</runtime>
|
||||
|
||||
@@ -1,7 +1,8 @@
|
||||
<Project Sdk="Microsoft.NET.Sdk">
|
||||
<PropertyGroup>
|
||||
<TargetFramework>net461</TargetFramework>
|
||||
<Configurations>Debug;Release</Configurations>
|
||||
<ContentSQLiteInteropFiles>true</ContentSQLiteInteropFiles>
|
||||
<PlatformTarget>x86</PlatformTarget>
|
||||
</PropertyGroup>
|
||||
<ItemGroup>
|
||||
<ProjectReference Include="..\..\..\src\Spring\Spring.Aop\Spring.Aop.csproj" />
|
||||
@@ -15,16 +16,13 @@
|
||||
<PackageReference Include="Microsoft.NET.Test.Sdk" Version="$(MicrosoftTestSDKVersion)" />
|
||||
<PackageReference Include="NUnit" Version="$(NUnitVersion)" />
|
||||
<PackageReference Include="NUnit3TestAdapter" Version="$(NUnitTestAdapterVersion)" />
|
||||
<PackageReference Include="System.Data.SQLite.Core" Version="1.0.113.7" PrivateAssets="None" />
|
||||
</ItemGroup>
|
||||
<ItemGroup>
|
||||
<Reference Include="NUnitAspEx">
|
||||
<HintPath>..\..\..\lib\Net\2.0\NUnitAspEx.dll</HintPath>
|
||||
<SpecificVersion>False</SpecificVersion>
|
||||
</Reference>
|
||||
<Reference Include="System.Data.SQLite, Version=1.0.80.0, Culture=neutral, PublicKeyToken=db937bc2d44ff139, processorArchitecture=x86">
|
||||
<HintPath>..\Spring.Web.Conversation.NHibernate5.Tests\lib\net\2.0\System.Data.SQLite.dll</HintPath>
|
||||
<SpecificVersion>False</SpecificVersion>
|
||||
</Reference>
|
||||
<Reference Include="System.Web" />
|
||||
</ItemGroup>
|
||||
<ItemGroup>
|
||||
@@ -61,4 +59,5 @@
|
||||
<Content Include="Data\Spring\Conversation\WebConversationStateTest\TimeOut_WithTimeOut.aspx" />
|
||||
<EmbeddedResource Include="Entities\*.hbm.xml" />
|
||||
</ItemGroup>
|
||||
|
||||
</Project>
|
||||
@@ -0,0 +1,22 @@
|
||||
using System;
|
||||
using System.IO;
|
||||
using NUnit.Framework;
|
||||
|
||||
namespace Spring
|
||||
{
|
||||
[SetUpFixture]
|
||||
public class TestAssemblySetup
|
||||
{
|
||||
[OneTimeSetUp]
|
||||
public void SetUp()
|
||||
{
|
||||
// work around getting interop assembly to correct directory
|
||||
var requiredFile = Path.Combine(Environment.CurrentDirectory, "SQLite.Interop.dll");
|
||||
var fileToUse = Path.Combine(Environment.CurrentDirectory, "x86", "SQLite.Interop.dll");
|
||||
if (!File.Exists(requiredFile) && File.Exists(fileToUse))
|
||||
{
|
||||
File.Copy(fileToUse, requiredFile);
|
||||
}
|
||||
}
|
||||
}
|
||||
}
|
||||
@@ -8,12 +8,4 @@
|
||||
<add name="SQLite Data Provider" invariant="System.Data.SQLite" description=".Net Framework Data Provider for SQLite" type="System.Data.SQLite.SQLiteFactory, System.Data.SQLite"/>
|
||||
</DbProviderFactories>
|
||||
</system.data>
|
||||
<runtime>
|
||||
<assemblyBinding xmlns="urn:schemas-microsoft-com:asm.v1">
|
||||
<dependentAssembly>
|
||||
<assemblyIdentity name="System.Data.SQLite" publicKeyToken="db937bc2d44ff139" culture="neutral"/>
|
||||
<bindingRedirect oldVersion="0.0.0.0-65535.65535.65535.65535" newVersion="1.0.80.0"/>
|
||||
</dependentAssembly>
|
||||
</assemblyBinding>
|
||||
</runtime>
|
||||
</configuration>
|
||||
|
||||
Binary file not shown.
Binary file not shown.
File diff suppressed because it is too large
Load Diff
Binary file not shown.
Binary file not shown.
Binary file not shown.
File diff suppressed because it is too large
Load Diff
Binary file not shown.
Binary file not shown.
Binary file not shown.
File diff suppressed because it is too large
Load Diff
Binary file not shown.
Binary file not shown.
Binary file not shown.
File diff suppressed because it is too large
Load Diff
Binary file not shown.
Binary file not shown.
@@ -28,7 +28,14 @@
|
||||
</ItemGroup>
|
||||
<ItemGroup>
|
||||
<Compile Include="..\Spring.Core.Tests\TestAssemblySetup.cs" Link="TestAssemblySetup.cs" />
|
||||
<Content Include="Data\**\*" CopyToOutputDirectory="PreserveNewest" />
|
||||
<None Include="Data\**\*">
|
||||
<Link>Data\%(RecursiveDir)%(Filename)%(Extension)</Link>
|
||||
<CopyToOutputDirectory>PreserveNewest</CopyToOutputDirectory>
|
||||
</None>
|
||||
<None Include="Data\**\*">
|
||||
<Link>%(RecursiveDir)%(Filename)%(Extension)</Link>
|
||||
<CopyToOutputDirectory>PreserveNewest</CopyToOutputDirectory>
|
||||
</None>
|
||||
<Content Include="Data\Spring\Context\Support\WebApplicationContextTests\Dummy.aspx" />
|
||||
<Content Include="Data\Spring\Objects\Factory\Support\TestForm.aspx" />
|
||||
<Content Include="Data\Spring\Web\Support\LocalResourceManagerTests\WithoutResources.aspx" />
|
||||
@@ -42,7 +49,4 @@
|
||||
<EmbeddedResource Include="Context\Support\*.xml" />
|
||||
<EmbeddedResource Include="Web\Support\ControlInterceptionTests.objects.xml" />
|
||||
</ItemGroup>
|
||||
<Target Name="PostBuild" AfterTargets="PostBuildEvent">
|
||||
<Exec Command="xcopy "$(ProjectDir)Data" "$(OutDir)" /y /s /q /d" />
|
||||
</Target>
|
||||
</Project>
|
||||
@@ -1,7 +1,7 @@
|
||||
#region License
|
||||
|
||||
/*
|
||||
* Copyright © 2002-2011 the original author or authors.
|
||||
* Copyright © 2002-2011 the original author or authors.
|
||||
*
|
||||
* Licensed under the Apache License, Version 2.0 (the "License");
|
||||
* you may not use this file except in compliance with the License.
|
||||
|
||||
Reference in New Issue
Block a user